4LF7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7I00
2LJPA 3Q1QA 2A2DA 4B3ME 2HHHI 4M1KA 4NXNI 3WU5A 4DV1I 1KKHA 2HFSA 2HKJA 2ZITA 3J80Q 2UUCI 4Z7CA 4JI5I 4PU9A 1Z5CA 4JYAI 2E1RA 2BV3A 1HNXE 4LF9I 1I94I 4LFBE 2UXDI 1NZ0A 3K17A 3ZKBA 4LF8I 5LMNE 1KIJA 4JI7E 4JV5E 4YY3I 4DV0I 4LF7I 1KVKA 3ZKDA 2UUBE 1IBKE 4JI4E 1XNQI 4DV1E 4DU7A 3HULA 3ZZUA 1ELOA 4WUDA 1KTVA 1D6TA 1Z0WA 1ZM2A 4DPUA 4YHHI 3J81C 4FWHA 3T1YI 4DPWA 1N33E 3WU6A 4UT4A 2VQFE 4LF7E 5LL6R 1IBKI 4OX9E 4NXNE 3ZZTA 1XHKA 5IWAI 2HK3A 1N34E 3QT6A 4JI0E 2HHHE 4UTGA 2UXDE 1XMOE 1MX0A 1Z59A 1XMQI 5FLXQ 2R42A 4B3TI 2Q2EB 1HNZI 1FWKA 2XEXA 1H74A 2V2ZA 4X66E 1FWLA 1VISA 4DPTA 1IBLE 3PYDA 2GS8A 2UUAE 4DV0E 1N36I 2V2QA 1IBME 1MG7A 4DUZE 1FKAE 1N33I 1H73A 4DV6E 4WUBA 4YHHE 4DV2E 4JI1E 3J7AG 1NHIA 4DXLA 4EMDA 4NXME 5GMEA 4X62I 4B3TE 2V2VA 4AQYE 1PVGA 1K47A 2ZBKB 1XNQE 4DV7E 2WW4A 3LNUA 1PKPA 1HR0E 5A2QQ 2VQFI 1BKNA 4DPXA 2F4VI 1DARA 2J7KA 2OI2A 3QT8A 2CZ9A 4X65I 4FW9A 4DR6E 1HNXI 4PRVA 3OTOE 4DPYA 1A6FA 2AJ4A 4MYUA 1QZRA 4K0KI 2UUCE 4USKA 2NPFA 4DV3I 4XTJA 1IBMI 4DV6I 1H7SA 1XMOI 1FJGE 1RREA 1Z0EA 4JV5I 1RR9A 4HACB 4LF5I 4B3MI 4Z7YA 3QT7A 4K0KE 4LF4E 3F0NA 4LFBI 3JAMQ 3LTOA 4DV2I 2HFUA 4JYAE 3B8HA 4KQVA 4DR2I 4LFCE 4KHPE 4B3RE 4I3HA 1Z0CA 4LF6E 5GMDA 3T1HE 2ZM6I 1FI4A 1B63A 2VQEI 2DEIA 4JI6E 4HXZA 4GKKI 1Z0TA 1J5EI 3JAMC 2UUBI 1B62A 1EI1A 4X64E 2A2CA 3OTOI 4DR3I 4LF9E 5LMNI 1ZXNA 4DV4E 4DU8A 2ZM6E 1Z5BA 4MYTA 4JI3I 4DR6I 3WU4A 4P7AA 2F4VE 4LF4I 5LMUE 5L3JA 3J7AM 4X64I 4DR1I 2VF3A 4FN5A 4DR7E 1N0UA 4DR5E 4JI6I 2V34A 4KHPI 4LF6I 1MU5A 3T1HI 1OJ4A 4WUCA 4ZVIA 3PYGA 5A2QC 1N32I 1HNWI 1XMQE 1S16A 4JG4A 2HKEA 5IWAE 2UU9I 4DR3E 3B82A 4RPFA 2UXBE 1NHHA 4HYMA 1H7UA 4JI3E 1IBLI 1U2RA 2VQEE 2V8PA 4GKKE 5IT9C 4X62E 4DV7I 1ZM3A 3B78A 4NXMI 4X65E 4AQYI 3WU3A 3LPSA 1Z5AA 4DR7I 2UXBI 4B3SI 3QT5A 4JI4I 4R1FA 5FLXC 1UEKA 4LF5E 4LF8E 1HNWE 4DR4E 5LMUI 1ZXMA 1N32E 1N0VC 2X7IA 5BR8I 4ED4A 3D4JA 3K1JA 2E5LE 3J81Q 2BM0A 1Z0BA 4JI0I 1N34I 2UXCI 4LFAE 1FJGI 4DUYI 4YY3E 1XNRE 3PYEA 4P52A 4B3SE 1ZM9A 4DR2E 4X66I 1WUUA 2E5LI 4DV5I 4JI2E 4LFCI 1S4EA 3PYFA 5BR8E 3M6AA 1FNMA 1EA6A 1Z0GA 3V5RA 1XNRI 1J5EE 4DR4I 2EFGA 1ZM4A 4OX9I 4LFAI 4DUZI 4GKJI 1N36E 4HACA 1I94E 4B3RI 4JI1I 4JI8E 1HNZE 3V2UC 1PIEA 4HY1A 4JI2I 4JI5E 2DEJA 4DR5I 4DV4I 4JI7I 4GKJE 4DUYE 2UUAI 2UU9E 4DR1E 3ZM7A 4FWDA 2BM1A 3ZZ0A 4DV3E 1HR0I 4URLA 1Z0VA 3CWVA 3T1YE 3J80C 4USMA 2UXCE 3GONA 2HK2A 2X36A 4DV5E 5IT9Q 4PRXA 4JI8I 1H72C 3H4LA 4FWGA 2R3VA 1NHJA
chains in the Genus database with same CATH superfamily
2LJPA 3Q1QA 2A2DA 4B3ME 2O3ZA 2HHHI 5JEAE 4M1KA 3KRNA 4NXNI 3WU5A 4IFDA 4DV1I 2C38B 1E3PA 4IS9A 4BA1B 5K36F 1KKHA 2IOQA 2NN6C 2HFSA 3L7ZA 2HKJA 4OO1D 2IOPA 2ZITA 3J80Q 4Z7CA 2UUCI 4JI5I 1XXEA 4PU9A 1Z5CA 4JYAI 2E1RA 2BV3A 1HNXE 2JEAB 4BA2A 4LF9I 1I94I 4LFBE 4MDTA 2O1VA 2GQ0A 5DNXA 2UXDI 1NZ0A 4FW7A 3K17A 2Z5EA 3ZKBA 4LF8I 2JE6A 5LMNE 5C0XF 1KIJA 4JI7E 4JV5E 3U1YA 4YY3I 4FW5A 4DV0I 4LF7I 1KVKA 4OO1B 3ZKDA 2UUBE 1IBKE 2JE6B 3U1KA 4JI4E 1XNQI 4DV1E 4DU7A 3HULA 4MU0A 3ZZUA 1ELOA 4LCGA 4WUDA 2PO1A 1KTVA 1D6TA 1Z0WA 1ZM2A 4DPUA 1R6MA 4YHHI 3J81C 4FWHA 3T1YI 2CVEA 4DPWA 2PO1B 3WU6A 1N33E 4UT4A 5EL9A 2VQFE 4LF7E 5LL6R 2PO0A 2WP8B 1IBKI 4OX9E 5EKWA 4NXNE 3ZZTA 4IFDC 1XHKA 5IWAI 2HK3A 1N34E 3QT6A 4JI0E 2HHHE 4U3DA 4UTGA 1UDNA 2PO0B 2UXDE 2WP8A 2BR2A 1MX0A 1XMOE 1Z59A 2PNMA 1XMQI 5FLXQ 2R42A 4B3TI 2Q2EB 1HNZI 1FWKA 1OYPA 5JEAF 2XEXA 1H74A 2V2ZA 5DRRA 4X66E 1FWLA 1VISA 2C39B 4DPTA 1IBLE 3PYDA 2GS8A 4IFDB 2JEBA 2CG9A 5C0XB 2UUAE 2Z5BA 4DV0E 1N36I 4FW3A 2V2QA 4MU3A 4MQYA 4GQUA 1IBME 4OO1E 1MG7A 4DUZE 1FKAE 3GMEA 1N33I 1H73A 4DV6E 4WUBA 5C0XD 4YHHE 4DV2E 2Z5BB 4JI1E 1Y5YA 3J7AG 4OO1C 1NHIA 4DXLA 4EMDA 4NXME 5GMEA 5C0XC 4X62I 4B3TE 2V2VA 4AQYE 1PVGA 1K47A 2ZBKB 1XNQE 4DV7E 2WW4A 3LNUA 1PKPA 2O1TA 3NZKA 4QNKA 2O1WA 3L7ZB 5JEAC 1HR0E 4AM3A 5A2QQ 2VQFI 1BKNA 4DPXA 2Z5CA 2F4VI 3H1CA 1DARA 2J7KA 2OI2A 3QT8A 1OYRA 5DROA 2CZ9A 1Y60A 4X65I 4FW9A 4AIMA 4DR6E 1HNXI 2PO2B 4PRVA 5JEAB 3OTOE 4DPYA 1A6FA 2AJ4A 4MYUA 1QZRA 3HKMA 4K0KI 2UUCE 2NN6B 2BA1D 4USKA 2NPFA 4DV3I 4IFDF 4XTJA 1IBMI 4DV6I 1H7SA 1XMOI 1FJGE 1RREA 1Z0EA 1Y6ZA 3PRYA 2JT2A 4JV5I 1RR9A 2NN6A 4HACB 4LF5I 4B3MI 3M7NG 1Y4SA 4IZKB 4Z7YA 3QT7A 3P3CA 1UDSA 4OKGA 4K0KE 4LF4E 5K36D 3F0NA 4LFBI 3JAMQ 3LTOA 4DV2I 2HFUA 3Q6NA 4JYAE 3B8HA 4KQVA 4DR2I 4LFCE 4KHPE 2C39A 4B3RE 4IZJD 1Z0CA 5GMDA 4I3HA 3T1HE 2ZM6I 4LF6E 1FI4A 1B63A 2VQEI 2WNRB 2DEIA 3DD6A 4JI6E 4HXZA 4GKKI 1Z0TA 4N3OA 1J5EI 3JAMC 2UUBI 2C38A 2VESA 1B62A 1EI1A 4X64E 1YH8A 2A2CA 3OTOI 4DR3I 4LF9E 5C0XE 5LMNI 1ZXNA 4J3DA 4DV4E 4DU8A 2JEBB 2ZM6E 2AE8A 1Z5BA 4LCFA 4MYTA 4JI3I 3UHMA 4DR6I 2NN6F 3WU4A 4P7AA 2F4VE 4LF4I 4NBQA 5LMUE 5L3JA 1VI7A 3J7AM 4X64I 4DR1I 2VF3A 2IERA 2Z5CB 4FN5A 4DR7E 5K36E 1N0UA 4MU1A 4DR5E 4JI6I 2V34A 4KHPI 2CGEA 1MU5A 3T1HI 4LF6I 1OJ4A 4OO1A 4WUCA 4ZVIA 3P3GA 3PYGA 4LPFA 5A2QC 3M7ND 1N32I 1HNWI 1XMQE 1S16A 5DRPA 2GO3A 4JG4A 4AIDA 2BA0D 2HKEA 2J65A 3M85D 5FWKA 1YHCA 5JEAD 5IWAE 2UU9I 4DR3E 3B82A 4RPFA 2UXBE 1NHHA 3P06A 4HYMA 1HK7A 1H7UA 4JI3E 1IBLI 1U2RA 2VQEE 2V8PA 4GKKE 5IT9C 1UDOA 4X62E 4DV7I 1ZM3A 3B78A 4NXMI 5DRQA 4X65E 3B4TA 4AQYI 3WU3A 3P76A 3LPSA 2NN6E 3PS3A 2C37A 2WNRA 1Z5AA 3CDIA 2O1UA 4DR7I 2UXBI 4B3SI 5K36C 3QT5A 4JI4I 4R1FA 2PNZA 5FLXC 1USUA 1UDQA 4IZJB 1UEKA 4LF5E 4LF8E 1RHYA 4OZEA 1HNWE 4DR4E 2PNLA 2PNZB 3M85G 5LMUI 1ZXMA 1N32E 3GCMA 4BA1A 1N0VC 2X7IA 5ELWA 1R6LA 5BR8I 4ED4A 3D4JA 3GLLA 4ISAA 3K1JA 2E5LE 3J81Q 2BM0A 1Z0BA 4JI0I 1N34I 2UXCI 3PS1A 3Q6MA 2JEAA 4LFAE 1FJGI 3CDJA 1OYSA 4DUYI 4FW6A 4YY3E 1XNRE 4IFDD 3PYEA 4P52A 4B3SE 1ZM9A 4FW4A 1Y4UA 4DR2E 4LOMA 4X66I 3HJCA 1WUUA 1USVA 2GO4A 2E5LI 4DV5I 4JI2E 4LFCI 4IFDE 1S4EA 3PS2A 3PYFA 5BR8E 4BA2B 2PO2A 4QNJA 5JEAA 3M6AA 4MU4A 1FNMA 1EA6A 1Z0GA 3V5RA 1XNRI 2IESA 1J5EE 4DR4I 2EFGA 1ZM4A 4OX9I 4LFAI 3K85A 4DUZI 5K36B 4GKJI 1N36E 4HACA 2BA0G 1I94E 4B3RI 4JI1I 5K36A 4JI8E 1HNZE 2C37B 3V2UC 1PIEA 4HY1A 4JI2I 5DNLA 3P3EA 4JI5E 2DEJA 4DR5I 4DV4I 4JI7I 4GKJE 4DUYE 2UUAI 2UU9E 4DR1E 3ZM7A 4FWDA 2BM1A 3ZZ0A 2NN6D 4DV3E 1E3HA 4IZKA 1HR0I 4URLA 4OO1F 1Z0VA 5C0XA 3CWVA 3T1YE 3J80C 4USMA 4U3BA 2UXCE 3GONA 2HK2A 2X36A 2F1DA 4LCHA 4DV5E 2BA1G 5IT9Q 2BR2B 4PRXA 4JI8I 1P42A 1H72C 3H4LA 4FWGA 2R3VA 1NHJA 4IZJA
chains in the Genus database with same CATH topology
2LJPA 3Q1QA 2A2DA 4B3ME 2HHHI 4M1KA 4NXNI 3WU5A 4DV1I 1KKHA 2IOQA 2HFSA 2HKJA 2IOPA 2ZITA 3J80Q 4Z7CA 2UUCI 4JI5I 4PU9A 1Z5CA 4JYAI 2E1RA 2BV3A 1HNXE 4LF9I 1I94I 4LFBE 2O1VA 2GQ0A 2UXDI 1NZ0A 3K17A 2Z5EA 3ZKBA 4LF8I 5LMNE 1KIJA 4JI7E 4JV5E 4YY3I 4DV0I 4LF7I 1KVKA 3ZKDA 2UUBE 1IBKE 4JI4E 1XNQI 4DV1E 4DU7A 3HULA 3ZZUA 1ELOA 4WUDA 1KTVA 1D6TA 1Z0WA 1ZM2A 4DPUA 4YHHI 3J81C 4FWHA 3T1YI 4DPWA 1N33E 3WU6A 4UT4A 2VQFE 4LF7E 5LL6R 1IBKI 4OX9E 4NXNE 3ZZTA 1XHKA 5IWAI 2HK3A 1N34E 3QT6A 4JI0E 2HHHE 4UTGA 2UXDE 1XMOE 1MX0A 1Z59A 2PNMA 1XMQI 5FLXQ 2R42A 4B3TI 2Q2EB 1HNZI 1FWKA 2XEXA 1H74A 2V2ZA 4X66E 1FWLA 1VISA 4DPTA 1IBLE 3PYDA 2GS8A 2CG9A 2UUAE 2Z5BA 4DV0E 1N36I 2V2QA 1IBME 1MG7A 4DUZE 1FKAE 1N33I 1H73A 4DV6E 4WUBA 4YHHE 4DV2E 2Z5BB 4JI1E 3J7AG 1NHIA 4DXLA 4EMDA 4NXME 5GMEA 4X62I 4B3TE 2V2VA 4AQYE 1PVGA 1K47A 2ZBKB 1XNQE 4DV7E 2WW4A 3LNUA 1PKPA 2O1TA 2O1WA 1HR0E 5A2QQ 2VQFI 1BKNA 4DPXA 2Z5CA 2F4VI 1DARA 2J7KA 2OI2A 3QT8A 2CZ9A 4X65I 4FW9A 4DR6E 1HNXI 4PRVA 3OTOE 4DPYA 1A6FA 2AJ4A 4MYUA 1QZRA 4K0KI 2UUCE 4USKA 2NPFA 4DV3I 4XTJA 1IBMI 4DV6I 1H7SA 1XMOI 1FJGE 1RREA 1Z0EA 1Y6ZA 3PRYA 4JV5I 1RR9A 4HACB 4LF5I 4B3MI 1Y4SA 4IZKB 4Z7YA 3QT7A 4K0KE 4LF4E 3F0NA 4LFBI 3JAMQ 3LTOA 4DV2I 2HFUA 3Q6NA 4JYAE 3B8HA 4KQVA 4DR2I 4LFCE 4KHPE 4B3RE 4IZJD 1Z0CA 5GMDA 4I3HA 3T1HE 2ZM6I 4LF6E 1FI4A 1B63A 2VQEI 2DEIA 4JI6E 4HXZA 4GKKI 1Z0TA 4N3OA 1J5EI 3JAMC 2UUBI 1B62A 1EI1A 4X64E 2A2CA 3OTOI 4DR3I 4LF9E 5LMNI 1ZXNA 4DV4E 4DU8A 2ZM6E 1Z5BA 4MYTA 4JI3I 4DR6I 3WU4A 4P7AA 2F4VE 4LF4I 5LMUE 5L3JA 3J7AM 4X64I 4DR1I 2VF3A 2Z5CB 4FN5A 4DR7E 1N0UA 4DR5E 4JI6I 2V34A 4KHPI 2CGEA 3T1HI 1MU5A 4LF6I 1OJ4A 4WUCA 4ZVIA 3PYGA 5A2QC 1N32I 1HNWI 1XMQE 1S16A 4JG4A 2HKEA 5FWKA 5IWAE 2UU9I 4DR3E 3B82A 4RPFA 2UXBE 1NHHA 3P06A 4HYMA 1HK7A 1H7UA 4JI3E 1IBLI 1U2RA 2VQEE 2V8PA 4GKKE 5IT9C 4X62E 4DV7I 1ZM3A 3B78A 4NXMI 4X65E 4AQYI 3WU3A 3LPSA 1Z5AA 2O1UA 4DR7I 2UXBI 4B3SI 3QT5A 4JI4I 4R1FA 5FLXC 1USUA 4IZJB 1UEKA 4LF5E 4LF8E 1HNWE 4DR4E 2PNLA 5LMUI 1ZXMA 1N32E 1N0VC 2X7IA 5BR8I 4ED4A 3D4JA 3K1JA 2E5LE 3J81Q 2BM0A 1Z0BA 4JI0I 1N34I 2UXCI 3Q6MA 4LFAE 1FJGI 4DUYI 4YY3E 1XNRE 3PYEA 4P52A 4B3SE 1ZM9A 1Y4UA 4DR2E 4X66I 3HJCA 1WUUA 1USVA 2E5LI 4DV5I 4JI2E 4LFCI 1S4EA 3PYFA 5BR8E 3M6AA 1FNMA 1EA6A 1Z0GA 3V5RA 1XNRI 1J5EE 4DR4I 2EFGA 1ZM4A 4OX9I 4LFAI 3K85A 4DUZI 4GKJI 1N36E 4HACA 1I94E 4B3RI 4JI1I 4JI8E 1HNZE 3V2UC 1PIEA 4HY1A 4JI2I 4JI5E 2DEJA 4DR5I 4DV4I 4JI7I 4GKJE 4DUYE 2UUAI 2UU9E 4DR1E 3ZM7A 4FWDA 2BM1A 3ZZ0A 4DV3E 4IZKA 1HR0I 4URLA 1Z0VA 3CWVA 3T1YE 3J80C 4USMA 2UXCE 3GONA 2HK2A 2X36A 4DV5E 5IT9Q 4PRXA 4JI8I 1H72C 3H4LA 4FWGA 2R3VA 1NHJA 4IZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJP A;  3Q1Q A;  2A2D A;  4B3M E;  2HHH I;  4M1K A;  4NXN I;  3WU5 A;  4DV1 I;  1KKH A;  2HFS A;  2HKJ A;  2ZIT A;  3J80 Q;  2UUC I;  4Z7C A;  4JI5 I;  4PU9 A;  1Z5C A;  4JYA I;  2E1R A;  2BV3 A;  1HNX E;  4LF9 I;  1I94 I;  4LFB E;  2UXD I;  1NZ0 A;  3K17 A;  3ZKB A;  4LF8 I;  5LMN E;  1KIJ A;  4JI7 E;  4JV5 E;  4YY3 I;  4DV0 I;  4LF7 I;  1KVK A;  3ZKD A;  2UUB E;  1IBK E;  4JI4 E;  1XNQ I;  4DV1 E;  4DU7 A;  3HUL A;  3ZZU A;  1ELO A;  4WUD A;  1KTV A;  1D6T A;  1Z0W A;  1ZM2 A;  4DPU A;  4YHH I;  3J81 C;  4FWH A;  3T1Y I;  4DPW A;  1N33 E;  3WU6 A;  4UT4 A;  2VQF E;  4LF7 E;  5LL6 R;  1IBK I;  4OX9 E;  4NXN E;  3ZZT A;  1XHK A;  5IWA I;  2HK3 A;  1N34 E;  3QT6 A;  4JI0 E;  2HHH E;  4UTG A;  2UXD E;  1XMO E;  1MX0 A;  1Z59 A;  1XMQ I;  5FLX Q;  2R42 A;  4B3T I;  2Q2E B;  1HNZ I;  1FWK A;  2XEX A;  1H74 A;  2V2Z A;  4X66 E;  1FWL A;  1VIS A;  4DPT A;  1IBL E;  3PYD A;  2GS8 A;  2UUA E;  4DV0 E;  1N36 I;  2V2Q A;  1IBM E;  1MG7 A;  4DUZ E;  1FKA E;  1N33 I;  1H73 A;  4DV6 E;  4WUB A;  4YHH E;  4DV2 E;  4JI1 E;  3J7A G;  1NHI A;  4DXL A;  4EMD A;  4NXM E;  5GME A;  4X62 I;  4B3T E;  2V2V A;  4AQY E;  1PVG A;  1K47 A;  2ZBK B;  1XNQ E;  4DV7 E;  2WW4 A;  3LNU A;  1PKP A;  1HR0 E;  5A2Q Q;  2VQF I;  1BKN A;  4DPX A;  2F4V I;  1DAR A;  2J7K A;  2OI2 A;  3QT8 A;  2CZ9 A;  4X65 I;  4FW9 A;  4DR6 E;  1HNX I;  4PRV A;  3OTO E;  4DPY A;  1A6F A;  2AJ4 A;  4MYU A;  1QZR A;  4K0K I;  2UUC E;  4USK A;  2NPF A;  4DV3 I;  4XTJ A;  1IBM I;  4DV6 I;  1H7S A;  1XMO I;  1FJG E;  1RRE A;  1Z0E A;  4JV5 I;  1RR9 A;  4HAC B;  4LF5 I;  4B3M I;  4Z7Y A;  3QT7 A;  4K0K E;  4LF4 E;  3F0N A;  4LFB I;  3JAM Q;  3LTO A;  4DV2 I;  2HFU A;  4JYA E;  3B8H A;  4KQV A;  4DR2 I;  4LFC E;  4KHP E;  4B3R E;  4I3H A;  1Z0C A;  4LF6 E;  5GMD A;  3T1H E;  2ZM6 I;  1FI4 A;  1B63 A;  2VQE I;  2DEI A;  4JI6 E;  4HXZ A;  4GKK I;  1Z0T A;  1J5E I;  3JAM C;  2UUB I;  1B62 A;  1EI1 A;  4X64 E;  2A2C A;  3OTO I;  4DR3 I;  4LF9 E;  5LMN I;  1ZXN A;  4DV4 E;  4DU8 A;  2ZM6 E;  1Z5B A;  4MYT A;  4JI3 I;  4DR6 I;  3WU4 A;  4P7A A;  2F4V E;  4LF4 I;  5LMU E;  5L3J A;  3J7A M;  4X64 I;  4DR1 I;  2VF3 A;  4FN5 A;  4DR7 E;  1N0U A;  4DR5 E;  4JI6 I;  2V34 A;  4KHP I;  4LF6 I;  1MU5 A;  3T1H I;  1OJ4 A;  4WUC A;  4ZVI A;  3PYG A;  5A2Q C;  1N32 I;  1HNW I;  1XMQ E;  1S16 A;  4JG4 A;  2HKE A;  5IWA E;  2UU9 I;  4DR3 E;  3B82 A;  4RPF A;  2UXB E;  1NHH A;  4HYM A;  1H7U A;  4JI3 E;  1IBL I;  1U2R A;  2VQE E;  2V8P A;  4GKK E;  5IT9 C;  4X62 E;  4DV7 I;  1ZM3 A;  3B78 A;  4NXM I;  4X65 E;  4AQY I;  3WU3 A;  3LPS A;  1Z5A A;  4DR7 I;  2UXB I;  4B3S I;  3QT5 A;  4JI4 I;  4R1F A;  5FLX C;  1UEK A;  4LF5 E;  4LF8 E;  1HNW E;  4DR4 E;  5LMU I;  1ZXM A;  1N32 E;  1N0V C;  2X7I A;  5BR8 I;  4ED4 A;  3D4J A;  3K1J A;  2E5L E;  3J81 Q;  2BM0 A;  1Z0B A;  4JI0 I;  1N34 I;  2UXC I;  4LFA E;  1FJG I;  4DUY I;  4YY3 E;  1XNR E;  3PYE A;  4P52 A;  4B3S E;  1ZM9 A;  4DR2 E;  4X66 I;  1WUU A;  2E5L I;  4DV5 I;  4JI2 E;  4LFC I;  1S4E A;  3PYF A;  5BR8 E;  3M6A A;  1FNM A;  1EA6 A;  1Z0G A;  3V5R A;  1XNR I;  1J5E E;  4DR4 I;  2EFG A;  1ZM4 A;  4OX9 I;  4LFA I;  4DUZ I;  4GKJ I;  1N36 E;  4HAC A;  1I94 E;  4B3R I;  4JI1 I;  4JI8 E;  1HNZ E;  3V2U C;  1PIE A;  4HY1 A;  4JI2 I;  4JI5 E;  2DEJ A;  4DR5 I;  4DV4 I;  4JI7 I;  4GKJ E;  4DUY E;  2UUA I;  2UU9 E;  4DR1 E;  3ZM7 A;  4FWD A;  2BM1 A;  3ZZ0 A;  4DV3 E;  1HR0 I;  4URL A;  1Z0V A;  3CWV A;  3T1Y E;  3J80 C;  4USM A;  2UXC E;  3GON A;  2HK2 A;  2X36 A;  4DV5 E;  5IT9 Q;  4PRX A;  4JI8 I;  1H72 C;  3H4L A;  4FWG A;  2R3V A;  1NHJ A; 
#chains in the Genus database with same CATH topology
 2LJP A;  3Q1Q A;  2A2D A;  4B3M E;  2O3Z A;  2HHH I;  5JEA E;  4M1K A;  3KRN A;  4NXN I;  3WU5 A;  4IFD A;  4DV1 I;  2C38 B;  1E3P A;  4IS9 A;  4BA1 B;  5K36 F;  1KKH A;  2IOQ A;  2NN6 C;  2HFS A;  3L7Z A;  2HKJ A;  4OO1 D;  2IOP A;  2ZIT A;  3J80 Q;  4Z7C A;  2UUC I;  4JI5 I;  1XXE A;  4PU9 A;  1Z5C A;  4JYA I;  2E1R A;  2BV3 A;  1HNX E;  2JEA B;  4BA2 A;  4LF9 I;  1I94 I;  4LFB E;  4MDT A;  2O1V A;  2GQ0 A;  5DNX A;  2UXD I;  1NZ0 A;  4FW7 A;  3K17 A;  2Z5E A;  3ZKB A;  4LF8 I;  2JE6 A;  5LMN E;  5C0X F;  1KIJ A;  4JI7 E;  4JV5 E;  3U1Y A;  4YY3 I;  4FW5 A;  4DV0 I;  4LF7 I;  1KVK A;  4OO1 B;  3ZKD A;  2UUB E;  1IBK E;  2JE6 B;  3U1K A;  4JI4 E;  1XNQ I;  4DV1 E;  4DU7 A;  3HUL A;  4MU0 A;  3ZZU A;  1ELO A;  4LCG A;  4WUD A;  2PO1 A;  1KTV A;  1D6T A;  1Z0W A;  1ZM2 A;  4DPU A;  1R6M A;  4YHH I;  3J81 C;  4FWH A;  3T1Y I;  2CVE A;  4DPW A;  2PO1 B;  3WU6 A;  1N33 E;  4UT4 A;  5EL9 A;  2VQF E;  4LF7 E;  5LL6 R;  2PO0 A;  2WP8 B;  1IBK I;  4OX9 E;  5EKW A;  4NXN E;  3ZZT A;  4IFD C;  1XHK A;  5IWA I;  2HK3 A;  1N34 E;  3QT6 A;  4JI0 E;  2HHH E;  4U3D A;  4UTG A;  1UDN A;  2PO0 B;  2UXD E;  2WP8 A;  2BR2 A;  1MX0 A;  1XMO E;  1Z59 A;  2PNM A;  1XMQ I;  5FLX Q;  2R42 A;  4B3T I;  2Q2E B;  1HNZ I;  1FWK A;  1OYP A;  5JEA F;  2XEX A;  1H74 A;  2V2Z A;  5DRR A;  4X66 E;  1FWL A;  1VIS A;  2C39 B;  4DPT A;  1IBL E;  3PYD A;  2GS8 A;  4IFD B;  2JEB A;  2CG9 A;  5C0X B;  2UUA E;  2Z5B A;  4DV0 E;  1N36 I;  4FW3 A;  2V2Q A;  4MU3 A;  4MQY A;  4GQU A;  1IBM E;  4OO1 E;  1MG7 A;  4DUZ E;  1FKA E;  3GME A;  1N33 I;  1H73 A;  4DV6 E;  4WUB A;  5C0X D;  4YHH E;  4DV2 E;  2Z5B B;  4JI1 E;  1Y5Y A;  3J7A G;  4OO1 C;  1NHI A;  4DXL A;  4EMD A;  4NXM E;  5GME A;  5C0X C;  4X62 I;  4B3T E;  2V2V A;  4AQY E;  1PVG A;  1K47 A;  2ZBK B;  1XNQ E;  4DV7 E;  2WW4 A;  3LNU A;  1PKP A;  2O1T A;  3NZK A;  4QNK A;  2O1W A;  3L7Z B;  5JEA C;  1HR0 E;  4AM3 A;  5A2Q Q;  2VQF I;  1BKN A;  4DPX A;  2Z5C A;  2F4V I;  3H1C A;  1DAR A;  2J7K A;  2OI2 A;  3QT8 A;  1OYR A;  5DRO A;  2CZ9 A;  1Y60 A;  4X65 I;  4FW9 A;  4AIM A;  4DR6 E;  1HNX I;  2PO2 B;  4PRV A;  5JEA B;  3OTO E;  4DPY A;  1A6F A;  2AJ4 A;  4MYU A;  1QZR A;  3HKM A;  4K0K I;  2UUC E;  2NN6 B;  2BA1 D;  4USK A;  2NPF A;  4DV3 I;  4IFD F;  4XTJ A;  1IBM I;  4DV6 I;  1H7S A;  1XMO I;  1FJG E;  1RRE A;  1Z0E A;  1Y6Z A;  3PRY A;  2JT2 A;  4JV5 I;  1RR9 A;  2NN6 A;  4HAC B;  4LF5 I;  4B3M I;  3M7N G;  1Y4S A;  4IZK B;  4Z7Y A;  3QT7 A;  3P3C A;  1UDS A;  4OKG A;  4K0K E;  4LF4 E;  5K36 D;  3F0N A;  4LFB I;  3JAM Q;  3LTO A;  4DV2 I;  2HFU A;  3Q6N A;  4JYA E;  3B8H A;  4KQV A;  4DR2 I;  4LFC E;  4KHP E;  2C39 A;  4B3R E;  4IZJ D;  1Z0C A;  5GMD A;  4I3H A;  3T1H E;  2ZM6 I;  4LF6 E;  1FI4 A;  1B63 A;  2VQE I;  2WNR B;  2DEI A;  3DD6 A;  4JI6 E;  4HXZ A;  4GKK I;  1Z0T A;  4N3O A;  1J5E I;  3JAM C;  2UUB I;  2C38 A;  2VES A;  1B62 A;  1EI1 A;  4X64 E;  1YH8 A;  2A2C A;  3OTO I;  4DR3 I;  4LF9 E;  5C0X E;  5LMN I;  1ZXN A;  4J3D A;  4DV4 E;  4DU8 A;  2JEB B;  2ZM6 E;  2AE8 A;  1Z5B A;  4LCF A;  4MYT A;  4JI3 I;  3UHM A;  4DR6 I;  2NN6 F;  3WU4 A;  4P7A A;  2F4V E;  4LF4 I;  4NBQ A;  5LMU E;  5L3J A;  1VI7 A;  3J7A M;  4X64 I;  4DR1 I;  2VF3 A;  2IER A;  2Z5C B;  4FN5 A;  4DR7 E;  5K36 E;  1N0U A;  4MU1 A;  4DR5 E;  4JI6 I;  2V34 A;  4KHP I;  2CGE A;  1MU5 A;  3T1H I;  4LF6 I;  1OJ4 A;  4OO1 A;  4WUC A;  4ZVI A;  3P3G A;  3PYG A;  4LPF A;  5A2Q C;  3M7N D;  1N32 I;  1HNW I;  1XMQ E;  1S16 A;  5DRP A;  2GO3 A;  4JG4 A;  4AID A;  2BA0 D;  2HKE A;  2J65 A;  3M85 D;  5FWK A;  1YHC A;  5JEA D;  5IWA E;  2UU9 I;  4DR3 E;  3B82 A;  4RPF A;  2UXB E;  1NHH A;  3P06 A;  4HYM A;  1HK7 A;  1H7U A;  4JI3 E;  1IBL I;  1U2R A;  2VQE E;  2V8P A;  4GKK E;  5IT9 C;  1UDO A;  4X62 E;  4DV7 I;  1ZM3 A;  3B78 A;  4NXM I;  5DRQ A;  4X65 E;  3B4T A;  4AQY I;  3WU3 A;  3P76 A;  3LPS A;  2NN6 E;  3PS3 A;  2C37 A;  2WNR A;  1Z5A A;  3CDI A;  2O1U A;  4DR7 I;  2UXB I;  4B3S I;  5K36 C;  3QT5 A;  4JI4 I;  4R1F A;  2PNZ A;  5FLX C;  1USU A;  1UDQ A;  4IZJ B;  1UEK A;  4LF5 E;  4LF8 E;  1RHY A;  4OZE A;  1HNW E;  4DR4 E;  2PNL A;  2PNZ B;  3M85 G;  5LMU I;  1ZXM A;  1N32 E;  3GCM A;  4BA1 A;  1N0V C;  2X7I A;  5ELW A;  1R6L A;  5BR8 I;  4ED4 A;  3D4J A;  3GLL A;  4ISA A;  3K1J A;  2E5L E;  3J81 Q;  2BM0 A;  1Z0B A;  4JI0 I;  1N34 I;  2UXC I;  3PS1 A;  3Q6M A;  2JEA A;  4LFA E;  1FJG I;  3CDJ A;  1OYS A;  4DUY I;  4FW6 A;  4YY3 E;  1XNR E;  4IFD D;  3PYE A;  4P52 A;  4B3S E;  1ZM9 A;  4FW4 A;  1Y4U A;  4DR2 E;  4LOM A;  4X66 I;  3HJC A;  1WUU A;  1USV A;  2GO4 A;  2E5L I;  4DV5 I;  4JI2 E;  4LFC I;  4IFD E;  1S4E A;  3PS2 A;  3PYF A;  5BR8 E;  4BA2 B;  2PO2 A;  4QNJ A;  5JEA A;  3M6A A;  4MU4 A;  1FNM A;  1EA6 A;  1Z0G A;  3V5R A;  1XNR I;  2IES A;  1J5E E;  4DR4 I;  2EFG A;  1ZM4 A;  4OX9 I;  4LFA I;  3K85 A;  4DUZ I;  5K36 B;  4GKJ I;  1N36 E;  4HAC A;  2BA0 G;  1I94 E;  4B3R I;  4JI1 I;  5K36 A;  4JI8 E;  1HNZ E;  2C37 B;  3V2U C;  1PIE A;  4HY1 A;  4JI2 I;  5DNL A;  3P3E A;  4JI5 E;  2DEJ A;  4DR5 I;  4DV4 I;  4JI7 I;  4GKJ E;  4DUY E;  2UUA I;  2UU9 E;  4DR1 E;  3ZM7 A;  4FWD A;  2BM1 A;  3ZZ0 A;  2NN6 D;  4DV3 E;  1E3H A;  4IZK A;  1HR0 I;  4URL A;  4OO1 F;  1Z0V A;  5C0X A;  3CWV A;  3T1Y E;  3J80 C;  4USM A;  4U3B A;  2UXC E;  3GON A;  2HK2 A;  2X36 A;  2F1D A;  4LCH A;  4DV5 E;  2BA1 G;  5IT9 Q;  2BR2 B;  4PRX A;  4JI8 I;  1P42 A;  1H72 C;  3H4L A;  4FWG A;  2R3V A;  1NHJ A;  4IZJ A; 
#chains in the Genus database with same CATH homology
 2LJP A;  3Q1Q A;  2A2D A;  4B3M E;  2HHH I;  4M1K A;  4NXN I;  3WU5 A;  4DV1 I;  1KKH A;  2IOQ A;  2HFS A;  2HKJ A;  2IOP A;  2ZIT A;  3J80 Q;  4Z7C A;  2UUC I;  4JI5 I;  4PU9 A;  1Z5C A;  4JYA I;  2E1R A;  2BV3 A;  1HNX E;  4LF9 I;  1I94 I;  4LFB E;  2O1V A;  2GQ0 A;  2UXD I;  1NZ0 A;  3K17 A;  2Z5E A;  3ZKB A;  4LF8 I;  5LMN E;  1KIJ A;  4JI7 E;  4JV5 E;  4YY3 I;  4DV0 I;  4LF7 I;  1KVK A;  3ZKD A;  2UUB E;  1IBK E;  4JI4 E;  1XNQ I;  4DV1 E;  4DU7 A;  3HUL A;  3ZZU A;  1ELO A;  4WUD A;  1KTV A;  1D6T A;  1Z0W A;  1ZM2 A;  4DPU A;  4YHH I;  3J81 C;  4FWH A;  3T1Y I;  4DPW A;  1N33 E;  3WU6 A;  4UT4 A;  2VQF E;  4LF7 E;  5LL6 R;  1IBK I;  4OX9 E;  4NXN E;  3ZZT A;  1XHK A;  5IWA I;  2HK3 A;  1N34 E;  3QT6 A;  4JI0 E;  2HHH E;  4UTG A;  2UXD E;  1XMO E;  1MX0 A;  1Z59 A;  2PNM A;  1XMQ I;  5FLX Q;  2R42 A;  4B3T I;  2Q2E B;  1HNZ I;  1FWK A;  2XEX A;  1H74 A;  2V2Z A;  4X66 E;  1FWL A;  1VIS A;  4DPT A;  1IBL E;  3PYD A;  2GS8 A;  2CG9 A;  2UUA E;  2Z5B A;  4DV0 E;  1N36 I;  2V2Q A;  1IBM E;  1MG7 A;  4DUZ E;  1FKA E;  1N33 I;  1H73 A;  4DV6 E;  4WUB A;  4YHH E;  4DV2 E;  2Z5B B;  4JI1 E;  3J7A G;  1NHI A;  4DXL A;  4EMD A;  4NXM E;  5GME A;  4X62 I;  4B3T E;  2V2V A;  4AQY E;  1PVG A;  1K47 A;  2ZBK B;  1XNQ E;  4DV7 E;  2WW4 A;  3LNU A;  1PKP A;  2O1T A;  2O1W A;  1HR0 E;  5A2Q Q;  2VQF I;  1BKN A;  4DPX A;  2Z5C A;  2F4V I;  1DAR A;  2J7K A;  2OI2 A;  3QT8 A;  2CZ9 A;  4X65 I;  4FW9 A;  4DR6 E;  1HNX I;  4PRV A;  3OTO E;  4DPY A;  1A6F A;  2AJ4 A;  4MYU A;  1QZR A;  4K0K I;  2UUC E;  4USK A;  2NPF A;  4DV3 I;  4XTJ A;  1IBM I;  4DV6 I;  1H7S A;  1XMO I;  1FJG E;  1RRE A;  1Z0E A;  1Y6Z A;  3PRY A;  4JV5 I;  1RR9 A;  4HAC B;  4LF5 I;  4B3M I;  1Y4S A;  4IZK B;  4Z7Y A;  3QT7 A;  4K0K E;  4LF4 E;  3F0N A;  4LFB I;  3JAM Q;  3LTO A;  4DV2 I;  2HFU A;  3Q6N A;  4JYA E;  3B8H A;  4KQV A;  4DR2 I;  4LFC E;  4KHP E;  4B3R E;  4IZJ D;  1Z0C A;  5GMD A;  4I3H A;  3T1H E;  2ZM6 I;  4LF6 E;  1FI4 A;  1B63 A;  2VQE I;  2DEI A;  4JI6 E;  4HXZ A;  4GKK I;  1Z0T A;  4N3O A;  1J5E I;  3JAM C;  2UUB I;  1B62 A;  1EI1 A;  4X64 E;  2A2C A;  3OTO I;  4DR3 I;  4LF9 E;  5LMN I;  1ZXN A;  4DV4 E;  4DU8 A;  2ZM6 E;  1Z5B A;  4MYT A;  4JI3 I;  4DR6 I;  3WU4 A;  4P7A A;  2F4V E;  4LF4 I;  5LMU E;  5L3J A;  3J7A M;  4X64 I;  4DR1 I;  2VF3 A;  2Z5C B;  4FN5 A;  4DR7 E;  1N0U A;  4DR5 E;  4JI6 I;  2V34 A;  4KHP I;  2CGE A;  3T1H I;  1MU5 A;  4LF6 I;  1OJ4 A;  4WUC A;  4ZVI A;  3PYG A;  5A2Q C;  1N32 I;  1HNW I;  1XMQ E;  1S16 A;  4JG4 A;  2HKE A;  5FWK A;  5IWA E;  2UU9 I;  4DR3 E;  3B82 A;  4RPF A;  2UXB E;  1NHH A;  3P06 A;  4HYM A;  1HK7 A;  1H7U A;  4JI3 E;  1IBL I;  1U2R A;  2VQE E;  2V8P A;  4GKK E;  5IT9 C;  4X62 E;  4DV7 I;  1ZM3 A;  3B78 A;  4NXM I;  4X65 E;  4AQY I;  3WU3 A;  3LPS A;  1Z5A A;  2O1U A;  4DR7 I;  2UXB I;  4B3S I;  3QT5 A;  4JI4 I;  4R1F A;  5FLX C;  1USU A;  4IZJ B;  1UEK A;  4LF5 E;  4LF8 E;  1HNW E;  4DR4 E;  2PNL A;  5LMU I;  1ZXM A;  1N32 E;  1N0V C;  2X7I A;  5BR8 I;  4ED4 A;  3D4J A;  3K1J A;  2E5L E;  3J81 Q;  2BM0 A;  1Z0B A;  4JI0 I;  1N34 I;  2UXC I;  3Q6M A;  4LFA E;  1FJG I;  4DUY I;  4YY3 E;  1XNR E;  3PYE A;  4P52 A;  4B3S E;  1ZM9 A;  1Y4U A;  4DR2 E;  4X66 I;  3HJC A;  1WUU A;  1USV A;  2E5L I;  4DV5 I;  4JI2 E;  4LFC I;  1S4E A;  3PYF A;  5BR8 E;  3M6A A;  1FNM A;  1EA6 A;  1Z0G A;  3V5R A;  1XNR I;  1J5E E;  4DR4 I;  2EFG A;  1ZM4 A;  4OX9 I;  4LFA I;  3K85 A;  4DUZ I;  4GKJ I;  1N36 E;  4HAC A;  1I94 E;  4B3R I;  4JI1 I;  4JI8 E;  1HNZ E;  3V2U C;  1PIE A;  4HY1 A;  4JI2 I;  4JI5 E;  2DEJ A;  4DR5 I;  4DV4 I;  4JI7 I;  4GKJ E;  4DUY E;  2UUA I;  2UU9 E;  4DR1 E;  3ZM7 A;  4FWD A;  2BM1 A;  3ZZ0 A;  4DV3 E;  4IZK A;  1HR0 I;  4URL A;  1Z0V A;  3CWV A;  3T1Y E;  3J80 C;  4USM A;  2UXC E;  3GON A;  2HK2 A;  2X36 A;  4DV5 E;  5IT9 Q;  4PRX A;  4JI8 I;  1H72 C;  3H4L A;  4FWG A;  2R3V A;  1NHJ A;  4IZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...