4LF7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7I00
4X62E 2UXBI 3K17A 1HNWE 2HFSA 3CWVA 4HYMA 4JV5I 1I94I 2WW4A 2UUCE 4JI5E 4JI0E 4LF8E 2HHHE 1Z5BA 4DV4E 4JI1E 3JAMQ 4JI2E 1IBME 1U2RA 3D4JA 4FW9A 4DXLA 4JI4E 4OX9E 4HY1A 1HR0E 1N36I 2A2CA 1NHIA 4DV0I 3OTOE 1Z0TA 1XNRE 4EMDA 5GMDA 4HACA 5IWAE 4JI6E 3T1HI 4DV7I 1H7UA 1XNQE 4DPYA 1FNMA 4UTGA 1ZM4A 4DR4E 4FWHA 5LMUE 2F4VE 3T1YE 2HK2A 2J7KA 1PIEA 4HXZA 4JI7E 2EFGA 4P7AA 2VQEE 4PRVA 1XMQE 4FN5A 2V34A 2V8PA 1N0UA 4X64I 2E5LE 3ZKBA 4DUZI 1Z5AA 4B3RE 3WU4A 3PYEA 4X65I 4DR2I 4B3MI 1IBLE 5BR8E 1ZXMA 1XMOI 3LNUA 4DU8A 4P52A 2UUBI 2UUAE 4LFBE 5A2QC 4NXNI 2VQFE 3V5RA 4LF9I 1KTVA 1H72C 4GKKI 4DV6E 4K0KI 4AQYI 3B8HA 4LF5I 2Q2EB 2BV3A 3PYFA 4GKJI 5IT9C 4LFAI 4LF4I 4DV3E 1RREA 2UU9E 1S4EA 2BM1A 2HKEA 1KKHA 4DR6E 4MYTA 2HKJA 4DV2I 4WUCA 1ZM2A 4DPWA 1MG7A 4DR7I 4X66E 1Z0BA 4USKA 4DUYE 1B62A 2V2VA 4XTJA 1PVGA 1B63A 2UXCE 4LF6E 1UEKA 4MYUA 4JI8I 1FWLA 4YHHI 3ZZUA 1S16A 2VF3A 3Q1QA 3K1JA 1N32E 1PKPA 5FLXC 4X62I 1Z0VA 1FI4A 3LPSA 1DARA 4JI3E 1HNWI 4B3SE 2ZM6E 1WUUA 4LF7E 3J80C 4ED4A 4DV0E 4ZVIA 3ZZ0A 2UUCI 3QT7A 4JI5I 4NXME 4JI0I 2X7IA 1KVKA 4LF8I 2HHHI 4JI1I 4DR1E 1MU5A 4JI2I 1IBMI 4UT4A 2UXDE 1ZM9A 4DV5E 1A6FA 2OI2A 4JI4I 1H74A 4OX9I 3QT5A 5LL6R 3V2UC 3LTOA 3OTOI 4Z7CA 4WUBA 1XNRI 2NPFA 1D6TA 3WU5A 4JI6I 1NZ0A 3JAMC 1XNQI 1IBKE 4I3HA 1HNXE 2HK3A 3PYDA 2V2ZA 4LFCE 4DPTA 4KQVA 3WU6A 4DPUA 5IT9Q 4DR3E 2F4VI 3T1YI 1FKAE 1XMOE 4KHPE 4JI7I 1XHKA 4NXNE 1EI1A 2VQEI 4DV1E 1Z59A 4LF9E 1VISA 3J7AM 5LMNE 1Z0EA 1XMQI 1H7SA 4USMA 4AQYE 4B3TI 3QT6A 2E5LI 4GKJE 1HNZE 3ZZTA 4LFAE 1N33E 4PRXA 1N34E 4B3RI 3B78A 4JYAE 4DR5I 1IBLI 5BR8I 1J5EE 1FJGE 4LFBI 2UUAI 3J81C 4YY3I 1QZRA 5FLXQ 2R42A 2VQFI 2UXBE 4DV6I 4FWDA 2XEXA 3J80Q 4WUDA 4JV5E 1I94E 3J7AG 1ZM3A 4DV3I 2E1RA 2UU9I 2V2QA 2GS8A 3ZM7A 1K47A 4HACB 4DR6I 4URLA 1FWKA 2CZ9A 4Z7YA 4X66I 1N36E 1Z5CA 4DUYI 4DPXA 2UXCI 4LF6I 2ZBKB 4DV4I 3T1HE 4DV7E 2DEIA 3M6AA 1N32I 2R3VA 4RPFA 5L3JA 4JI3I 1KIJA 1OJ4A 4B3SI 2ZM6I 4LF7I 1HR0I 1Z0GA 4R1FA 4NXMI 3HULA 3GONA 5A2QQ 1NHHA 1RR9A 3ZKDA 5IWAI 4DR1I 2ZITA 4JG4A 2UXDI 4DV5I 4X64E 4DUZE 4DR4I 1MX0A 5LMUI 4X65E 4DR2E 1BKNA 4B3ME 2DEJA 3J81Q 2UUBE 1NHJA 1IBKI 4GKKE 4B3TE 2HFUA 1HNXI 4K0KE 4LF5E 4LFCI 5GMEA 1N0VC 4DR3I 3QT8A 1H73A 2X36A 4LF4E 4FWGA 4DR5E 4KHPI 4M1KA 4YY3E 4PU9A 1ELOA 4DV1I 5LMNI 3B82A 4DV2E 3PYGA 3H4LA 4DR7E 2A2DA 1Z0CA 1HNZI 3F0NA 3WU3A 1N33I 1N34I 4JYAI 1EA6A 2LJPA 1J5EI 1FJGI 4JI8E 1Z0WA 2AJ4A 4YHHE 1ZXNA 2BM0A 4DU7A
chains in the Genus database with same CATH superfamily
2PO2B 4X62E 2UXBI 3K17A 2BR2A 1HNWE 2HFSA 3CWVA 2JEBB 4LCGA 4HYMA 4JV5I 4FW7A 3P76A 1I94I 3Q6NA 2WW4A 2UUCE 4JI5E 4AM3A 1YH8A 4JI0E 4LF8E 2HHHE 1Z5BA 4DV4E 4JI1E 3JAMQ 4JI2E 4OKGA 1IBME 1U2RA 3D4JA 4FW9A 4DXLA 3Q6MA 2VESA 4LOMA 4JI4E 4QNJA 4OX9E 4HY1A 1HR0E 4BA1A 1N36I 1OYSA 2C38A 2A2CA 1NHIA 2O1WA 4DV0I 1UDNA 2GQ0A 3OTOE 2F1DA 1Z0TA 1P42A 1XNRE 2PNLA 4FW6A 4EMDA 5GMDA 4HACA 5IWAE 4JI6E 3T1HI 4DV7I 1H7UA 1XNQE 4DPYA 1FNMA 5C0XA 2IESA 4UTGA 3B4TA 1ZM4A 4DR4E 4FWHA 5LMUE 2JE6B 2F4VE 3T1YE 2HK2A 2J7KA 4IFDF 1PIEA 4HXZA 4JI7E 2EFGA 4FW5A 4OO1F 4P7AA 4IS9A 2O1TA 5JEAA 2VQEE 4PRVA 4ISAA 1XMQE 4FN5A 2V34A 2BA1D 4IZJB 2V8PA 1N0UA 4X64I 2E5LE 3ZKBA 4DUZI 3GCMA 1Z5AA 2NN6F 3NZKA 4B3RE 3WU4A 3PYEA 4AIDA 4X65I 4DR2I 4B3MI 3P06A 1IBLE 5BR8E 1ZXMA 4IFDE 1XMOI 4FW3A 3LNUA 4DU8A 4OO1E 4P52A 2UUBI 2UUAE 4LFBE 5A2QC 2WNRB 4NXNI 2VQFE 3UHMA 3V5RA 2JEAB 4LF9I 1KTVA 1H72C 4GKKI 4BA2A 4DV6E 2Z5EA 4K0KI 3P3EA 4AQYI 2Z5CB 3B8HA 4LF5I 2BA0D 2Q2EB 4MU4A 4IFDD 2C37A 2BV3A 3PYFA 4IZKB 4GKJI 5IT9C 4OO1D 4LFAI 4LF4I 2NN6E 4DV3E 4J3DA 1RREA 2C39B 2UU9E 2O1UA 1R6MA 1S4EA 2BM1A 2HKEA 2CGEA 1KKHA 5K36A 1USVA 4DR6E 4MYTA 5ELWA 2HKJA 3KRNA 4N3OA 4DV2I 4WUCA 2PO1A 1ZM2A 1UDOA 2NN6A 4DPWA 3H1CA 1MG7A 4DR7I 2PO0A 4X66E 4BA1B 1Y6ZA 5C0XF 1Z0BA 4USKA 4DUYE 1B62A 2V2VA 4XTJA 1PVGA 1B63A 2UXCE 4LF6E 1UEKA 4MYUA 4JI8I 1FWLA 4YHHI 4LCFA 3ZZUA 1S16A 2VF3A 3Q1QA 2WP8A 3K1JA 1N32E 5DRRA 1PKPA 5FLXC 4GQUA 4X62I 2PNZA 1YHCA 1Z0VA 1FI4A 3LPSA 1DARA 5JEAF 4IFDC 5DNXA 4JI3E 1HNWI 4OO1C 1R6LA 4B3SE 2ZM6E 1WUUA 4LF7E 3J80C 4ED4A 4DV0E 4ZVIA 5C0XE 3L7ZB 4OZEA 3ZZ0A 2UUCI 3QT7A 4JI5I 4NXME 4JI0I 2BA1G 2X7IA 1KVKA 4LF8I 2HHHI 1OYRA 4JI1I 4DR1E 1MU5A 4JI2I 1IBMI 2PO2A 4UT4A 2NN6C 2IOQA 3P3CA 3M85D 2UXDE 1ZM9A 4DV5E 5C0XD 1A6FA 5JEAE 2OI2A 4JI4I 1H74A 4OX9I 3GMEA 3QT5A 2JEBA 5LL6R 3V2UC 3LTOA 3OTOI 4Z7CA 4WUBA 1XNRI 3DD6A 2NPFA 1D6TA 3WU5A 4JI6I 1NZ0A 2BA0G 1OYPA 2AE8A 4U3BA 3JAMC 5JEAD 1XNQI 4BA2B 1IBKE 2Z5BB 4I3HA 1HNXE 2HK3A 3PYDA 2V2ZA 4IFDB 5K36F 4LFCE 4DPTA 1E3PA 4OO1B 4KQVA 3WU6A 4DPUA 4MU1A 5IT9Q 4DR3E 2F4VI 3T1YI 1FKAE 1UDQA 1XMOE 4KHPE 4JI7I 1XHKA 4FW4A 2IERA 4NXNE 1EI1A 5EKWA 2VQEI 4DV1E 2PNMA 1Z59A 4LF9E 1VISA 4NBQA 3J7AM 5LMNE 1Z0EA 5C0XC 1XMQI 2BR2B 2NN6B 1H7SA 4USMA 4AQYE 4B3TI 3QT6A 2E5LI 5K36E 4GKJE 1HNZE 3ZZTA 4LFAE 2JE6A 1N33E 4PRXA 5DNLA 1N34E 4B3RI 3B78A 3HKMA 4JYAE 4DR5I 1IBLI 5BR8I 1J5EE 1FJGE 2J65A 5JEAC 4LFBI 2UUAI 3J81C 4YY3I 1QZRA 4MQYA 5FLXQ 2R42A 2VQFI 2UXBE 5K36D 4IZJA 4DV6I 3U1YA 4FWDA 2XEXA 2NN6D 3J80Q 4WUDA 1VI7A 2C38B 4JV5E 1I94E 3J7AG 1ZM3A 4DV3I 3PS2A 2E1RA 2UU9I 2V2QA 3M85G 2GS8A 3ZM7A 1K47A 4HACB 4MU3A 2WNRA 1RHYA 4URLA 4DR6I 2JEAA 1FWKA 3K85A 5C0XB 2CZ9A 1USUA 4Z7YA 4X66I 2Z5CA 1N36E 3M7ND 4IZKA 1Z5CA 4DUYI 3PRYA 3PS1A 1Y4SA 2C39A 4DPXA 2UXCI 4LF6I 2GO4A 5JEAB 1Y4UA 2ZBKB 1XXEA 4DV4I 3T1HE 5K36C 4DV7E 2DEIA 3M6AA 1N32I 2R3VA 4RPFA 5L3JA 4JI3I 3CDIA 1KIJA 1OJ4A 4B3SI 2ZM6I 4LF7I 1HR0I 1Z0GA 4R1FA 2O1VA 2CVEA 4NXMI 3HULA 3GONA 1Y5YA 5A2QQ 1NHHA 1RR9A 3ZKDA 5IWAI 4DR1I 2ZITA 4JG4A 2UXDI 5DROA 4DV5I 4X64E 3P3GA 2C37B 4DUZE 4QNKA 4DR4I 1MX0A 4MDTA 5LMUI 3L7ZA 4X65E 4DR2E 1BKNA 4B3ME 2DEJA 3CDJA 3J81Q 2UUBE 5K36B 1NHJA 4MU0A 1IBKI 4GKKE 1UDSA 2PO1B 2CG9A 2GO3A 2HFUA 4B3TE 1HNXI 4K0KE 2PO0B 4LF5E 4LFCI 3PS3A 5GMEA 1N0VC 4DR3I 3QT8A 1H73A 5DRQA 2X36A 4LF4E 4AIMA 4FWGA 4DR5E 4KHPI 4M1KA 2IOPA 1HK7A 1Y60A 4YY3E 2JT2A 4PU9A 1ELOA 2WP8B 4DV1I 5FWKA 1E3HA 5LMNI 2PNZB 3M7NG 3B82A 4DV2E 5DRPA 2Z5BA 3PYGA 3H4LA 4DR7E 2A2DA 4IFDA 4IZJD 4LCHA 3U1KA 3HJCA 4OO1A 1Z0CA 3GLLA 5EL9A 1HNZI 3F0NA 4U3DA 3WU3A 1N33I 1N34I 4JYAI 1EA6A 2LJPA 1J5EI 4LPFA 1FJGI 4JI8E 1Z0WA 2AJ4A 2O3ZA 4YHHE 1ZXNA 2BM0A 4DU7A
chains in the Genus database with same CATH topology
4X62E 2UXBI 3K17A 1HNWE 2HFSA 3CWVA 4HYMA 4JV5I 1I94I 3Q6NA 2WW4A 2UUCE 4JI5E 4JI0E 4LF8E 2HHHE 1Z5BA 4DV4E 4JI1E 3JAMQ 4JI2E 1IBME 1U2RA 3D4JA 4FW9A 4DXLA 3Q6MA 4JI4E 4OX9E 4HY1A 1HR0E 1N36I 2A2CA 1NHIA 2O1WA 4DV0I 2GQ0A 3OTOE 1Z0TA 1XNRE 2PNLA 4EMDA 5GMDA 4HACA 5IWAE 4JI6E 3T1HI 4DV7I 1H7UA 1XNQE 4DPYA 1FNMA 4UTGA 1ZM4A 4DR4E 4FWHA 5LMUE 2F4VE 3T1YE 2HK2A 2J7KA 1PIEA 4HXZA 4JI7E 2EFGA 4P7AA 2O1TA 2VQEE 4PRVA 1XMQE 4FN5A 2V34A 4IZJB 2V8PA 1N0UA 4X64I 2E5LE 3ZKBA 4DUZI 1Z5AA 4B3RE 3WU4A 3PYEA 4X65I 4DR2I 4B3MI 3P06A 1IBLE 5BR8E 1ZXMA 1XMOI 3LNUA 4DU8A 4P52A 2UUBI 2UUAE 4LFBE 5A2QC 4NXNI 2VQFE 3V5RA 4LF9I 1KTVA 1H72C 4GKKI 4DV6E 2Z5EA 4K0KI 4AQYI 2Z5CB 3B8HA 4LF5I 2Q2EB 2BV3A 3PYFA 4IZKB 4GKJI 5IT9C 4LFAI 4LF4I 4DV3E 1RREA 2UU9E 2O1UA 1S4EA 2BM1A 2HKEA 2CGEA 1KKHA 1USVA 4DR6E 4MYTA 2HKJA 4N3OA 4DV2I 4WUCA 1ZM2A 4DPWA 1MG7A 4DR7I 4X66E 1Y6ZA 1Z0BA 4USKA 4DUYE 1B62A 2V2VA 4XTJA 1PVGA 1B63A 2UXCE 4LF6E 1UEKA 4MYUA 4JI8I 1FWLA 4YHHI 3ZZUA 1S16A 2VF3A 3Q1QA 3K1JA 1N32E 1PKPA 5FLXC 4X62I 1Z0VA 1FI4A 3LPSA 1DARA 4JI3E 1HNWI 4B3SE 2ZM6E 1WUUA 4LF7E 3J80C 4ED4A 4DV0E 4ZVIA 3ZZ0A 2UUCI 3QT7A 4JI5I 4NXME 4JI0I 2X7IA 1KVKA 4LF8I 2HHHI 4JI1I 4DR1E 1MU5A 4JI2I 1IBMI 4UT4A 2IOQA 2UXDE 1ZM9A 4DV5E 1A6FA 2OI2A 4JI4I 1H74A 4OX9I 3QT5A 5LL6R 3V2UC 3LTOA 3OTOI 4Z7CA 4WUBA 1XNRI 2NPFA 1D6TA 3WU5A 4JI6I 1NZ0A 3JAMC 1XNQI 1IBKE 2Z5BB 4I3HA 1HNXE 2HK3A 3PYDA 2V2ZA 4LFCE 4DPTA 4KQVA 3WU6A 4DPUA 5IT9Q 4DR3E 2F4VI 3T1YI 1FKAE 1XMOE 4KHPE 4JI7I 1XHKA 4NXNE 1EI1A 2VQEI 4DV1E 2PNMA 1Z59A 4LF9E 1VISA 3J7AM 5LMNE 1Z0EA 1XMQI 1H7SA 4USMA 4AQYE 4B3TI 3QT6A 2E5LI 4GKJE 1HNZE 3ZZTA 4LFAE 1N33E 4PRXA 1N34E 4B3RI 3B78A 4JYAE 4DR5I 1IBLI 5BR8I 1J5EE 1FJGE 4LFBI 2UUAI 3J81C 4YY3I 1QZRA 5FLXQ 2R42A 2VQFI 2UXBE 4IZJA 4DV6I 4FWDA 2XEXA 3J80Q 4WUDA 4JV5E 1I94E 3J7AG 1ZM3A 4DV3I 2E1RA 2UU9I 2V2QA 2GS8A 3ZM7A 1K47A 4HACB 4DR6I 4URLA 1FWKA 3K85A 2CZ9A 1USUA 4Z7YA 4X66I 2Z5CA 1N36E 4IZKA 1Z5CA 4DUYI 3PRYA 1Y4SA 4DPXA 2UXCI 4LF6I 1Y4UA 2ZBKB 4DV4I 3T1HE 4DV7E 2DEIA 3M6AA 1N32I 2R3VA 4RPFA 5L3JA 4JI3I 1KIJA 1OJ4A 4B3SI 2ZM6I 4LF7I 1HR0I 1Z0GA 4R1FA 2O1VA 4NXMI 3HULA 3GONA 5A2QQ 1NHHA 1RR9A 3ZKDA 5IWAI 4DR1I 2ZITA 4JG4A 2UXDI 4DV5I 4X64E 4DUZE 4DR4I 1MX0A 5LMUI 4X65E 4DR2E 1BKNA 4B3ME 2DEJA 3J81Q 2UUBE 1NHJA 1IBKI 4GKKE 2CG9A 4B3TE 2HFUA 1HNXI 4K0KE 4LF5E 4LFCI 5GMEA 1N0VC 4DR3I 3QT8A 1H73A 2X36A 4LF4E 4FWGA 4DR5E 4KHPI 4M1KA 2IOPA 1HK7A 4YY3E 4PU9A 1ELOA 4DV1I 5FWKA 5LMNI 3B82A 4DV2E 2Z5BA 3PYGA 3H4LA 4DR7E 2A2DA 4IZJD 3HJCA 1Z0CA 1HNZI 3F0NA 3WU3A 1N33I 1N34I 4JYAI 1EA6A 2LJPA 1J5EI 1FJGI 4JI8E 1Z0WA 2AJ4A 4YHHE 1ZXNA 2BM0A 4DU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 E;  2UXB I;  3K17 A;  1HNW E;  2HFS A;  3CWV A;  4HYM A;  4JV5 I;  1I94 I;  2WW4 A;  2UUC E;  4JI5 E;  4JI0 E;  4LF8 E;  2HHH E;  1Z5B A;  4DV4 E;  4JI1 E;  3JAM Q;  4JI2 E;  1IBM E;  1U2R A;  3D4J A;  4FW9 A;  4DXL A;  4JI4 E;  4OX9 E;  4HY1 A;  1HR0 E;  1N36 I;  2A2C A;  1NHI A;  4DV0 I;  3OTO E;  1Z0T A;  1XNR E;  4EMD A;  5GMD A;  4HAC A;  5IWA E;  4JI6 E;  3T1H I;  4DV7 I;  1H7U A;  1XNQ E;  4DPY A;  1FNM A;  4UTG A;  1ZM4 A;  4DR4 E;  4FWH A;  5LMU E;  2F4V E;  3T1Y E;  2HK2 A;  2J7K A;  1PIE A;  4HXZ A;  4JI7 E;  2EFG A;  4P7A A;  2VQE E;  4PRV A;  1XMQ E;  4FN5 A;  2V34 A;  2V8P A;  1N0U A;  4X64 I;  2E5L E;  3ZKB A;  4DUZ I;  1Z5A A;  4B3R E;  3WU4 A;  3PYE A;  4X65 I;  4DR2 I;  4B3M I;  1IBL E;  5BR8 E;  1ZXM A;  1XMO I;  3LNU A;  4DU8 A;  4P52 A;  2UUB I;  2UUA E;  4LFB E;  5A2Q C;  4NXN I;  2VQF E;  3V5R A;  4LF9 I;  1KTV A;  1H72 C;  4GKK I;  4DV6 E;  4K0K I;  4AQY I;  3B8H A;  4LF5 I;  2Q2E B;  2BV3 A;  3PYF A;  4GKJ I;  5IT9 C;  4LFA I;  4LF4 I;  4DV3 E;  1RRE A;  2UU9 E;  1S4E A;  2BM1 A;  2HKE A;  1KKH A;  4DR6 E;  4MYT A;  2HKJ A;  4DV2 I;  4WUC A;  1ZM2 A;  4DPW A;  1MG7 A;  4DR7 I;  4X66 E;  1Z0B A;  4USK A;  4DUY E;  1B62 A;  2V2V A;  4XTJ A;  1PVG A;  1B63 A;  2UXC E;  4LF6 E;  1UEK A;  4MYU A;  4JI8 I;  1FWL A;  4YHH I;  3ZZU A;  1S16 A;  2VF3 A;  3Q1Q A;  3K1J A;  1N32 E;  1PKP A;  5FLX C;  4X62 I;  1Z0V A;  1FI4 A;  3LPS A;  1DAR A;  4JI3 E;  1HNW I;  4B3S E;  2ZM6 E;  1WUU A;  4LF7 E;  3J80 C;  4ED4 A;  4DV0 E;  4ZVI A;  3ZZ0 A;  2UUC I;  3QT7 A;  4JI5 I;  4NXM E;  4JI0 I;  2X7I A;  1KVK A;  4LF8 I;  2HHH I;  4JI1 I;  4DR1 E;  1MU5 A;  4JI2 I;  1IBM I;  4UT4 A;  2UXD E;  1ZM9 A;  4DV5 E;  1A6F A;  2OI2 A;  4JI4 I;  1H74 A;  4OX9 I;  3QT5 A;  5LL6 R;  3V2U C;  3LTO A;  3OTO I;  4Z7C A;  4WUB A;  1XNR I;  2NPF A;  1D6T A;  3WU5 A;  4JI6 I;  1NZ0 A;  3JAM C;  1XNQ I;  1IBK E;  4I3H A;  1HNX E;  2HK3 A;  3PYD A;  2V2Z A;  4LFC E;  4DPT A;  4KQV A;  3WU6 A;  4DPU A;  5IT9 Q;  4DR3 E;  2F4V I;  3T1Y I;  1FKA E;  1XMO E;  4KHP E;  4JI7 I;  1XHK A;  4NXN E;  1EI1 A;  2VQE I;  4DV1 E;  1Z59 A;  4LF9 E;  1VIS A;  3J7A M;  5LMN E;  1Z0E A;  1XMQ I;  1H7S A;  4USM A;  4AQY E;  4B3T I;  3QT6 A;  2E5L I;  4GKJ E;  1HNZ E;  3ZZT A;  4LFA E;  1N33 E;  4PRX A;  1N34 E;  4B3R I;  3B78 A;  4JYA E;  4DR5 I;  1IBL I;  5BR8 I;  1J5E E;  1FJG E;  4LFB I;  2UUA I;  3J81 C;  4YY3 I;  1QZR A;  5FLX Q;  2R42 A;  2VQF I;  2UXB E;  4DV6 I;  4FWD A;  2XEX A;  3J80 Q;  4WUD A;  4JV5 E;  1I94 E;  3J7A G;  1ZM3 A;  4DV3 I;  2E1R A;  2UU9 I;  2V2Q A;  2GS8 A;  3ZM7 A;  1K47 A;  4HAC B;  4DR6 I;  4URL A;  1FWK A;  2CZ9 A;  4Z7Y A;  4X66 I;  1N36 E;  1Z5C A;  4DUY I;  4DPX A;  2UXC I;  4LF6 I;  2ZBK B;  4DV4 I;  3T1H E;  4DV7 E;  2DEI A;  3M6A A;  1N32 I;  2R3V A;  4RPF A;  5L3J A;  4JI3 I;  1KIJ A;  1OJ4 A;  4B3S I;  2ZM6 I;  4LF7 I;  1HR0 I;  1Z0G A;  4R1F A;  4NXM I;  3HUL A;  3GON A;  5A2Q Q;  1NHH A;  1RR9 A;  3ZKD A;  5IWA I;  4DR1 I;  2ZIT A;  4JG4 A;  2UXD I;  4DV5 I;  4X64 E;  4DUZ E;  4DR4 I;  1MX0 A;  5LMU I;  4X65 E;  4DR2 E;  1BKN A;  4B3M E;  2DEJ A;  3J81 Q;  2UUB E;  1NHJ A;  1IBK I;  4GKK E;  4B3T E;  2HFU A;  1HNX I;  4K0K E;  4LF5 E;  4LFC I;  5GME A;  1N0V C;  4DR3 I;  3QT8 A;  1H73 A;  2X36 A;  4LF4 E;  4FWG A;  4DR5 E;  4KHP I;  4M1K A;  4YY3 E;  4PU9 A;  1ELO A;  4DV1 I;  5LMN I;  3B82 A;  4DV2 E;  3PYG A;  3H4L A;  4DR7 E;  2A2D A;  1Z0C A;  1HNZ I;  3F0N A;  3WU3 A;  1N33 I;  1N34 I;  4JYA I;  1EA6 A;  2LJP A;  1J5E I;  1FJG I;  4JI8 E;  1Z0W A;  2AJ4 A;  4YHH E;  1ZXN A;  2BM0 A;  4DU7 A; 
#chains in the Genus database with same CATH topology
 2PO2 B;  4X62 E;  2UXB I;  3K17 A;  2BR2 A;  1HNW E;  2HFS A;  3CWV A;  2JEB B;  4LCG A;  4HYM A;  4JV5 I;  4FW7 A;  3P76 A;  1I94 I;  3Q6N A;  2WW4 A;  2UUC E;  4JI5 E;  4AM3 A;  1YH8 A;  4JI0 E;  4LF8 E;  2HHH E;  1Z5B A;  4DV4 E;  4JI1 E;  3JAM Q;  4JI2 E;  4OKG A;  1IBM E;  1U2R A;  3D4J A;  4FW9 A;  4DXL A;  3Q6M A;  2VES A;  4LOM A;  4JI4 E;  4QNJ A;  4OX9 E;  4HY1 A;  1HR0 E;  4BA1 A;  1N36 I;  1OYS A;  2C38 A;  2A2C A;  1NHI A;  2O1W A;  4DV0 I;  1UDN A;  2GQ0 A;  3OTO E;  2F1D A;  1Z0T A;  1P42 A;  1XNR E;  2PNL A;  4FW6 A;  4EMD A;  5GMD A;  4HAC A;  5IWA E;  4JI6 E;  3T1H I;  4DV7 I;  1H7U A;  1XNQ E;  4DPY A;  1FNM A;  5C0X A;  2IES A;  4UTG A;  3B4T A;  1ZM4 A;  4DR4 E;  4FWH A;  5LMU E;  2JE6 B;  2F4V E;  3T1Y E;  2HK2 A;  2J7K A;  4IFD F;  1PIE A;  4HXZ A;  4JI7 E;  2EFG A;  4FW5 A;  4OO1 F;  4P7A A;  4IS9 A;  2O1T A;  5JEA A;  2VQE E;  4PRV A;  4ISA A;  1XMQ E;  4FN5 A;  2V34 A;  2BA1 D;  4IZJ B;  2V8P A;  1N0U A;  4X64 I;  2E5L E;  3ZKB A;  4DUZ I;  3GCM A;  1Z5A A;  2NN6 F;  3NZK A;  4B3R E;  3WU4 A;  3PYE A;  4AID A;  4X65 I;  4DR2 I;  4B3M I;  3P06 A;  1IBL E;  5BR8 E;  1ZXM A;  4IFD E;  1XMO I;  4FW3 A;  3LNU A;  4DU8 A;  4OO1 E;  4P52 A;  2UUB I;  2UUA E;  4LFB E;  5A2Q C;  2WNR B;  4NXN I;  2VQF E;  3UHM A;  3V5R A;  2JEA B;  4LF9 I;  1KTV A;  1H72 C;  4GKK I;  4BA2 A;  4DV6 E;  2Z5E A;  4K0K I;  3P3E A;  4AQY I;  2Z5C B;  3B8H A;  4LF5 I;  2BA0 D;  2Q2E B;  4MU4 A;  4IFD D;  2C37 A;  2BV3 A;  3PYF A;  4IZK B;  4GKJ I;  5IT9 C;  4OO1 D;  4LFA I;  4LF4 I;  2NN6 E;  4DV3 E;  4J3D A;  1RRE A;  2C39 B;  2UU9 E;  2O1U A;  1R6M A;  1S4E A;  2BM1 A;  2HKE A;  2CGE A;  1KKH A;  5K36 A;  1USV A;  4DR6 E;  4MYT A;  5ELW A;  2HKJ A;  3KRN A;  4N3O A;  4DV2 I;  4WUC A;  2PO1 A;  1ZM2 A;  1UDO A;  2NN6 A;  4DPW A;  3H1C A;  1MG7 A;  4DR7 I;  2PO0 A;  4X66 E;  4BA1 B;  1Y6Z A;  5C0X F;  1Z0B A;  4USK A;  4DUY E;  1B62 A;  2V2V A;  4XTJ A;  1PVG A;  1B63 A;  2UXC E;  4LF6 E;  1UEK A;  4MYU A;  4JI8 I;  1FWL A;  4YHH I;  4LCF A;  3ZZU A;  1S16 A;  2VF3 A;  3Q1Q A;  2WP8 A;  3K1J A;  1N32 E;  5DRR A;  1PKP A;  5FLX C;  4GQU A;  4X62 I;  2PNZ A;  1YHC A;  1Z0V A;  1FI4 A;  3LPS A;  1DAR A;  5JEA F;  4IFD C;  5DNX A;  4JI3 E;  1HNW I;  4OO1 C;  1R6L A;  4B3S E;  2ZM6 E;  1WUU A;  4LF7 E;  3J80 C;  4ED4 A;  4DV0 E;  4ZVI A;  5C0X E;  3L7Z B;  4OZE A;  3ZZ0 A;  2UUC I;  3QT7 A;  4JI5 I;  4NXM E;  4JI0 I;  2BA1 G;  2X7I A;  1KVK A;  4LF8 I;  2HHH I;  1OYR A;  4JI1 I;  4DR1 E;  1MU5 A;  4JI2 I;  1IBM I;  2PO2 A;  4UT4 A;  2NN6 C;  2IOQ A;  3P3C A;  3M85 D;  2UXD E;  1ZM9 A;  4DV5 E;  5C0X D;  1A6F A;  5JEA E;  2OI2 A;  4JI4 I;  1H74 A;  4OX9 I;  3GME A;  3QT5 A;  2JEB A;  5LL6 R;  3V2U C;  3LTO A;  3OTO I;  4Z7C A;  4WUB A;  1XNR I;  3DD6 A;  2NPF A;  1D6T A;  3WU5 A;  4JI6 I;  1NZ0 A;  2BA0 G;  1OYP A;  2AE8 A;  4U3B A;  3JAM C;  5JEA D;  1XNQ I;  4BA2 B;  1IBK E;  2Z5B B;  4I3H A;  1HNX E;  2HK3 A;  3PYD A;  2V2Z A;  4IFD B;  5K36 F;  4LFC E;  4DPT A;  1E3P A;  4OO1 B;  4KQV A;  3WU6 A;  4DPU A;  4MU1 A;  5IT9 Q;  4DR3 E;  2F4V I;  3T1Y I;  1FKA E;  1UDQ A;  1XMO E;  4KHP E;  4JI7 I;  1XHK A;  4FW4 A;  2IER A;  4NXN E;  1EI1 A;  5EKW A;  2VQE I;  4DV1 E;  2PNM A;  1Z59 A;  4LF9 E;  1VIS A;  4NBQ A;  3J7A M;  5LMN E;  1Z0E A;  5C0X C;  1XMQ I;  2BR2 B;  2NN6 B;  1H7S A;  4USM A;  4AQY E;  4B3T I;  3QT6 A;  2E5L I;  5K36 E;  4GKJ E;  1HNZ E;  3ZZT A;  4LFA E;  2JE6 A;  1N33 E;  4PRX A;  5DNL A;  1N34 E;  4B3R I;  3B78 A;  3HKM A;  4JYA E;  4DR5 I;  1IBL I;  5BR8 I;  1J5E E;  1FJG E;  2J65 A;  5JEA C;  4LFB I;  2UUA I;  3J81 C;  4YY3 I;  1QZR A;  4MQY A;  5FLX Q;  2R42 A;  2VQF I;  2UXB E;  5K36 D;  4IZJ A;  4DV6 I;  3U1Y A;  4FWD A;  2XEX A;  2NN6 D;  3J80 Q;  4WUD A;  1VI7 A;  2C38 B;  4JV5 E;  1I94 E;  3J7A G;  1ZM3 A;  4DV3 I;  3PS2 A;  2E1R A;  2UU9 I;  2V2Q A;  3M85 G;  2GS8 A;  3ZM7 A;  1K47 A;  4HAC B;  4MU3 A;  2WNR A;  1RHY A;  4URL A;  4DR6 I;  2JEA A;  1FWK A;  3K85 A;  5C0X B;  2CZ9 A;  1USU A;  4Z7Y A;  4X66 I;  2Z5C A;  1N36 E;  3M7N D;  4IZK A;  1Z5C A;  4DUY I;  3PRY A;  3PS1 A;  1Y4S A;  2C39 A;  4DPX A;  2UXC I;  4LF6 I;  2GO4 A;  5JEA B;  1Y4U A;  2ZBK B;  1XXE A;  4DV4 I;  3T1H E;  5K36 C;  4DV7 E;  2DEI A;  3M6A A;  1N32 I;  2R3V A;  4RPF A;  5L3J A;  4JI3 I;  3CDI A;  1KIJ A;  1OJ4 A;  4B3S I;  2ZM6 I;  4LF7 I;  1HR0 I;  1Z0G A;  4R1F A;  2O1V A;  2CVE A;  4NXM I;  3HUL A;  3GON A;  1Y5Y A;  5A2Q Q;  1NHH A;  1RR9 A;  3ZKD A;  5IWA I;  4DR1 I;  2ZIT A;  4JG4 A;  2UXD I;  5DRO A;  4DV5 I;  4X64 E;  3P3G A;  2C37 B;  4DUZ E;  4QNK A;  4DR4 I;  1MX0 A;  4MDT A;  5LMU I;  3L7Z A;  4X65 E;  4DR2 E;  1BKN A;  4B3M E;  2DEJ A;  3CDJ A;  3J81 Q;  2UUB E;  5K36 B;  1NHJ A;  4MU0 A;  1IBK I;  4GKK E;  1UDS A;  2PO1 B;  2CG9 A;  2GO3 A;  2HFU A;  4B3T E;  1HNX I;  4K0K E;  2PO0 B;  4LF5 E;  4LFC I;  3PS3 A;  5GME A;  1N0V C;  4DR3 I;  3QT8 A;  1H73 A;  5DRQ A;  2X36 A;  4LF4 E;  4AIM A;  4FWG A;  4DR5 E;  4KHP I;  4M1K A;  2IOP A;  1HK7 A;  1Y60 A;  4YY3 E;  2JT2 A;  4PU9 A;  1ELO A;  2WP8 B;  4DV1 I;  5FWK A;  1E3H A;  5LMN I;  2PNZ B;  3M7N G;  3B82 A;  4DV2 E;  5DRP A;  2Z5B A;  3PYG A;  3H4L A;  4DR7 E;  2A2D A;  4IFD A;  4IZJ D;  4LCH A;  3U1K A;  3HJC A;  4OO1 A;  1Z0C A;  3GLL A;  5EL9 A;  1HNZ I;  3F0N A;  4U3D A;  3WU3 A;  1N33 I;  1N34 I;  4JYA I;  1EA6 A;  2LJP A;  1J5E I;  4LPF A;  1FJG I;  4JI8 E;  1Z0W A;  2AJ4 A;  2O3Z A;  4YHH E;  1ZXN A;  2BM0 A;  4DU7 A; 
#chains in the Genus database with same CATH homology
 4X62 E;  2UXB I;  3K17 A;  1HNW E;  2HFS A;  3CWV A;  4HYM A;  4JV5 I;  1I94 I;  3Q6N A;  2WW4 A;  2UUC E;  4JI5 E;  4JI0 E;  4LF8 E;  2HHH E;  1Z5B A;  4DV4 E;  4JI1 E;  3JAM Q;  4JI2 E;  1IBM E;  1U2R A;  3D4J A;  4FW9 A;  4DXL A;  3Q6M A;  4JI4 E;  4OX9 E;  4HY1 A;  1HR0 E;  1N36 I;  2A2C A;  1NHI A;  2O1W A;  4DV0 I;  2GQ0 A;  3OTO E;  1Z0T A;  1XNR E;  2PNL A;  4EMD A;  5GMD A;  4HAC A;  5IWA E;  4JI6 E;  3T1H I;  4DV7 I;  1H7U A;  1XNQ E;  4DPY A;  1FNM A;  4UTG A;  1ZM4 A;  4DR4 E;  4FWH A;  5LMU E;  2F4V E;  3T1Y E;  2HK2 A;  2J7K A;  1PIE A;  4HXZ A;  4JI7 E;  2EFG A;  4P7A A;  2O1T A;  2VQE E;  4PRV A;  1XMQ E;  4FN5 A;  2V34 A;  4IZJ B;  2V8P A;  1N0U A;  4X64 I;  2E5L E;  3ZKB A;  4DUZ I;  1Z5A A;  4B3R E;  3WU4 A;  3PYE A;  4X65 I;  4DR2 I;  4B3M I;  3P06 A;  1IBL E;  5BR8 E;  1ZXM A;  1XMO I;  3LNU A;  4DU8 A;  4P52 A;  2UUB I;  2UUA E;  4LFB E;  5A2Q C;  4NXN I;  2VQF E;  3V5R A;  4LF9 I;  1KTV A;  1H72 C;  4GKK I;  4DV6 E;  2Z5E A;  4K0K I;  4AQY I;  2Z5C B;  3B8H A;  4LF5 I;  2Q2E B;  2BV3 A;  3PYF A;  4IZK B;  4GKJ I;  5IT9 C;  4LFA I;  4LF4 I;  4DV3 E;  1RRE A;  2UU9 E;  2O1U A;  1S4E A;  2BM1 A;  2HKE A;  2CGE A;  1KKH A;  1USV A;  4DR6 E;  4MYT A;  2HKJ A;  4N3O A;  4DV2 I;  4WUC A;  1ZM2 A;  4DPW A;  1MG7 A;  4DR7 I;  4X66 E;  1Y6Z A;  1Z0B A;  4USK A;  4DUY E;  1B62 A;  2V2V A;  4XTJ A;  1PVG A;  1B63 A;  2UXC E;  4LF6 E;  1UEK A;  4MYU A;  4JI8 I;  1FWL A;  4YHH I;  3ZZU A;  1S16 A;  2VF3 A;  3Q1Q A;  3K1J A;  1N32 E;  1PKP A;  5FLX C;  4X62 I;  1Z0V A;  1FI4 A;  3LPS A;  1DAR A;  4JI3 E;  1HNW I;  4B3S E;  2ZM6 E;  1WUU A;  4LF7 E;  3J80 C;  4ED4 A;  4DV0 E;  4ZVI A;  3ZZ0 A;  2UUC I;  3QT7 A;  4JI5 I;  4NXM E;  4JI0 I;  2X7I A;  1KVK A;  4LF8 I;  2HHH I;  4JI1 I;  4DR1 E;  1MU5 A;  4JI2 I;  1IBM I;  4UT4 A;  2IOQ A;  2UXD E;  1ZM9 A;  4DV5 E;  1A6F A;  2OI2 A;  4JI4 I;  1H74 A;  4OX9 I;  3QT5 A;  5LL6 R;  3V2U C;  3LTO A;  3OTO I;  4Z7C A;  4WUB A;  1XNR I;  2NPF A;  1D6T A;  3WU5 A;  4JI6 I;  1NZ0 A;  3JAM C;  1XNQ I;  1IBK E;  2Z5B B;  4I3H A;  1HNX E;  2HK3 A;  3PYD A;  2V2Z A;  4LFC E;  4DPT A;  4KQV A;  3WU6 A;  4DPU A;  5IT9 Q;  4DR3 E;  2F4V I;  3T1Y I;  1FKA E;  1XMO E;  4KHP E;  4JI7 I;  1XHK A;  4NXN E;  1EI1 A;  2VQE I;  4DV1 E;  2PNM A;  1Z59 A;  4LF9 E;  1VIS A;  3J7A M;  5LMN E;  1Z0E A;  1XMQ I;  1H7S A;  4USM A;  4AQY E;  4B3T I;  3QT6 A;  2E5L I;  4GKJ E;  1HNZ E;  3ZZT A;  4LFA E;  1N33 E;  4PRX A;  1N34 E;  4B3R I;  3B78 A;  4JYA E;  4DR5 I;  1IBL I;  5BR8 I;  1J5E E;  1FJG E;  4LFB I;  2UUA I;  3J81 C;  4YY3 I;  1QZR A;  5FLX Q;  2R42 A;  2VQF I;  2UXB E;  4IZJ A;  4DV6 I;  4FWD A;  2XEX A;  3J80 Q;  4WUD A;  4JV5 E;  1I94 E;  3J7A G;  1ZM3 A;  4DV3 I;  2E1R A;  2UU9 I;  2V2Q A;  2GS8 A;  3ZM7 A;  1K47 A;  4HAC B;  4DR6 I;  4URL A;  1FWK A;  3K85 A;  2CZ9 A;  1USU A;  4Z7Y A;  4X66 I;  2Z5C A;  1N36 E;  4IZK A;  1Z5C A;  4DUY I;  3PRY A;  1Y4S A;  4DPX A;  2UXC I;  4LF6 I;  1Y4U A;  2ZBK B;  4DV4 I;  3T1H E;  4DV7 E;  2DEI A;  3M6A A;  1N32 I;  2R3V A;  4RPF A;  5L3J A;  4JI3 I;  1KIJ A;  1OJ4 A;  4B3S I;  2ZM6 I;  4LF7 I;  1HR0 I;  1Z0G A;  4R1F A;  2O1V A;  4NXM I;  3HUL A;  3GON A;  5A2Q Q;  1NHH A;  1RR9 A;  3ZKD A;  5IWA I;  4DR1 I;  2ZIT A;  4JG4 A;  2UXD I;  4DV5 I;  4X64 E;  4DUZ E;  4DR4 I;  1MX0 A;  5LMU I;  4X65 E;  4DR2 E;  1BKN A;  4B3M E;  2DEJ A;  3J81 Q;  2UUB E;  1NHJ A;  1IBK I;  4GKK E;  2CG9 A;  4B3T E;  2HFU A;  1HNX I;  4K0K E;  4LF5 E;  4LFC I;  5GME A;  1N0V C;  4DR3 I;  3QT8 A;  1H73 A;  2X36 A;  4LF4 E;  4FWG A;  4DR5 E;  4KHP I;  4M1K A;  2IOP A;  1HK7 A;  4YY3 E;  4PU9 A;  1ELO A;  4DV1 I;  5FWK A;  5LMN I;  3B82 A;  4DV2 E;  2Z5B A;  3PYG A;  3H4L A;  4DR7 E;  2A2D A;  4IZJ D;  3HJC A;  1Z0C A;  1HNZ I;  3F0N A;  3WU3 A;  1N33 I;  1N34 I;  4JYA I;  1EA6 A;  2LJP A;  1J5E I;  1FJG I;  4JI8 E;  1Z0W A;  2AJ4 A;  4YHH E;  1ZXN A;  2BM0 A;  4DU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...