4LF7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7I00
1ZM4A 3T1YE 4B3RI 1NHJA 5GMDA 1QZRA 1FI4A 1H73A 1IBLE 1BKNA 3V5RA 2HFUA 2DEJA 4B3SI 4JI0E 4LF9E 4WUBA 1IBKE 1Z5AA 3GONA 4JI8I 4Z7YA 4FN5A 2A2CA 4DV7E 3D4JA 4YHHI 4JG4A 2ZM6E 3JAMC 1XNQE 3H4LA 4DR1I 1N33E 1FWLA 4I3HA 1K47A 1KVKA 4LF4I 4LF8I 3K17A 1HNXI 5A2QC 3ZM7A 2UU9E 1ZM3A 1KIJA 1J5EE 2X7IA 4JYAE 5LMUI 1N32I 2BM0A 4DV0I 4DR5I 2BM1A 4MYUA 1XHKA 2XEXA 4JI6E 4HACA 3ZZTA 4DV4I 3PYFA 4DPUA 4PRXA 4LFBE 4JI4E 4WUCA 4LFAE 2UXDI 4UT4A 1Z0GA 5FLXQ 2UXCI 4DUZE 1FJGE 2HK3A 4ZVIA 4K0KI 4OX9E 2WW4A 4NXNI 1HR0I 4B3ME 4DR7I 2F4VI 4USMA 2VQEI 1HNWI 1KTVA 4USKA 1IBMI 5FLXC 1DARA 4UTGA 4DR4E 3T1YI 3OTOE 4DV5I 4FW9A 4LF5E 4X65I 4DPXA 4HACB 1N34E 1EA6A 4NXMI 3T1HI 1H74A 1WUUA 4JI7E 1XMOE 1N0VC 1IBLI 1RR9A 2ZITA 3K1JA 4LF6E 4HYMA 4URLA 4DR3E 3HULA 4LF9I 3WU3A 1H7SA 4HXZA 4MYTA 2LJPA 4JI1I 2R3VA 4DR2I 2V2VA 4B3TI 4X62E 1XNQI 4WUDA 1N33I 2V8PA 4KHPI 2UUBE 4LF7I 5LMNI 1Z0EA 2E5LE 4DUYE 2UU9I 2J7KA 2UUAE 4X66E 1FWKA 4AQYI 1J5EI 2UXBE 1I94E 4JYAI 3JAMQ 4DV6E 4KQVA 1Z0TA 5IWAI 2V2QA 4X64I 5BR8I 4DV3E 3B82A 4DR6I 4GKKE 3J80Q 4JI4I 5A2QQ 2V34A 4DPYA 3J7AM 4OX9I 3J80C 1FKAE 4P52A 4B3MI 4JI3I 2VQFI 4FWDA 4DV2E 1MG7A 4PU9A 2V2ZA 1ZXMA 3QT8A 4DR4I 1ZXNA 1XNRE 3OTOI 3ZZ0A 2Q2EB 2ZBKB 4JV5I 2A2DA 2E1RA 1ELOA 4B3SE 1A6FA 1XMOI 4JI7I 4LF6I 3J81C 4JI2I 4Z7CA 4YHHE 1PVGA 3B8HA 3QT6A 3V2UC 2UUCI 1UEKA 4YY3I 2HHHE 4DV1E 2VF3A 4LF4E 3Q1QA 2OI2A 3ZZUA 1HNXE 4XTJA 3LTOA 1HNZE 1N0UA 4M1KA 1Z59A 3LPSA 2UUAI 4X66I 1KKHA 4JI0I 2UXBI 1IBKI 4DV6I 1NHIA 1Z0CA 4R1FA 4DV3I 4LFCE 4DV7I 4DU8A 1FNMA 2UXDE 4GKKI 2UXCE 2ZM6I 1EI1A 2X36A 1N36E 4NXNE 4ED4A 1HR0E 3PYGA 2VQEE 1HNWE 1IBME 1VISA 1ZM9A 2CZ9A 2DEIA 1XMQE 3PYDA 3M6AA 4DXLA 1Z0BA 4DV2I 1S4EA 4DV5E 5IT9Q 4X65E 4JI6I 1XNRI 1MX0A 4DU7A 4LFBI 4NXME 2HKJA 3T1HE 1Z0WA 4LFAI 1RREA 4DUZI 5IT9C 1FJGI 4JI1E 3WU6A 4GKJE 4DR2E 2GS8A 4JI5E 3QT7A 4B3TE 1U2RA 2HFSA 2HHHI 4KHPE 3J7AG 4DV1I 4LF7E 4B3RE 5LMNE 5LL6R 1PKPA 3J81Q 4LF5I 3ZKDA 2HKEA 1NHHA 1N34I 1HNZI 4AQYE 2HK2A 1PIEA 3WU5A 5IWAE 4JI8E 4DR3I 1ZM2A 4X64E 1D6TA 3PYEA 5GMEA 5BR8E 4HY1A 4DR6E 1NZ0A 3WU4A 1MU5A 4LFCI 4DR1E 3CWVA 1H72C 4X62I 1B63A 4LF8E 1N36I 2NPFA 2UUBI 3B78A 4JI3E 4EMDA 2EFGA 2E5LI 2VQFE 2R42A 4DUYI 4P7AA 2AJ4A 5LMUE 1XMQI 1N32E 4DV0E 4DR5E 3LNUA 4FWGA 1I94I 2BV3A 4DPWA 4DV4E 1H7UA 5L3JA 3QT5A 4JV5E 1S16A 4DPTA 4FWHA 1Z5CA 4K0KE 1B62A 4JI2E 1OJ4A 1Z5BA 3F0NA 4DR7E 2F4VE 1Z0VA 4GKJI 4PRVA 2UUCE 3ZKBA 4RPFA 4YY3E 4JI5I
chains in the Genus database with same CATH superfamily
2NN6A 3B4TA 1ZM4A 3T1YE 1E3HA 4IS9A 4B3RI 1NHJA 5GMDA 5DRRA 1QZRA 1FI4A 1H73A 1IBLE 1BKNA 3V5RA 2HFUA 4FW6A 2JEBA 2DEJA 4B3SI 4JI0E 4LF9E 2GO3A 4IFDD 4WUBA 1IBKE 1Z5AA 4IZJB 3P06A 3GONA 4JI8I 4Z7YA 4FN5A 2NN6E 1UDNA 2A2CA 2C37A 4DV7E 3D4JA 4YHHI 4BA2B 1Y60A 4JG4A 2ZM6E 1Y5YA 3JAMC 1XNQE 3H4LA 2WNRB 4IFDA 4DR1I 1N33E 2J65A 1FWLA 4I3HA 4U3BA 1K47A 1KVKA 4ISAA 2NN6B 4LF4I 4LF8I 3K17A 5A2QC 1HNXI 1Y4UA 3ZM7A 2UU9E 1ZM3A 5K36D 3GLLA 1KIJA 2Z5EA 1J5EE 1OYRA 2X7IA 4JYAE 1R6MA 1OYPA 5LMUI 1N32I 2BM0A 4DV0I 4DR5I 2BM1A 4MYUA 1XHKA 2IOPA 2JEBB 2XEXA 4JI6E 4HACA 3ZZTA 4DV4I 4OO1F 3PYFA 3U1YA 4DPUA 4PRXA 4LFBE 2PNLA 4IFDE 4JI4E 2GO4A 4WUCA 4LFAE 2UXDI 4UT4A 1Z0GA 5FLXQ 2UXCI 4DUZE 1FJGE 2HK3A 4ZVIA 4K0KI 4OX9E 2WW4A 4BA1A 4NXNI 4IFDB 1HR0I 4B3ME 4DR7I 3P3CA 4USMA 2F4VI 2VQEI 1HNWI 1KTVA 4USKA 4AIMA 5FLXC 1IBMI 1DARA 4AM3A 2CGEA 4UTGA 3PS3A 4MU1A 4DR4E 3T1YI 5K36E 3OTOE 4DV5I 3Q6NA 4FW4A 4FW9A 2Z5CA 2JT2A 4X65I 4LF5E 4DPXA 4HACB 3PS2A 4QNJA 1N34E 1EA6A 4NXMI 3T1HI 1H74A 1WUUA 4JI7E 1XMOE 1N0VC 1IBLI 2NN6F 4MU4A 1RR9A 2ZITA 3K1JA 4LF6E 4HYMA 2PO0A 5K36B 4URLA 4DR3E 3HULA 4LF9I 3WU3A 1H7SA 4HXZA 4MYTA 2LJPA 4JI1I 2BR2A 4BA1B 4OZEA 2R3VA 4DR2I 2V2VA 4B3TI 4X62E 1XNQI 3Q6MA 4WUDA 2BA0G 1N33I 2V8PA 4OO1C 4KHPI 5JEAD 2UUBE 4LF7I 5LMNI 1Z0EA 5DNLA 2F1DA 3P3EA 2E5LE 4DUYE 1USUA 2Z5CB 2UU9I 2J7KA 4NBQA 2UUAE 4X66E 1FWKA 1XXEA 4AQYI 1E3PA 4IFDF 1J5EI 3NZKA 1I94E 2UXBE 4JYAI 3JAMQ 4DV6E 4KQVA 1Z0TA 5IWAI 2V2QA 4FW3A 4X64I 5JEAA 2PO0B 5BR8I 4DV3E 3B82A 4DR6I 4GKKE 3J80Q 1UDOA 4JI4I 5EKWA 5A2QQ 2BR2B 2V34A 5FWKA 4DPYA 4LOMA 3J7AM 2CVEA 5EL9A 4OX9I 3HKMA 3J80C 1FKAE 4P52A 4B3MI 1YHCA 4JI3I 5K36F 2CG9A 2VQFI 4FWDA 4DV2E 1MG7A 5JEAE 2NN6C 3PS1A 4PU9A 2V2ZA 1ZXMA 3QT8A 4DR4I 3CDJA 1ZXNA 1XNRE 3OTOI 3ZZ0A 2Q2EB 2ZBKB 5JEAB 4JV5I 1Y4SA 2C37B 2A2DA 2E1RA 1ELOA 4B3SE 1A6FA 2VESA 3P3GA 1XMOI 4JI7I 2JEAA 4LF6I 3J81C 4JI2I 4Z7CA 2BA0D 4YHHE 1PVGA 3B8HA 3QT6A 3V2UC 2UUCI 5C0XA 1UEKA 3H1CA 4IFDC 2JE6A 2IOQA 4YY3I 2HHHE 4IZKA 4DV1E 2VF3A 4J3DA 4LF4E 3Q1QA 2OI2A 3ZZUA 1HNXE 4OO1A 4XTJA 4FW5A 5DRPA 3LTOA 1HNZE 1N0UA 3U1KA 4M1KA 3DD6A 1Z59A 3LPSA 2UUAI 4X66I 1KKHA 1RHYA 2IESA 4JI0I 2C39A 2UXBI 3PRYA 1R6LA 4MDTA 1IBKI 4DV6I 1NHIA 5C0XE 4MQYA 3M7NG 1Z0CA 4R1FA 4DV3I 4LFCE 4DV7I 5K36C 4DU8A 2O1UA 2O1VA 1FNMA 2UXDE 4AIDA 4GKKI 2UXCE 2ZM6I 2Z5BA 5C0XB 1EI1A 2X36A 2JE6B 1N36E 4NXNE 4ED4A 1Y6ZA 5JEAF 1HR0E 3PYGA 2VQEE 3M85G 1HNWE 1IBME 2AE8A 1VISA 1ZM9A 2CZ9A 3CDIA 2DEIA 2PNZA 1XMQE 2WNRA 3PYDA 3M6AA 4DXLA 1Z0BA 4LCHA 3UHMA 4DV2I 1S4EA 4OKGA 4DV5E 5IT9Q 4X65E 4JI6I 1XNRI 2BA1D 2C39B 1MX0A 4DU7A 3P76A 4LFBI 4NXME 2HKJA 3T1HE 1Z0WA 4LFAI 1RREA 1YH8A 1USVA 4DUZI 2PO2A 5IT9C 1FJGI 4MU0A 4JI1E 3WU6A 2PNMA 3GMEA 4GKJE 2Z5BB 1P42A 4DR2E 2GS8A 4JI5E 3L7ZA 3QT7A 4B3TE 4LCFA 1U2RA 5DNXA 1UDQA 2PNZB 1OYSA 2HFSA 2HHHI 2O1WA 4KHPE 3J7AG 4LPFA 4DV1I 4LF7E 5LMNE 4B3RE 5LL6R 1PKPA 5DROA 3J81Q 4LF5I 3ZKDA 2HKEA 1NHHA 2IERA 5C0XD 5C0XF 2O3ZA 1N34I 2GQ0A 1HNZI 4AQYE 5DRQA 3M7ND 2HK2A 2BA1G 2WP8A 1PIEA 3WU5A 5IWAE 4JI8E 5JEAC 4DR3I 1ZM2A 3KRNA 4X64E 3PYEA 2PO1A 5GMEA 1D6TA 5BR8E 4OO1D 4HY1A 2PO2B 4LCGA 4DR6E 1NZ0A 3WU4A 1MU5A 2C38A 4LFCI 5K36A 1UDSA 3M85D 4DR1E 3CWVA 1H72C 4X62I 1B63A 3L7ZB 4LF8E 1N36I 2NPFA 2UUBI 3B78A 4JI3E 1VI7A 4EMDA 2EFGA 2E5LI 4MU3A 2R42A 2VQFE 4P7AA 4DUYI 2AJ4A 4IZJD 3GCMA 5LMUE 1XMQI 1N32E 4DV0E 4DR5E 4U3DA 2O1TA 3LNUA 4FW7A 4FWGA 1I94I 2BV3A 4DPWA 4DV4E 2WP8B 2JEAB 1H7UA 2PO1B 5L3JA 3QT5A 4JV5E 1S16A 4DPTA 4FWHA 4IZJA 3HJCA 4OO1E 1Z5CA 2NN6D 4GQUA 2C38B 4K0KE 1B62A 4QNKA 4JI2E 1OJ4A 1Z5BA 3F0NA 4DR7E 4IZKB 2F4VE 4BA2A 1HK7A 1Z0VA 5ELWA 4GKJI 4PRVA 2UUCE 3K85A 5C0XC 3ZKBA 4OO1B 4N3OA 4RPFA 4YY3E 4JI5I
chains in the Genus database with same CATH topology
1ZM4A 3T1YE 4B3RI 1NHJA 5GMDA 1QZRA 1FI4A 1H73A 1IBLE 1BKNA 3V5RA 2HFUA 2DEJA 4B3SI 4JI0E 4LF9E 4WUBA 1IBKE 1Z5AA 4IZJB 3P06A 3GONA 4JI8I 4Z7YA 4FN5A 2A2CA 4DV7E 3D4JA 4YHHI 4JG4A 2ZM6E 3JAMC 1XNQE 3H4LA 4DR1I 1N33E 1FWLA 4I3HA 1K47A 1KVKA 4LF4I 4LF8I 3K17A 5A2QC 1HNXI 1Y4UA 3ZM7A 2UU9E 1ZM3A 1KIJA 2Z5EA 1J5EE 2X7IA 4JYAE 5LMUI 1N32I 2BM0A 4DV0I 4DR5I 2BM1A 4MYUA 1XHKA 2IOPA 2XEXA 4JI6E 4HACA 3ZZTA 4DV4I 3PYFA 4DPUA 4PRXA 4LFBE 2PNLA 4JI4E 4WUCA 4LFAE 2UXDI 4UT4A 1Z0GA 5FLXQ 2UXCI 4DUZE 1FJGE 2HK3A 4ZVIA 4K0KI 4OX9E 2WW4A 4NXNI 1HR0I 4B3ME 4DR7I 2F4VI 4USMA 2VQEI 1HNWI 1KTVA 4USKA 1IBMI 5FLXC 1DARA 2CGEA 4UTGA 4DR4E 3T1YI 3OTOE 4DV5I 3Q6NA 4FW9A 2Z5CA 4LF5E 4X65I 4DPXA 4HACB 1N34E 1EA6A 4NXMI 3T1HI 1H74A 1WUUA 4JI7E 1XMOE 1N0VC 1IBLI 1RR9A 2ZITA 3K1JA 4LF6E 4HYMA 4URLA 4DR3E 3HULA 4LF9I 3WU3A 1H7SA 4HXZA 4MYTA 2LJPA 4JI1I 2R3VA 4DR2I 2V2VA 4B3TI 4X62E 1XNQI 3Q6MA 4WUDA 1N33I 2V8PA 4KHPI 2UUBE 4LF7I 5LMNI 1Z0EA 2E5LE 4DUYE 1USUA 2Z5CB 2UU9I 2J7KA 2UUAE 4X66E 1FWKA 4AQYI 1J5EI 2UXBE 1I94E 4JYAI 3JAMQ 4DV6E 4KQVA 1Z0TA 5IWAI 2V2QA 4X64I 5BR8I 4DV3E 3B82A 4DR6I 4GKKE 3J80Q 4JI4I 5A2QQ 2V34A 5FWKA 4DPYA 3J7AM 4OX9I 3J80C 1FKAE 4P52A 4B3MI 4JI3I 2CG9A 2VQFI 4FWDA 4DV2E 1MG7A 4PU9A 2V2ZA 1ZXMA 3QT8A 4DR4I 1ZXNA 1XNRE 3OTOI 3ZZ0A 2Q2EB 2ZBKB 4JV5I 1Y4SA 2A2DA 2E1RA 1ELOA 4B3SE 1A6FA 1XMOI 4JI7I 4LF6I 3J81C 4JI2I 4Z7CA 4YHHE 1PVGA 3B8HA 3QT6A 3V2UC 2UUCI 1UEKA 2IOQA 4YY3I 2HHHE 4IZKA 4DV1E 2VF3A 4LF4E 3Q1QA 2OI2A 3ZZUA 1HNXE 4XTJA 3LTOA 1HNZE 1N0UA 4M1KA 1Z59A 3LPSA 2UUAI 4X66I 1KKHA 4JI0I 2UXBI 3PRYA 1IBKI 4DV6I 1NHIA 1Z0CA 4R1FA 4DV3I 4LFCE 4DV7I 4DU8A 2O1UA 2O1VA 1FNMA 2UXDE 4GKKI 2UXCE 2ZM6I 2Z5BA 1EI1A 2X36A 1N36E 4NXNE 4ED4A 1Y6ZA 1HR0E 3PYGA 2VQEE 1HNWE 1IBME 2CZ9A 1VISA 1ZM9A 2DEIA 1XMQE 3PYDA 3M6AA 4DXLA 1Z0BA 4DV2I 1S4EA 4DV5E 5IT9Q 4X65E 4JI6I 1XNRI 1MX0A 4DU7A 4LFBI 4NXME 2HKJA 3T1HE 1Z0WA 4LFAI 1RREA 1USVA 4DUZI 5IT9C 1FJGI 4JI1E 3WU6A 2PNMA 4GKJE 2Z5BB 4DR2E 2GS8A 4JI5E 3QT7A 4B3TE 1U2RA 2HFSA 2HHHI 2O1WA 4KHPE 3J7AG 4DV1I 4LF7E 4B3RE 5LMNE 5LL6R 1PKPA 3J81Q 4LF5I 3ZKDA 2HKEA 1NHHA 1N34I 2GQ0A 1HNZI 4AQYE 2HK2A 1PIEA 3WU5A 5IWAE 4JI8E 4DR3I 1ZM2A 4X64E 1D6TA 3PYEA 5GMEA 5BR8E 4HY1A 4DR6E 1NZ0A 3WU4A 1MU5A 4LFCI 4DR1E 3CWVA 1H72C 4X62I 1B63A 4LF8E 1N36I 2NPFA 2UUBI 3B78A 4JI3E 4EMDA 2EFGA 2E5LI 2VQFE 2R42A 4DUYI 4P7AA 2AJ4A 4IZJD 5LMUE 1XMQI 1N32E 4DV0E 4DR5E 2O1TA 3LNUA 4FWGA 1I94I 2BV3A 4DPWA 4DV4E 1H7UA 5L3JA 3QT5A 4JV5E 1S16A 4DPTA 4FWHA 4IZJA 3HJCA 1Z5CA 4K0KE 1B62A 4JI2E 1OJ4A 1Z5BA 3F0NA 4DR7E 4IZKB 2F4VE 1HK7A 1Z0VA 4GKJI 4PRVA 2UUCE 3K85A 3ZKBA 4N3OA 4RPFA 4YY3E 4JI5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZM4 A;  3T1Y E;  4B3R I;  1NHJ A;  5GMD A;  1QZR A;  1FI4 A;  1H73 A;  1IBL E;  1BKN A;  3V5R A;  2HFU A;  2DEJ A;  4B3S I;  4JI0 E;  4LF9 E;  4WUB A;  1IBK E;  1Z5A A;  3GON A;  4JI8 I;  4Z7Y A;  4FN5 A;  2A2C A;  4DV7 E;  3D4J A;  4YHH I;  4JG4 A;  2ZM6 E;  3JAM C;  1XNQ E;  3H4L A;  4DR1 I;  1N33 E;  1FWL A;  4I3H A;  1K47 A;  1KVK A;  4LF4 I;  4LF8 I;  3K17 A;  1HNX I;  5A2Q C;  3ZM7 A;  2UU9 E;  1ZM3 A;  1KIJ A;  1J5E E;  2X7I A;  4JYA E;  5LMU I;  1N32 I;  2BM0 A;  4DV0 I;  4DR5 I;  2BM1 A;  4MYU A;  1XHK A;  2XEX A;  4JI6 E;  4HAC A;  3ZZT A;  4DV4 I;  3PYF A;  4DPU A;  4PRX A;  4LFB E;  4JI4 E;  4WUC A;  4LFA E;  2UXD I;  4UT4 A;  1Z0G A;  5FLX Q;  2UXC I;  4DUZ E;  1FJG E;  2HK3 A;  4ZVI A;  4K0K I;  4OX9 E;  2WW4 A;  4NXN I;  1HR0 I;  4B3M E;  4DR7 I;  2F4V I;  4USM A;  2VQE I;  1HNW I;  1KTV A;  4USK A;  1IBM I;  5FLX C;  1DAR A;  4UTG A;  4DR4 E;  3T1Y I;  3OTO E;  4DV5 I;  4FW9 A;  4LF5 E;  4X65 I;  4DPX A;  4HAC B;  1N34 E;  1EA6 A;  4NXM I;  3T1H I;  1H74 A;  1WUU A;  4JI7 E;  1XMO E;  1N0V C;  1IBL I;  1RR9 A;  2ZIT A;  3K1J A;  4LF6 E;  4HYM A;  4URL A;  4DR3 E;  3HUL A;  4LF9 I;  3WU3 A;  1H7S A;  4HXZ A;  4MYT A;  2LJP A;  4JI1 I;  2R3V A;  4DR2 I;  2V2V A;  4B3T I;  4X62 E;  1XNQ I;  4WUD A;  1N33 I;  2V8P A;  4KHP I;  2UUB E;  4LF7 I;  5LMN I;  1Z0E A;  2E5L E;  4DUY E;  2UU9 I;  2J7K A;  2UUA E;  4X66 E;  1FWK A;  4AQY I;  1J5E I;  2UXB E;  1I94 E;  4JYA I;  3JAM Q;  4DV6 E;  4KQV A;  1Z0T A;  5IWA I;  2V2Q A;  4X64 I;  5BR8 I;  4DV3 E;  3B82 A;  4DR6 I;  4GKK E;  3J80 Q;  4JI4 I;  5A2Q Q;  2V34 A;  4DPY A;  3J7A M;  4OX9 I;  3J80 C;  1FKA E;  4P52 A;  4B3M I;  4JI3 I;  2VQF I;  4FWD A;  4DV2 E;  1MG7 A;  4PU9 A;  2V2Z A;  1ZXM A;  3QT8 A;  4DR4 I;  1ZXN A;  1XNR E;  3OTO I;  3ZZ0 A;  2Q2E B;  2ZBK B;  4JV5 I;  2A2D A;  2E1R A;  1ELO A;  4B3S E;  1A6F A;  1XMO I;  4JI7 I;  4LF6 I;  3J81 C;  4JI2 I;  4Z7C A;  4YHH E;  1PVG A;  3B8H A;  3QT6 A;  3V2U C;  2UUC I;  1UEK A;  4YY3 I;  2HHH E;  4DV1 E;  2VF3 A;  4LF4 E;  3Q1Q A;  2OI2 A;  3ZZU A;  1HNX E;  4XTJ A;  3LTO A;  1HNZ E;  1N0U A;  4M1K A;  1Z59 A;  3LPS A;  2UUA I;  4X66 I;  1KKH A;  4JI0 I;  2UXB I;  1IBK I;  4DV6 I;  1NHI A;  1Z0C A;  4R1F A;  4DV3 I;  4LFC E;  4DV7 I;  4DU8 A;  1FNM A;  2UXD E;  4GKK I;  2UXC E;  2ZM6 I;  1EI1 A;  2X36 A;  1N36 E;  4NXN E;  4ED4 A;  1HR0 E;  3PYG A;  2VQE E;  1HNW E;  1IBM E;  1VIS A;  1ZM9 A;  2CZ9 A;  2DEI A;  1XMQ E;  3PYD A;  3M6A A;  4DXL A;  1Z0B A;  4DV2 I;  1S4E A;  4DV5 E;  5IT9 Q;  4X65 E;  4JI6 I;  1XNR I;  1MX0 A;  4DU7 A;  4LFB I;  4NXM E;  2HKJ A;  3T1H E;  1Z0W A;  4LFA I;  1RRE A;  4DUZ I;  5IT9 C;  1FJG I;  4JI1 E;  3WU6 A;  4GKJ E;  4DR2 E;  2GS8 A;  4JI5 E;  3QT7 A;  4B3T E;  1U2R A;  2HFS A;  2HHH I;  4KHP E;  3J7A G;  4DV1 I;  4LF7 E;  4B3R E;  5LMN E;  5LL6 R;  1PKP A;  3J81 Q;  4LF5 I;  3ZKD A;  2HKE A;  1NHH A;  1N34 I;  1HNZ I;  4AQY E;  2HK2 A;  1PIE A;  3WU5 A;  5IWA E;  4JI8 E;  4DR3 I;  1ZM2 A;  4X64 E;  1D6T A;  3PYE A;  5GME A;  5BR8 E;  4HY1 A;  4DR6 E;  1NZ0 A;  3WU4 A;  1MU5 A;  4LFC I;  4DR1 E;  3CWV A;  1H72 C;  4X62 I;  1B63 A;  4LF8 E;  1N36 I;  2NPF A;  2UUB I;  3B78 A;  4JI3 E;  4EMD A;  2EFG A;  2E5L I;  2VQF E;  2R42 A;  4DUY I;  4P7A A;  2AJ4 A;  5LMU E;  1XMQ I;  1N32 E;  4DV0 E;  4DR5 E;  3LNU A;  4FWG A;  1I94 I;  2BV3 A;  4DPW A;  4DV4 E;  1H7U A;  5L3J A;  3QT5 A;  4JV5 E;  1S16 A;  4DPT A;  4FWH A;  1Z5C A;  4K0K E;  1B62 A;  4JI2 E;  1OJ4 A;  1Z5B A;  3F0N A;  4DR7 E;  2F4V E;  1Z0V A;  4GKJ I;  4PRV A;  2UUC E;  3ZKB A;  4RPF A;  4YY3 E;  4JI5 I; 
#chains in the Genus database with same CATH topology
 2NN6 A;  3B4T A;  1ZM4 A;  3T1Y E;  1E3H A;  4IS9 A;  4B3R I;  1NHJ A;  5GMD A;  5DRR A;  1QZR A;  1FI4 A;  1H73 A;  1IBL E;  1BKN A;  3V5R A;  2HFU A;  4FW6 A;  2JEB A;  2DEJ A;  4B3S I;  4JI0 E;  4LF9 E;  2GO3 A;  4IFD D;  4WUB A;  1IBK E;  1Z5A A;  4IZJ B;  3P06 A;  3GON A;  4JI8 I;  4Z7Y A;  4FN5 A;  2NN6 E;  1UDN A;  2A2C A;  2C37 A;  4DV7 E;  3D4J A;  4YHH I;  4BA2 B;  1Y60 A;  4JG4 A;  2ZM6 E;  1Y5Y A;  3JAM C;  1XNQ E;  3H4L A;  2WNR B;  4IFD A;  4DR1 I;  1N33 E;  2J65 A;  1FWL A;  4I3H A;  4U3B A;  1K47 A;  1KVK A;  4ISA A;  2NN6 B;  4LF4 I;  4LF8 I;  3K17 A;  5A2Q C;  1HNX I;  1Y4U A;  3ZM7 A;  2UU9 E;  1ZM3 A;  5K36 D;  3GLL A;  1KIJ A;  2Z5E A;  1J5E E;  1OYR A;  2X7I A;  4JYA E;  1R6M A;  1OYP A;  5LMU I;  1N32 I;  2BM0 A;  4DV0 I;  4DR5 I;  2BM1 A;  4MYU A;  1XHK A;  2IOP A;  2JEB B;  2XEX A;  4JI6 E;  4HAC A;  3ZZT A;  4DV4 I;  4OO1 F;  3PYF A;  3U1Y A;  4DPU A;  4PRX A;  4LFB E;  2PNL A;  4IFD E;  4JI4 E;  2GO4 A;  4WUC A;  4LFA E;  2UXD I;  4UT4 A;  1Z0G A;  5FLX Q;  2UXC I;  4DUZ E;  1FJG E;  2HK3 A;  4ZVI A;  4K0K I;  4OX9 E;  2WW4 A;  4BA1 A;  4NXN I;  4IFD B;  1HR0 I;  4B3M E;  4DR7 I;  3P3C A;  4USM A;  2F4V I;  2VQE I;  1HNW I;  1KTV A;  4USK A;  4AIM A;  5FLX C;  1IBM I;  1DAR A;  4AM3 A;  2CGE A;  4UTG A;  3PS3 A;  4MU1 A;  4DR4 E;  3T1Y I;  5K36 E;  3OTO E;  4DV5 I;  3Q6N A;  4FW4 A;  4FW9 A;  2Z5C A;  2JT2 A;  4X65 I;  4LF5 E;  4DPX A;  4HAC B;  3PS2 A;  4QNJ A;  1N34 E;  1EA6 A;  4NXM I;  3T1H I;  1H74 A;  1WUU A;  4JI7 E;  1XMO E;  1N0V C;  1IBL I;  2NN6 F;  4MU4 A;  1RR9 A;  2ZIT A;  3K1J A;  4LF6 E;  4HYM A;  2PO0 A;  5K36 B;  4URL A;  4DR3 E;  3HUL A;  4LF9 I;  3WU3 A;  1H7S A;  4HXZ A;  4MYT A;  2LJP A;  4JI1 I;  2BR2 A;  4BA1 B;  4OZE A;  2R3V A;  4DR2 I;  2V2V A;  4B3T I;  4X62 E;  1XNQ I;  3Q6M A;  4WUD A;  2BA0 G;  1N33 I;  2V8P A;  4OO1 C;  4KHP I;  5JEA D;  2UUB E;  4LF7 I;  5LMN I;  1Z0E A;  5DNL A;  2F1D A;  3P3E A;  2E5L E;  4DUY E;  1USU A;  2Z5C B;  2UU9 I;  2J7K A;  4NBQ A;  2UUA E;  4X66 E;  1FWK A;  1XXE A;  4AQY I;  1E3P A;  4IFD F;  1J5E I;  3NZK A;  1I94 E;  2UXB E;  4JYA I;  3JAM Q;  4DV6 E;  4KQV A;  1Z0T A;  5IWA I;  2V2Q A;  4FW3 A;  4X64 I;  5JEA A;  2PO0 B;  5BR8 I;  4DV3 E;  3B82 A;  4DR6 I;  4GKK E;  3J80 Q;  1UDO A;  4JI4 I;  5EKW A;  5A2Q Q;  2BR2 B;  2V34 A;  5FWK A;  4DPY A;  4LOM A;  3J7A M;  2CVE A;  5EL9 A;  4OX9 I;  3HKM A;  3J80 C;  1FKA E;  4P52 A;  4B3M I;  1YHC A;  4JI3 I;  5K36 F;  2CG9 A;  2VQF I;  4FWD A;  4DV2 E;  1MG7 A;  5JEA E;  2NN6 C;  3PS1 A;  4PU9 A;  2V2Z A;  1ZXM A;  3QT8 A;  4DR4 I;  3CDJ A;  1ZXN A;  1XNR E;  3OTO I;  3ZZ0 A;  2Q2E B;  2ZBK B;  5JEA B;  4JV5 I;  1Y4S A;  2C37 B;  2A2D A;  2E1R A;  1ELO A;  4B3S E;  1A6F A;  2VES A;  3P3G A;  1XMO I;  4JI7 I;  2JEA A;  4LF6 I;  3J81 C;  4JI2 I;  4Z7C A;  2BA0 D;  4YHH E;  1PVG A;  3B8H A;  3QT6 A;  3V2U C;  2UUC I;  5C0X A;  1UEK A;  3H1C A;  4IFD C;  2JE6 A;  2IOQ A;  4YY3 I;  2HHH E;  4IZK A;  4DV1 E;  2VF3 A;  4J3D A;  4LF4 E;  3Q1Q A;  2OI2 A;  3ZZU A;  1HNX E;  4OO1 A;  4XTJ A;  4FW5 A;  5DRP A;  3LTO A;  1HNZ E;  1N0U A;  3U1K A;  4M1K A;  3DD6 A;  1Z59 A;  3LPS A;  2UUA I;  4X66 I;  1KKH A;  1RHY A;  2IES A;  4JI0 I;  2C39 A;  2UXB I;  3PRY A;  1R6L A;  4MDT A;  1IBK I;  4DV6 I;  1NHI A;  5C0X E;  4MQY A;  3M7N G;  1Z0C A;  4R1F A;  4DV3 I;  4LFC E;  4DV7 I;  5K36 C;  4DU8 A;  2O1U A;  2O1V A;  1FNM A;  2UXD E;  4AID A;  4GKK I;  2UXC E;  2ZM6 I;  2Z5B A;  5C0X B;  1EI1 A;  2X36 A;  2JE6 B;  1N36 E;  4NXN E;  4ED4 A;  1Y6Z A;  5JEA F;  1HR0 E;  3PYG A;  2VQE E;  3M85 G;  1HNW E;  1IBM E;  2AE8 A;  1VIS A;  1ZM9 A;  2CZ9 A;  3CDI A;  2DEI A;  2PNZ A;  1XMQ E;  2WNR A;  3PYD A;  3M6A A;  4DXL A;  1Z0B A;  4LCH A;  3UHM A;  4DV2 I;  1S4E A;  4OKG A;  4DV5 E;  5IT9 Q;  4X65 E;  4JI6 I;  1XNR I;  2BA1 D;  2C39 B;  1MX0 A;  4DU7 A;  3P76 A;  4LFB I;  4NXM E;  2HKJ A;  3T1H E;  1Z0W A;  4LFA I;  1RRE A;  1YH8 A;  1USV A;  4DUZ I;  2PO2 A;  5IT9 C;  1FJG I;  4MU0 A;  4JI1 E;  3WU6 A;  2PNM A;  3GME A;  4GKJ E;  2Z5B B;  1P42 A;  4DR2 E;  2GS8 A;  4JI5 E;  3L7Z A;  3QT7 A;  4B3T E;  4LCF A;  1U2R A;  5DNX A;  1UDQ A;  2PNZ B;  1OYS A;  2HFS A;  2HHH I;  2O1W A;  4KHP E;  3J7A G;  4LPF A;  4DV1 I;  4LF7 E;  5LMN E;  4B3R E;  5LL6 R;  1PKP A;  5DRO A;  3J81 Q;  4LF5 I;  3ZKD A;  2HKE A;  1NHH A;  2IER A;  5C0X D;  5C0X F;  2O3Z A;  1N34 I;  2GQ0 A;  1HNZ I;  4AQY E;  5DRQ A;  3M7N D;  2HK2 A;  2BA1 G;  2WP8 A;  1PIE A;  3WU5 A;  5IWA E;  4JI8 E;  5JEA C;  4DR3 I;  1ZM2 A;  3KRN A;  4X64 E;  3PYE A;  2PO1 A;  5GME A;  1D6T A;  5BR8 E;  4OO1 D;  4HY1 A;  2PO2 B;  4LCG A;  4DR6 E;  1NZ0 A;  3WU4 A;  1MU5 A;  2C38 A;  4LFC I;  5K36 A;  1UDS A;  3M85 D;  4DR1 E;  3CWV A;  1H72 C;  4X62 I;  1B63 A;  3L7Z B;  4LF8 E;  1N36 I;  2NPF A;  2UUB I;  3B78 A;  4JI3 E;  1VI7 A;  4EMD A;  2EFG A;  2E5L I;  4MU3 A;  2R42 A;  2VQF E;  4P7A A;  4DUY I;  2AJ4 A;  4IZJ D;  3GCM A;  5LMU E;  1XMQ I;  1N32 E;  4DV0 E;  4DR5 E;  4U3D A;  2O1T A;  3LNU A;  4FW7 A;  4FWG A;  1I94 I;  2BV3 A;  4DPW A;  4DV4 E;  2WP8 B;  2JEA B;  1H7U A;  2PO1 B;  5L3J A;  3QT5 A;  4JV5 E;  1S16 A;  4DPT A;  4FWH A;  4IZJ A;  3HJC A;  4OO1 E;  1Z5C A;  2NN6 D;  4GQU A;  2C38 B;  4K0K E;  1B62 A;  4QNK A;  4JI2 E;  1OJ4 A;  1Z5B A;  3F0N A;  4DR7 E;  4IZK B;  2F4V E;  4BA2 A;  1HK7 A;  1Z0V A;  5ELW A;  4GKJ I;  4PRV A;  2UUC E;  3K85 A;  5C0X C;  3ZKB A;  4OO1 B;  4N3O A;  4RPF A;  4YY3 E;  4JI5 I; 
#chains in the Genus database with same CATH homology
 1ZM4 A;  3T1Y E;  4B3R I;  1NHJ A;  5GMD A;  1QZR A;  1FI4 A;  1H73 A;  1IBL E;  1BKN A;  3V5R A;  2HFU A;  2DEJ A;  4B3S I;  4JI0 E;  4LF9 E;  4WUB A;  1IBK E;  1Z5A A;  4IZJ B;  3P06 A;  3GON A;  4JI8 I;  4Z7Y A;  4FN5 A;  2A2C A;  4DV7 E;  3D4J A;  4YHH I;  4JG4 A;  2ZM6 E;  3JAM C;  1XNQ E;  3H4L A;  4DR1 I;  1N33 E;  1FWL A;  4I3H A;  1K47 A;  1KVK A;  4LF4 I;  4LF8 I;  3K17 A;  5A2Q C;  1HNX I;  1Y4U A;  3ZM7 A;  2UU9 E;  1ZM3 A;  1KIJ A;  2Z5E A;  1J5E E;  2X7I A;  4JYA E;  5LMU I;  1N32 I;  2BM0 A;  4DV0 I;  4DR5 I;  2BM1 A;  4MYU A;  1XHK A;  2IOP A;  2XEX A;  4JI6 E;  4HAC A;  3ZZT A;  4DV4 I;  3PYF A;  4DPU A;  4PRX A;  4LFB E;  2PNL A;  4JI4 E;  4WUC A;  4LFA E;  2UXD I;  4UT4 A;  1Z0G A;  5FLX Q;  2UXC I;  4DUZ E;  1FJG E;  2HK3 A;  4ZVI A;  4K0K I;  4OX9 E;  2WW4 A;  4NXN I;  1HR0 I;  4B3M E;  4DR7 I;  2F4V I;  4USM A;  2VQE I;  1HNW I;  1KTV A;  4USK A;  1IBM I;  5FLX C;  1DAR A;  2CGE A;  4UTG A;  4DR4 E;  3T1Y I;  3OTO E;  4DV5 I;  3Q6N A;  4FW9 A;  2Z5C A;  4LF5 E;  4X65 I;  4DPX A;  4HAC B;  1N34 E;  1EA6 A;  4NXM I;  3T1H I;  1H74 A;  1WUU A;  4JI7 E;  1XMO E;  1N0V C;  1IBL I;  1RR9 A;  2ZIT A;  3K1J A;  4LF6 E;  4HYM A;  4URL A;  4DR3 E;  3HUL A;  4LF9 I;  3WU3 A;  1H7S A;  4HXZ A;  4MYT A;  2LJP A;  4JI1 I;  2R3V A;  4DR2 I;  2V2V A;  4B3T I;  4X62 E;  1XNQ I;  3Q6M A;  4WUD A;  1N33 I;  2V8P A;  4KHP I;  2UUB E;  4LF7 I;  5LMN I;  1Z0E A;  2E5L E;  4DUY E;  1USU A;  2Z5C B;  2UU9 I;  2J7K A;  2UUA E;  4X66 E;  1FWK A;  4AQY I;  1J5E I;  2UXB E;  1I94 E;  4JYA I;  3JAM Q;  4DV6 E;  4KQV A;  1Z0T A;  5IWA I;  2V2Q A;  4X64 I;  5BR8 I;  4DV3 E;  3B82 A;  4DR6 I;  4GKK E;  3J80 Q;  4JI4 I;  5A2Q Q;  2V34 A;  5FWK A;  4DPY A;  3J7A M;  4OX9 I;  3J80 C;  1FKA E;  4P52 A;  4B3M I;  4JI3 I;  2CG9 A;  2VQF I;  4FWD A;  4DV2 E;  1MG7 A;  4PU9 A;  2V2Z A;  1ZXM A;  3QT8 A;  4DR4 I;  1ZXN A;  1XNR E;  3OTO I;  3ZZ0 A;  2Q2E B;  2ZBK B;  4JV5 I;  1Y4S A;  2A2D A;  2E1R A;  1ELO A;  4B3S E;  1A6F A;  1XMO I;  4JI7 I;  4LF6 I;  3J81 C;  4JI2 I;  4Z7C A;  4YHH E;  1PVG A;  3B8H A;  3QT6 A;  3V2U C;  2UUC I;  1UEK A;  2IOQ A;  4YY3 I;  2HHH E;  4IZK A;  4DV1 E;  2VF3 A;  4LF4 E;  3Q1Q A;  2OI2 A;  3ZZU A;  1HNX E;  4XTJ A;  3LTO A;  1HNZ E;  1N0U A;  4M1K A;  1Z59 A;  3LPS A;  2UUA I;  4X66 I;  1KKH A;  4JI0 I;  2UXB I;  3PRY A;  1IBK I;  4DV6 I;  1NHI A;  1Z0C A;  4R1F A;  4DV3 I;  4LFC E;  4DV7 I;  4DU8 A;  2O1U A;  2O1V A;  1FNM A;  2UXD E;  4GKK I;  2UXC E;  2ZM6 I;  2Z5B A;  1EI1 A;  2X36 A;  1N36 E;  4NXN E;  4ED4 A;  1Y6Z A;  1HR0 E;  3PYG A;  2VQE E;  1HNW E;  1IBM E;  2CZ9 A;  1VIS A;  1ZM9 A;  2DEI A;  1XMQ E;  3PYD A;  3M6A A;  4DXL A;  1Z0B A;  4DV2 I;  1S4E A;  4DV5 E;  5IT9 Q;  4X65 E;  4JI6 I;  1XNR I;  1MX0 A;  4DU7 A;  4LFB I;  4NXM E;  2HKJ A;  3T1H E;  1Z0W A;  4LFA I;  1RRE A;  1USV A;  4DUZ I;  5IT9 C;  1FJG I;  4JI1 E;  3WU6 A;  2PNM A;  4GKJ E;  2Z5B B;  4DR2 E;  2GS8 A;  4JI5 E;  3QT7 A;  4B3T E;  1U2R A;  2HFS A;  2HHH I;  2O1W A;  4KHP E;  3J7A G;  4DV1 I;  4LF7 E;  4B3R E;  5LMN E;  5LL6 R;  1PKP A;  3J81 Q;  4LF5 I;  3ZKD A;  2HKE A;  1NHH A;  1N34 I;  2GQ0 A;  1HNZ I;  4AQY E;  2HK2 A;  1PIE A;  3WU5 A;  5IWA E;  4JI8 E;  4DR3 I;  1ZM2 A;  4X64 E;  1D6T A;  3PYE A;  5GME A;  5BR8 E;  4HY1 A;  4DR6 E;  1NZ0 A;  3WU4 A;  1MU5 A;  4LFC I;  4DR1 E;  3CWV A;  1H72 C;  4X62 I;  1B63 A;  4LF8 E;  1N36 I;  2NPF A;  2UUB I;  3B78 A;  4JI3 E;  4EMD A;  2EFG A;  2E5L I;  2VQF E;  2R42 A;  4DUY I;  4P7A A;  2AJ4 A;  4IZJ D;  5LMU E;  1XMQ I;  1N32 E;  4DV0 E;  4DR5 E;  2O1T A;  3LNU A;  4FWG A;  1I94 I;  2BV3 A;  4DPW A;  4DV4 E;  1H7U A;  5L3J A;  3QT5 A;  4JV5 E;  1S16 A;  4DPT A;  4FWH A;  4IZJ A;  3HJC A;  1Z5C A;  4K0K E;  1B62 A;  4JI2 E;  1OJ4 A;  1Z5B A;  3F0N A;  4DR7 E;  4IZK B;  2F4V E;  1HK7 A;  1Z0V A;  4GKJ I;  4PRV A;  2UUC E;  3K85 A;  3ZKB A;  4N3O A;  4RPF A;  4YY3 E;  4JI5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...