4LF7I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 27
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf7I00
1IBKI 4DUYI 3GONA 3B82A 4LF8E 3QT5A 4RPFA 2BV3A 5LMUI 4JI7E 3OTOE 1MU5A 4DR5E 2E5LE 4YHHE 5IT9C 1IBKE 2E1RA 1XNQE 1J5EI 4LF8I 4DV3I 2VQFE 4DV1E 2HHHE 2V2VA 4Z7YA 3QT8A 4B3ME 1U2RA 4UTGA 1J5EE 1OJ4A 1HR0I 2UXBI 4OX9E 2OI2A 4DV3E 2VQFI 4DV1I 1EA6A 4FW9A 3T1YE 4LF7E 4LF4I 1N0VC 1A6FA 4DUZE 4DXLA 5LL6R 3QT7A 2UU9I 1S4EA 3J7AG 1XNRI 3PYEA 1FJGE 4LFBI 1PIEA 4DR1I 4JI5I 4JI8I 4JI1I 4X65I 4DV5E 1XNRE 4LFCE 4GKJI 2HK2A 2UUAI 3QT6A 1Z0VA 3WU4A 2ZM6I 1FJGI 4X64E 1N32E 2HKEA 4WUCA 2VQEI 1PKPA 1ZXNA 2ZM6E 3J80Q 4LF9I 1N32I 1XHKA 4LF5I 4DV4I 5A2QC 4DV7I 4JI4E 1Z0BA 2BM0A 4NXMI 1D6TA 4JI2E 4JYAE 4Z7CA 4P52A 4YHHI 1FKAE 4ZVIA 1H7UA 1BKNA 1Z0EA 5GMDA 1MG7A 3LTOA 4JV5I 4HACA 3D4JA 2A2CA 4JI2I 4JG4A 4DU7A 4K0KI 2UXBE 1HNZI 4DV2E 2ZITA 1ELOA 1Z5CA 1ZM3A 4K0KE 3J7AM 4FN5A 1NHIA 3F0NA 1S16A 4JI0E 3ZZ0A 2UU9E 4LFAE 4HYMA 4P7AA 5FLXC 4YY3I 4JI6I 1I94E 4DV0E 2V8PA 2VF3A 5LMNI 2HKJA 1RR9A 4OX9I 4JI5E 1N36E 4X65E 4DV5I 2UXCI 4FWGA 5IT9Q 4KHPI 5IWAE 2R3VA 4DPXA 2V2ZA 4DUZI 2ZBKB 1ZXMA 4M1KA 4DR4I 3LPSA 3H4LA 4ED4A 2EFGA 3WU6A 1NZ0A 3PYDA 2UUCI 4DR4E 4JI1E 1B62A 1NHJA 2X36A 3J81Q 4LFCI 4GKJE 3WU3A 4EMDA 4FWHA 4X66I 4AQYI 1XMOE 4NXNI 4GKKI 1HNWI 1Z59A 3B78A 2WW4A 3K17A 1IBLE 2BM1A 4USKA 1N0UA 4DV7E 1N33I 3JAMC 2R42A 3T1HI 1UEKA 4I3HA 4DV2I 2F4VI 5GMEA 4PRXA 1N33E 4DR2I 3T1HE 4JV5E 2F4VE 4DR7I 3OTOI 3HULA 3V2UC 4USMA 2E5LI 3CWVA 1I94I 1HNXI 4LF4E 1XNQI 1FWKA 2XEXA 4DR7E 4LF6E 1H72C 2HFSA 5FLXQ 4X62E 4HXZA 1FWLA 2Q2EB 1FI4A 3J80C 5IWAI 1HR0E 4LFBE 4DR1E 5BR8E 4X62I 2DEIA 4R1FA 1Z5BA 1Z0TA 1Z5AA 5LMNE 4B3TI 1XMQI 2A2DA 2V2QA 3ZKDA 2VQEE 1KIJA 3B8HA 3ZZTA 4KHPE 4DR6I 1XMOI 4MYTA 4B3RI 3PYFA 4LF5E 2J7KA 4DPWA 2UXDI 4JI8E 3V5RA 4KQVA 4B3SE 4DR6E 2UUBI 2UUCE 4WUBA 3ZZUA 4DPTA 1DARA 3K1JA 2NPFA 1N34E 5L3JA 4HACB 2UUBE 4HY1A 3ZM7A 4JI7I 4DV6I 4GKKE 1HNWE 4DR3E 4DR2E 4JI4I 1IBMI 1HNZE 3LNUA 4PU9A 3Q1QA 4DV6E 1QZRA 2HHHI 4DR3I 4UT4A 3J81C 1HNXE 1KKHA 3PYGA 1KTVA 2CZ9A 5LMUE 4LFAI 4DR5I 1WUUA 4YY3E 2HK3A 4JI6E 3T1YI 4LF7I 1RREA 4DU8A 1KVKA 2AJ4A 2V34A 4FWDA 1Z0CA 1N36I 1ZM9A 4B3MI 1Z0WA 4MYUA 3ZKBA 4PRVA 1ZM4A 4LF6I 4B3TE 4JI0I 1XMQE 3WU5A 1NHHA 4DV0I 2UUAE 2HFUA 4X64I 2X7IA 1FNMA 4B3RE 5BR8I 1EI1A 2UXDE 1MX0A 1VISA 1H7SA 2UXCE 1Z0GA 4B3SI 3JAMQ 4X66E 4AQYE 4DPUA 2DEJA 4LF9E 1H74A 4URLA 4DPYA 4JI3I 1N34I 1IBLI 2LJPA 4NXME 1K47A 4JYAI 2GS8A 4DUYE 4JI3E 5A2QQ 1H73A 3M6AA 4WUDA 1PVGA 1IBME 1ZM2A 4NXNE 4DV4E 1B63A 4XTJA
chains in the Genus database with same CATH superfamily
1IBKI 4DUYI 3GONA 5C0XB 3B82A 3U1YA 4LF8E 3QT5A 4RPFA 2BV3A 5LMUI 4JI7E 5DROA 3OTOE 2PNZA 1MU5A 4DR5E 2BA0G 2E5LE 4YHHE 5IT9C 1IBKE 2E1RA 1XNQE 1J5EI 4LF8I 2O3ZA 4AIMA 4DV3I 2VQFE 4DV1E 3CDJA 2HHHE 2V2VA 4Z7YA 3QT8A 4B3ME 3L7ZA 4IZJA 1U2RA 4UTGA 1Y4SA 4FW6A 1J5EE 4IFDD 1OJ4A 1HR0I 3M7ND 2UXBI 4OX9E 4MU3A 2OI2A 3NZKA 2VQFI 2PO0A 2Z5EA 4DV1I 4DV3E 4J3DA 1EA6A 5C0XA 3P3CA 4FW9A 3B4TA 3P3GA 3T1YE 2WP8B 4LF7E 2PO2A 4LF4I 1N0VC 3M85D 4FW4A 3HKMA 1A6FA 1YHCA 1E3PA 4OZEA 4DUZE 4DXLA 5LL6R 3QT7A 2UU9I 1S4EA 4OO1D 3P76A 5C0XC 2JE6B 3J7AG 1XNRI 2NN6A 3PYEA 1FJGE 4LFBI 1PIEA 2C39A 4DR1I 2BA0D 4BA1A 4JI5I 4JI8I 4AIDA 4JI1I 4X65I 4DV5E 5ELWA 1XNRE 4LFCE 4GKJI 2HK2A 2UUAI 3QT6A 1Z0VA 3WU4A 2ZM6I 1FJGI 4X64E 1N32E 2HKEA 4WUCA 2VQEI 2CGEA 1PKPA 4IS9A 4BA2A 1ZXNA 2ZM6E 2C39B 3J80Q 4LF9I 1N32I 1XHKA 4LF5I 2WNRA 4DV4I 2F1DA 5EL9A 5A2QC 4DV7I 4NBQA 4JI4E 4U3DA 1Z0BA 2BM0A 1RHYA 2O1WA 4NXMI 1D6TA 4JI2E 4JYAE 4P52A 4Z7CA 2PO1A 2NN6D 4YHHI 2PNMA 1FKAE 4ZVIA 1H7UA 1BKNA 1Z0EA 5GMDA 1MG7A 4AM3A 5K36C 3LTOA 2GO4A 3UHMA 4JV5I 4HACA 3D4JA 5DRQA 3U1KA 2A2CA 1UDNA 2J65A 4JI2I 3L7ZB 4JG4A 4DU7A 5K36E 4K0KI 2UXBE 5FWKA 4DV2E 1HNZI 2ZITA 3P06A 1ELOA 1Z5CA 4MU1A 1ZM3A 2Z5CB 4K0KE 2AE8A 3J7AM 4FN5A 1NHIA 3F0NA 1S16A 3ZZ0A 4JI0E 2UU9E 4LFAE 3M7NG 4HYMA 3KRNA 4P7AA 5FLXC 4YY3I 4JI6I 2PO1B 4FW3A 1I94E 4DV0E 3PS2A 2V8PA 4IFDA 2VF3A 5LMNI 2IERA 2HKJA 2C37B 5K36A 1RR9A 4OX9I 4JI5E 1N36E 4X65E 4DV5I 2JE6A 4LOMA 2UXCI 4FWGA 5IT9Q 4FW5A 4KHPI 5IWAE 2R3VA 2C37A 4DPXA 2V2ZA 4IFDF 4DUZI 1OYRA 2CG9A 2NN6C 2ZBKB 1ZXMA 4M1KA 2JT2A 4ISAA 2BR2B 4FW7A 3P3EA 4DR4I 2IOQA 4BA2B 3LPSA 4LCGA 3H4LA 1E3HA 4ED4A 2EFGA 4U3BA 2Z5BA 3Q6MA 3WU6A 1NZ0A 3PYDA 2UUCI 2GO3A 2Z5BB 4DR4E 2O1VA 4IZJB 4JI1E 1B62A 1NHJA 2X36A 3J81Q 5C0XE 4LFCI 4GKJE 3WU3A 4EMDA 4FWHA 4X66I 4LCHA 2O1TA 4AQYI 1XMOE 4NXNI 3DD6A 2NN6B 5DNLA 4GKKI 1HNWI 3Q6NA 1Z59A 3B78A 2WW4A 3K17A 1OYPA 1IBLE 3PRYA 4IFDB 2BM1A 4USKA 2CVEA 2WP8A 1UDOA 1N0UA 4DV7E 1N33I 4MDTA 3CDIA 3JAMC 2R42A 3T1HI 1UEKA 4I3HA 4DV2I 2F4VI 5GMEA 4PRXA 3GLLA 5JEAB 2Z5CA 2C38A 1N33E 2WNRB 4DR2I 3T1HE 4JV5E 2F4VE 4DR7I 3H1CA 3OTOI 3V2UC 3HULA 4IFDC 4USMA 2E5LI 2JEAA 3CWVA 1I94I 1HNXI 4LF4E 1XNQI 1FWKA 1VI7A 2XEXA 4DR7E 4LF6E 3PS1A 1H72C 5C0XF 2HFSA 5FLXQ 4X62E 1P42A 5EKWA 4HXZA 4LPFA 4LCFA 1FWLA 2Q2EB 1FI4A 4OKGA 3J80C 5IWAI 1HR0E 4LFBE 5JEAC 4QNJA 4DR1E 5BR8E 4X62I 2DEIA 4R1FA 1Z5BA 1Z0TA 2NN6F 1R6MA 1Z5AA 5LMNE 1Y6ZA 4B3TI 1XMQI 2A2DA 2V2QA 3ZKDA 2VQEE 1KIJA 1XXEA 1YH8A 3B8HA 2IESA 2O1UA 1Y5YA 3ZZTA 4KHPE 4DR6I 1XMOI 4MYTA 4B3RI 2JEBB 3PYFA 2J7KA 5JEAE 4LF5E 4DPWA 2UXDI 4JI8E 3V5RA 4KQVA 2BR2A 1UDQA 5DRPA 4B3SE 5DRRA 4DR6E 1UDSA 2UUBI 2UUCE 4WUBA 3ZZUA 4DPTA 1DARA 4IFDE 3K1JA 4MU4A 2NPFA 1N34E 5L3JA 4HACB 2UUBE 2PNLA 4HY1A 3ZM7A 4JI7I 4DV6I 4GKKE 1HNWE 1USVA 4DR3E 1HK7A 2BA1D 4IZKB 4DR2E 2PO0B 4JI4I 1IBMI 4OO1E 2VESA 1HNZE 3LNUA 4PU9A 3Q1QA 4IZJD 4QNKA 4DV6E 1QZRA 2HHHI 3GCMA 4DR3I 2JEAB 4UT4A 3J81C 5JEAF 1OYSA 1HNXE 1KKHA 3PYGA 1KTVA 5C0XD 1Y60A 2CZ9A 5LMUE 4LFAI 4DR5I 1WUUA 4OO1F 3PS3A 4YY3E 2HK3A 4JI6E 3T1YI 4MQYA 2C38B 4LF7I 2PNZB 2JEBA 1RREA 4DU8A 4OO1C 1KVKA 3GMEA 2AJ4A 2V34A 4FWDA 1Z0CA 1N36I 1ZM9A 3M85G 4B3MI 1Z0WA 1R6LA 4GQUA 4MYUA 3ZKBA 4PRVA 1ZM4A 4LF6I 4B3TE 4JI0I 1XMQE 3WU5A 1NHHA 4N3OA 4DV0I 2UUAE 2HFUA 2BA1G 5K36B 4X64I 2X7IA 1FNMA 2NN6E 4B3RE 5BR8I 1EI1A 2UXDE 1MX0A 1VISA 4OO1B 1H7SA 2UXCE 1USUA 1Z0GA 4B3SI 3JAMQ 4X66E 1Y4UA 4DPUA 2DEJA 4AQYE 4LF9E 1H74A 4URLA 5K36D 4DPYA 4OO1A 5JEAD 4JI3I 4MU0A 4BA1B 1N34I 5K36F 1IBLI 2LJPA 2IOPA 4NXME 1K47A 3K85A 4JYAI 3HJCA 2GS8A 4DUYE 4JI3E 5A2QQ 5JEAA 1H73A 3M6AA 4WUDA 2GQ0A 1PVGA 1IBME 1ZM2A 4NXNE 4IZKA 4DV4E 2PO2B 1B63A 4XTJA 5DNXA
chains in the Genus database with same CATH topology
1IBKI 4DUYI 3GONA 3B82A 4LF8E 3QT5A 4RPFA 2BV3A 5LMUI 4JI7E 3OTOE 1MU5A 4DR5E 2E5LE 4YHHE 5IT9C 1IBKE 2E1RA 1XNQE 1J5EI 4LF8I 4DV3I 2VQFE 4DV1E 2HHHE 2V2VA 4Z7YA 3QT8A 4B3ME 4IZJA 1U2RA 4UTGA 1Y4SA 1J5EE 1OJ4A 1HR0I 2UXBI 4OX9E 2OI2A 4DV3E 2VQFI 2Z5EA 4DV1I 1EA6A 4FW9A 3T1YE 4LF7E 4LF4I 1N0VC 1A6FA 4DUZE 4DXLA 5LL6R 3QT7A 2UU9I 1S4EA 3J7AG 1XNRI 3PYEA 1FJGE 4LFBI 1PIEA 4DR1I 4JI5I 4JI8I 4JI1I 4X65I 4DV5E 1XNRE 4LFCE 4GKJI 2UUAI 2HK2A 3QT6A 1Z0VA 3WU4A 2ZM6I 1FJGI 4X64E 1N32E 2HKEA 4WUCA 2VQEI 2CGEA 1PKPA 1ZXNA 2ZM6E 3J80Q 4LF9I 1N32I 1XHKA 4LF5I 4DV4I 5A2QC 4DV7I 4JI4E 1Z0BA 2BM0A 2O1WA 4NXMI 1D6TA 4JI2E 4JYAE 4Z7CA 4P52A 4YHHI 2PNMA 1FKAE 4ZVIA 1H7UA 1BKNA 1Z0EA 5GMDA 1MG7A 3LTOA 4JV5I 4HACA 3D4JA 2A2CA 4JI2I 4JG4A 4DU7A 4K0KI 2UXBE 5FWKA 4DV2E 1HNZI 2ZITA 3P06A 1ELOA 1Z5CA 1ZM3A 2Z5CB 4K0KE 3J7AM 4FN5A 1NHIA 3F0NA 1S16A 3ZZ0A 4JI0E 2UU9E 4LFAE 4HYMA 4P7AA 5FLXC 4YY3I 4JI6I 1I94E 4DV0E 2V8PA 2VF3A 5LMNI 2HKJA 1RR9A 4OX9I 4JI5E 1N36E 4X65E 4DV5I 2UXCI 4FWGA 5IT9Q 4KHPI 5IWAE 2R3VA 4DPXA 2V2ZA 4DUZI 2CG9A 2ZBKB 1ZXMA 4M1KA 4DR4I 2IOQA 3LPSA 3H4LA 4ED4A 2EFGA 2Z5BA 3Q6MA 3WU6A 1NZ0A 3PYDA 2UUCI 2Z5BB 4DR4E 2O1VA 4IZJB 4JI1E 1B62A 1NHJA 2X36A 3J81Q 4LFCI 4GKJE 3WU3A 4EMDA 4FWHA 4X66I 2O1TA 4AQYI 1XMOE 4NXNI 4GKKI 1HNWI 3Q6NA 1Z59A 3B78A 2WW4A 3K17A 1IBLE 3PRYA 2BM1A 4USKA 1N0UA 4DV7E 1N33I 3JAMC 2R42A 3T1HI 1UEKA 4I3HA 4DV2I 2F4VI 5GMEA 4PRXA 2Z5CA 1N33E 4DR2I 3T1HE 4JV5E 2F4VE 4DR7I 3OTOI 3HULA 3V2UC 4USMA 2E5LI 3CWVA 1I94I 1HNXI 4LF4E 1XNQI 1FWKA 2XEXA 4DR7E 4LF6E 1H72C 2HFSA 5FLXQ 4X62E 4HXZA 1FWLA 2Q2EB 1FI4A 3J80C 5IWAI 1HR0E 4LFBE 4DR1E 5BR8E 4X62I 2DEIA 4R1FA 1Z5BA 1Z0TA 1Z5AA 5LMNE 1Y6ZA 4B3TI 1XMQI 2A2DA 2V2QA 3ZKDA 2VQEE 1KIJA 3B8HA 2O1UA 3ZZTA 4KHPE 4DR6I 1XMOI 4MYTA 4B3RI 3PYFA 4LF5E 2J7KA 4DPWA 2UXDI 4JI8E 3V5RA 4KQVA 4B3SE 4DR6E 2UUBI 2UUCE 4WUBA 3ZZUA 4DPTA 1DARA 3K1JA 2NPFA 1N34E 5L3JA 4HACB 2UUBE 2PNLA 4HY1A 3ZM7A 4JI7I 4DV6I 4GKKE 1HNWE 1USVA 4DR3E 1HK7A 4IZKB 4DR2E 4JI4I 1IBMI 1HNZE 3LNUA 4PU9A 3Q1QA 4IZJD 4DV6E 1QZRA 2HHHI 4DR3I 4UT4A 3J81C 1HNXE 1KKHA 3PYGA 1KTVA 2CZ9A 5LMUE 4LFAI 4DR5I 1WUUA 4YY3E 2HK3A 4JI6E 3T1YI 4LF7I 1RREA 4DU8A 1KVKA 2AJ4A 2V34A 4FWDA 1Z0CA 1N36I 1ZM9A 4B3MI 1Z0WA 4MYUA 3ZKBA 4PRVA 1ZM4A 4LF6I 4B3TE 4JI0I 1XMQE 3WU5A 1NHHA 4N3OA 4DV0I 2UUAE 2HFUA 4X64I 2X7IA 1FNMA 4B3RE 5BR8I 1EI1A 2UXDE 1MX0A 1VISA 1H7SA 2UXCE 1USUA 1Z0GA 4B3SI 3JAMQ 4X66E 1Y4UA 4DPUA 2DEJA 4AQYE 4LF9E 1H74A 4URLA 4DPYA 4JI3I 1N34I 1IBLI 2LJPA 2IOPA 4NXME 1K47A 3K85A 4JYAI 3HJCA 2GS8A 4DUYE 4JI3E 5A2QQ 1H73A 3M6AA 4WUDA 2GQ0A 1PVGA 1IBME 1ZM2A 4NXNE 4IZKA 4DV4E 1B63A 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK I;  4DUY I;  3GON A;  3B82 A;  4LF8 E;  3QT5 A;  4RPF A;  2BV3 A;  5LMU I;  4JI7 E;  3OTO E;  1MU5 A;  4DR5 E;  2E5L E;  4YHH E;  5IT9 C;  1IBK E;  2E1R A;  1XNQ E;  1J5E I;  4LF8 I;  4DV3 I;  2VQF E;  4DV1 E;  2HHH E;  2V2V A;  4Z7Y A;  3QT8 A;  4B3M E;  1U2R A;  4UTG A;  1J5E E;  1OJ4 A;  1HR0 I;  2UXB I;  4OX9 E;  2OI2 A;  4DV3 E;  2VQF I;  4DV1 I;  1EA6 A;  4FW9 A;  3T1Y E;  4LF7 E;  4LF4 I;  1N0V C;  1A6F A;  4DUZ E;  4DXL A;  5LL6 R;  3QT7 A;  2UU9 I;  1S4E A;  3J7A G;  1XNR I;  3PYE A;  1FJG E;  4LFB I;  1PIE A;  4DR1 I;  4JI5 I;  4JI8 I;  4JI1 I;  4X65 I;  4DV5 E;  1XNR E;  4LFC E;  4GKJ I;  2HK2 A;  2UUA I;  3QT6 A;  1Z0V A;  3WU4 A;  2ZM6 I;  1FJG I;  4X64 E;  1N32 E;  2HKE A;  4WUC A;  2VQE I;  1PKP A;  1ZXN A;  2ZM6 E;  3J80 Q;  4LF9 I;  1N32 I;  1XHK A;  4LF5 I;  4DV4 I;  5A2Q C;  4DV7 I;  4JI4 E;  1Z0B A;  2BM0 A;  4NXM I;  1D6T A;  4JI2 E;  4JYA E;  4Z7C A;  4P52 A;  4YHH I;  1FKA E;  4ZVI A;  1H7U A;  1BKN A;  1Z0E A;  5GMD A;  1MG7 A;  3LTO A;  4JV5 I;  4HAC A;  3D4J A;  2A2C A;  4JI2 I;  4JG4 A;  4DU7 A;  4K0K I;  2UXB E;  1HNZ I;  4DV2 E;  2ZIT A;  1ELO A;  1Z5C A;  1ZM3 A;  4K0K E;  3J7A M;  4FN5 A;  1NHI A;  3F0N A;  1S16 A;  4JI0 E;  3ZZ0 A;  2UU9 E;  4LFA E;  4HYM A;  4P7A A;  5FLX C;  4YY3 I;  4JI6 I;  1I94 E;  4DV0 E;  2V8P A;  2VF3 A;  5LMN I;  2HKJ A;  1RR9 A;  4OX9 I;  4JI5 E;  1N36 E;  4X65 E;  4DV5 I;  2UXC I;  4FWG A;  5IT9 Q;  4KHP I;  5IWA E;  2R3V A;  4DPX A;  2V2Z A;  4DUZ I;  2ZBK B;  1ZXM A;  4M1K A;  4DR4 I;  3LPS A;  3H4L A;  4ED4 A;  2EFG A;  3WU6 A;  1NZ0 A;  3PYD A;  2UUC I;  4DR4 E;  4JI1 E;  1B62 A;  1NHJ A;  2X36 A;  3J81 Q;  4LFC I;  4GKJ E;  3WU3 A;  4EMD A;  4FWH A;  4X66 I;  4AQY I;  1XMO E;  4NXN I;  4GKK I;  1HNW I;  1Z59 A;  3B78 A;  2WW4 A;  3K17 A;  1IBL E;  2BM1 A;  4USK A;  1N0U A;  4DV7 E;  1N33 I;  3JAM C;  2R42 A;  3T1H I;  1UEK A;  4I3H A;  4DV2 I;  2F4V I;  5GME A;  4PRX A;  1N33 E;  4DR2 I;  3T1H E;  4JV5 E;  2F4V E;  4DR7 I;  3OTO I;  3HUL A;  3V2U C;  4USM A;  2E5L I;  3CWV A;  1I94 I;  1HNX I;  4LF4 E;  1XNQ I;  1FWK A;  2XEX A;  4DR7 E;  4LF6 E;  1H72 C;  2HFS A;  5FLX Q;  4X62 E;  4HXZ A;  1FWL A;  2Q2E B;  1FI4 A;  3J80 C;  5IWA I;  1HR0 E;  4LFB E;  4DR1 E;  5BR8 E;  4X62 I;  2DEI A;  4R1F A;  1Z5B A;  1Z0T A;  1Z5A A;  5LMN E;  4B3T I;  1XMQ I;  2A2D A;  2V2Q A;  3ZKD A;  2VQE E;  1KIJ A;  3B8H A;  3ZZT A;  4KHP E;  4DR6 I;  1XMO I;  4MYT A;  4B3R I;  3PYF A;  4LF5 E;  2J7K A;  4DPW A;  2UXD I;  4JI8 E;  3V5R A;  4KQV A;  4B3S E;  4DR6 E;  2UUB I;  2UUC E;  4WUB A;  3ZZU A;  4DPT A;  1DAR A;  3K1J A;  2NPF A;  1N34 E;  5L3J A;  4HAC B;  2UUB E;  4HY1 A;  3ZM7 A;  4JI7 I;  4DV6 I;  4GKK E;  1HNW E;  4DR3 E;  4DR2 E;  4JI4 I;  1IBM I;  1HNZ E;  3LNU A;  4PU9 A;  3Q1Q A;  4DV6 E;  1QZR A;  2HHH I;  4DR3 I;  4UT4 A;  3J81 C;  1HNX E;  1KKH A;  3PYG A;  1KTV A;  2CZ9 A;  5LMU E;  4LFA I;  4DR5 I;  1WUU A;  4YY3 E;  2HK3 A;  4JI6 E;  3T1Y I;  4LF7 I;  1RRE A;  4DU8 A;  1KVK A;  2AJ4 A;  2V34 A;  4FWD A;  1Z0C A;  1N36 I;  1ZM9 A;  4B3M I;  1Z0W A;  4MYU A;  3ZKB A;  4PRV A;  1ZM4 A;  4LF6 I;  4B3T E;  4JI0 I;  1XMQ E;  3WU5 A;  1NHH A;  4DV0 I;  2UUA E;  2HFU A;  4X64 I;  2X7I A;  1FNM A;  4B3R E;  5BR8 I;  1EI1 A;  2UXD E;  1MX0 A;  1VIS A;  1H7S A;  2UXC E;  1Z0G A;  4B3S I;  3JAM Q;  4X66 E;  4AQY E;  4DPU A;  2DEJ A;  4LF9 E;  1H74 A;  4URL A;  4DPY A;  4JI3 I;  1N34 I;  1IBL I;  2LJP A;  4NXM E;  1K47 A;  4JYA I;  2GS8 A;  4DUY E;  4JI3 E;  5A2Q Q;  1H73 A;  3M6A A;  4WUD A;  1PVG A;  1IBM E;  1ZM2 A;  4NXN E;  4DV4 E;  1B63 A;  4XTJ A; 
#chains in the Genus database with same CATH topology
 1IBK I;  4DUY I;  3GON A;  5C0X B;  3B82 A;  3U1Y A;  4LF8 E;  3QT5 A;  4RPF A;  2BV3 A;  5LMU I;  4JI7 E;  5DRO A;  3OTO E;  2PNZ A;  1MU5 A;  4DR5 E;  2BA0 G;  2E5L E;  4YHH E;  5IT9 C;  1IBK E;  2E1R A;  1XNQ E;  1J5E I;  4LF8 I;  2O3Z A;  4AIM A;  4DV3 I;  2VQF E;  4DV1 E;  3CDJ A;  2HHH E;  2V2V A;  4Z7Y A;  3QT8 A;  4B3M E;  3L7Z A;  4IZJ A;  1U2R A;  4UTG A;  1Y4S A;  4FW6 A;  1J5E E;  4IFD D;  1OJ4 A;  1HR0 I;  3M7N D;  2UXB I;  4OX9 E;  4MU3 A;  2OI2 A;  3NZK A;  2VQF I;  2PO0 A;  2Z5E A;  4DV1 I;  4DV3 E;  4J3D A;  1EA6 A;  5C0X A;  3P3C A;  4FW9 A;  3B4T A;  3P3G A;  3T1Y E;  2WP8 B;  4LF7 E;  2PO2 A;  4LF4 I;  1N0V C;  3M85 D;  4FW4 A;  3HKM A;  1A6F A;  1YHC A;  1E3P A;  4OZE A;  4DUZ E;  4DXL A;  5LL6 R;  3QT7 A;  2UU9 I;  1S4E A;  4OO1 D;  3P76 A;  5C0X C;  2JE6 B;  3J7A G;  1XNR I;  2NN6 A;  3PYE A;  1FJG E;  4LFB I;  1PIE A;  2C39 A;  4DR1 I;  2BA0 D;  4BA1 A;  4JI5 I;  4JI8 I;  4AID A;  4JI1 I;  4X65 I;  4DV5 E;  5ELW A;  1XNR E;  4LFC E;  4GKJ I;  2HK2 A;  2UUA I;  3QT6 A;  1Z0V A;  3WU4 A;  2ZM6 I;  1FJG I;  4X64 E;  1N32 E;  2HKE A;  4WUC A;  2VQE I;  2CGE A;  1PKP A;  4IS9 A;  4BA2 A;  1ZXN A;  2ZM6 E;  2C39 B;  3J80 Q;  4LF9 I;  1N32 I;  1XHK A;  4LF5 I;  2WNR A;  4DV4 I;  2F1D A;  5EL9 A;  5A2Q C;  4DV7 I;  4NBQ A;  4JI4 E;  4U3D A;  1Z0B A;  2BM0 A;  1RHY A;  2O1W A;  4NXM I;  1D6T A;  4JI2 E;  4JYA E;  4P52 A;  4Z7C A;  2PO1 A;  2NN6 D;  4YHH I;  2PNM A;  1FKA E;  4ZVI A;  1H7U A;  1BKN A;  1Z0E A;  5GMD A;  1MG7 A;  4AM3 A;  5K36 C;  3LTO A;  2GO4 A;  3UHM A;  4JV5 I;  4HAC A;  3D4J A;  5DRQ A;  3U1K A;  2A2C A;  1UDN A;  2J65 A;  4JI2 I;  3L7Z B;  4JG4 A;  4DU7 A;  5K36 E;  4K0K I;  2UXB E;  5FWK A;  4DV2 E;  1HNZ I;  2ZIT A;  3P06 A;  1ELO A;  1Z5C A;  4MU1 A;  1ZM3 A;  2Z5C B;  4K0K E;  2AE8 A;  3J7A M;  4FN5 A;  1NHI A;  3F0N A;  1S16 A;  3ZZ0 A;  4JI0 E;  2UU9 E;  4LFA E;  3M7N G;  4HYM A;  3KRN A;  4P7A A;  5FLX C;  4YY3 I;  4JI6 I;  2PO1 B;  4FW3 A;  1I94 E;  4DV0 E;  3PS2 A;  2V8P A;  4IFD A;  2VF3 A;  5LMN I;  2IER A;  2HKJ A;  2C37 B;  5K36 A;  1RR9 A;  4OX9 I;  4JI5 E;  1N36 E;  4X65 E;  4DV5 I;  2JE6 A;  4LOM A;  2UXC I;  4FWG A;  5IT9 Q;  4FW5 A;  4KHP I;  5IWA E;  2R3V A;  2C37 A;  4DPX A;  2V2Z A;  4IFD F;  4DUZ I;  1OYR A;  2CG9 A;  2NN6 C;  2ZBK B;  1ZXM A;  4M1K A;  2JT2 A;  4ISA A;  2BR2 B;  4FW7 A;  3P3E A;  4DR4 I;  2IOQ A;  4BA2 B;  3LPS A;  4LCG A;  3H4L A;  1E3H A;  4ED4 A;  2EFG A;  4U3B A;  2Z5B A;  3Q6M A;  3WU6 A;  1NZ0 A;  3PYD A;  2UUC I;  2GO3 A;  2Z5B B;  4DR4 E;  2O1V A;  4IZJ B;  4JI1 E;  1B62 A;  1NHJ A;  2X36 A;  3J81 Q;  5C0X E;  4LFC I;  4GKJ E;  3WU3 A;  4EMD A;  4FWH A;  4X66 I;  4LCH A;  2O1T A;  4AQY I;  1XMO E;  4NXN I;  3DD6 A;  2NN6 B;  5DNL A;  4GKK I;  1HNW I;  3Q6N A;  1Z59 A;  3B78 A;  2WW4 A;  3K17 A;  1OYP A;  1IBL E;  3PRY A;  4IFD B;  2BM1 A;  4USK A;  2CVE A;  2WP8 A;  1UDO A;  1N0U A;  4DV7 E;  1N33 I;  4MDT A;  3CDI A;  3JAM C;  2R42 A;  3T1H I;  1UEK A;  4I3H A;  4DV2 I;  2F4V I;  5GME A;  4PRX A;  3GLL A;  5JEA B;  2Z5C A;  2C38 A;  1N33 E;  2WNR B;  4DR2 I;  3T1H E;  4JV5 E;  2F4V E;  4DR7 I;  3H1C A;  3OTO I;  3V2U C;  3HUL A;  4IFD C;  4USM A;  2E5L I;  2JEA A;  3CWV A;  1I94 I;  1HNX I;  4LF4 E;  1XNQ I;  1FWK A;  1VI7 A;  2XEX A;  4DR7 E;  4LF6 E;  3PS1 A;  1H72 C;  5C0X F;  2HFS A;  5FLX Q;  4X62 E;  1P42 A;  5EKW A;  4HXZ A;  4LPF A;  4LCF A;  1FWL A;  2Q2E B;  1FI4 A;  4OKG A;  3J80 C;  5IWA I;  1HR0 E;  4LFB E;  5JEA C;  4QNJ A;  4DR1 E;  5BR8 E;  4X62 I;  2DEI A;  4R1F A;  1Z5B A;  1Z0T A;  2NN6 F;  1R6M A;  1Z5A A;  5LMN E;  1Y6Z A;  4B3T I;  1XMQ I;  2A2D A;  2V2Q A;  3ZKD A;  2VQE E;  1KIJ A;  1XXE A;  1YH8 A;  3B8H A;  2IES A;  2O1U A;  1Y5Y A;  3ZZT A;  4KHP E;  4DR6 I;  1XMO I;  4MYT A;  4B3R I;  2JEB B;  3PYF A;  2J7K A;  5JEA E;  4LF5 E;  4DPW A;  2UXD I;  4JI8 E;  3V5R A;  4KQV A;  2BR2 A;  1UDQ A;  5DRP A;  4B3S E;  5DRR A;  4DR6 E;  1UDS A;  2UUB I;  2UUC E;  4WUB A;  3ZZU A;  4DPT A;  1DAR A;  4IFD E;  3K1J A;  4MU4 A;  2NPF A;  1N34 E;  5L3J A;  4HAC B;  2UUB E;  2PNL A;  4HY1 A;  3ZM7 A;  4JI7 I;  4DV6 I;  4GKK E;  1HNW E;  1USV A;  4DR3 E;  1HK7 A;  2BA1 D;  4IZK B;  4DR2 E;  2PO0 B;  4JI4 I;  1IBM I;  4OO1 E;  2VES A;  1HNZ E;  3LNU A;  4PU9 A;  3Q1Q A;  4IZJ D;  4QNK A;  4DV6 E;  1QZR A;  2HHH I;  3GCM A;  4DR3 I;  2JEA B;  4UT4 A;  3J81 C;  5JEA F;  1OYS A;  1HNX E;  1KKH A;  3PYG A;  1KTV A;  5C0X D;  1Y60 A;  2CZ9 A;  5LMU E;  4LFA I;  4DR5 I;  1WUU A;  4OO1 F;  3PS3 A;  4YY3 E;  2HK3 A;  4JI6 E;  3T1Y I;  4MQY A;  2C38 B;  4LF7 I;  2PNZ B;  2JEB A;  1RRE A;  4DU8 A;  4OO1 C;  1KVK A;  3GME A;  2AJ4 A;  2V34 A;  4FWD A;  1Z0C A;  1N36 I;  1ZM9 A;  3M85 G;  4B3M I;  1Z0W A;  1R6L A;  4GQU A;  4MYU A;  3ZKB A;  4PRV A;  1ZM4 A;  4LF6 I;  4B3T E;  4JI0 I;  1XMQ E;  3WU5 A;  1NHH A;  4N3O A;  4DV0 I;  2UUA E;  2HFU A;  2BA1 G;  5K36 B;  4X64 I;  2X7I A;  1FNM A;  2NN6 E;  4B3R E;  5BR8 I;  1EI1 A;  2UXD E;  1MX0 A;  1VIS A;  4OO1 B;  1H7S A;  2UXC E;  1USU A;  1Z0G A;  4B3S I;  3JAM Q;  4X66 E;  1Y4U A;  4DPU A;  2DEJ A;  4AQY E;  4LF9 E;  1H74 A;  4URL A;  5K36 D;  4DPY A;  4OO1 A;  5JEA D;  4JI3 I;  4MU0 A;  4BA1 B;  1N34 I;  5K36 F;  1IBL I;  2LJP A;  2IOP A;  4NXM E;  1K47 A;  3K85 A;  4JYA I;  3HJC A;  2GS8 A;  4DUY E;  4JI3 E;  5A2Q Q;  5JEA A;  1H73 A;  3M6A A;  4WUD A;  2GQ0 A;  1PVG A;  1IBM E;  1ZM2 A;  4NXN E;  4IZK A;  4DV4 E;  2PO2 B;  1B63 A;  4XTJ A;  5DNX A; 
#chains in the Genus database with same CATH homology
 1IBK I;  4DUY I;  3GON A;  3B82 A;  4LF8 E;  3QT5 A;  4RPF A;  2BV3 A;  5LMU I;  4JI7 E;  3OTO E;  1MU5 A;  4DR5 E;  2E5L E;  4YHH E;  5IT9 C;  1IBK E;  2E1R A;  1XNQ E;  1J5E I;  4LF8 I;  4DV3 I;  2VQF E;  4DV1 E;  2HHH E;  2V2V A;  4Z7Y A;  3QT8 A;  4B3M E;  4IZJ A;  1U2R A;  4UTG A;  1Y4S A;  1J5E E;  1OJ4 A;  1HR0 I;  2UXB I;  4OX9 E;  2OI2 A;  4DV3 E;  2VQF I;  2Z5E A;  4DV1 I;  1EA6 A;  4FW9 A;  3T1Y E;  4LF7 E;  4LF4 I;  1N0V C;  1A6F A;  4DUZ E;  4DXL A;  5LL6 R;  3QT7 A;  2UU9 I;  1S4E A;  3J7A G;  1XNR I;  3PYE A;  1FJG E;  4LFB I;  1PIE A;  4DR1 I;  4JI5 I;  4JI8 I;  4JI1 I;  4X65 I;  4DV5 E;  1XNR E;  4LFC E;  4GKJ I;  2UUA I;  2HK2 A;  3QT6 A;  1Z0V A;  3WU4 A;  2ZM6 I;  1FJG I;  4X64 E;  1N32 E;  2HKE A;  4WUC A;  2VQE I;  2CGE A;  1PKP A;  1ZXN A;  2ZM6 E;  3J80 Q;  4LF9 I;  1N32 I;  1XHK A;  4LF5 I;  4DV4 I;  5A2Q C;  4DV7 I;  4JI4 E;  1Z0B A;  2BM0 A;  2O1W A;  4NXM I;  1D6T A;  4JI2 E;  4JYA E;  4Z7C A;  4P52 A;  4YHH I;  2PNM A;  1FKA E;  4ZVI A;  1H7U A;  1BKN A;  1Z0E A;  5GMD A;  1MG7 A;  3LTO A;  4JV5 I;  4HAC A;  3D4J A;  2A2C A;  4JI2 I;  4JG4 A;  4DU7 A;  4K0K I;  2UXB E;  5FWK A;  4DV2 E;  1HNZ I;  2ZIT A;  3P06 A;  1ELO A;  1Z5C A;  1ZM3 A;  2Z5C B;  4K0K E;  3J7A M;  4FN5 A;  1NHI A;  3F0N A;  1S16 A;  3ZZ0 A;  4JI0 E;  2UU9 E;  4LFA E;  4HYM A;  4P7A A;  5FLX C;  4YY3 I;  4JI6 I;  1I94 E;  4DV0 E;  2V8P A;  2VF3 A;  5LMN I;  2HKJ A;  1RR9 A;  4OX9 I;  4JI5 E;  1N36 E;  4X65 E;  4DV5 I;  2UXC I;  4FWG A;  5IT9 Q;  4KHP I;  5IWA E;  2R3V A;  4DPX A;  2V2Z A;  4DUZ I;  2CG9 A;  2ZBK B;  1ZXM A;  4M1K A;  4DR4 I;  2IOQ A;  3LPS A;  3H4L A;  4ED4 A;  2EFG A;  2Z5B A;  3Q6M A;  3WU6 A;  1NZ0 A;  3PYD A;  2UUC I;  2Z5B B;  4DR4 E;  2O1V A;  4IZJ B;  4JI1 E;  1B62 A;  1NHJ A;  2X36 A;  3J81 Q;  4LFC I;  4GKJ E;  3WU3 A;  4EMD A;  4FWH A;  4X66 I;  2O1T A;  4AQY I;  1XMO E;  4NXN I;  4GKK I;  1HNW I;  3Q6N A;  1Z59 A;  3B78 A;  2WW4 A;  3K17 A;  1IBL E;  3PRY A;  2BM1 A;  4USK A;  1N0U A;  4DV7 E;  1N33 I;  3JAM C;  2R42 A;  3T1H I;  1UEK A;  4I3H A;  4DV2 I;  2F4V I;  5GME A;  4PRX A;  2Z5C A;  1N33 E;  4DR2 I;  3T1H E;  4JV5 E;  2F4V E;  4DR7 I;  3OTO I;  3HUL A;  3V2U C;  4USM A;  2E5L I;  3CWV A;  1I94 I;  1HNX I;  4LF4 E;  1XNQ I;  1FWK A;  2XEX A;  4DR7 E;  4LF6 E;  1H72 C;  2HFS A;  5FLX Q;  4X62 E;  4HXZ A;  1FWL A;  2Q2E B;  1FI4 A;  3J80 C;  5IWA I;  1HR0 E;  4LFB E;  4DR1 E;  5BR8 E;  4X62 I;  2DEI A;  4R1F A;  1Z5B A;  1Z0T A;  1Z5A A;  5LMN E;  1Y6Z A;  4B3T I;  1XMQ I;  2A2D A;  2V2Q A;  3ZKD A;  2VQE E;  1KIJ A;  3B8H A;  2O1U A;  3ZZT A;  4KHP E;  4DR6 I;  1XMO I;  4MYT A;  4B3R I;  3PYF A;  4LF5 E;  2J7K A;  4DPW A;  2UXD I;  4JI8 E;  3V5R A;  4KQV A;  4B3S E;  4DR6 E;  2UUB I;  2UUC E;  4WUB A;  3ZZU A;  4DPT A;  1DAR A;  3K1J A;  2NPF A;  1N34 E;  5L3J A;  4HAC B;  2UUB E;  2PNL A;  4HY1 A;  3ZM7 A;  4JI7 I;  4DV6 I;  4GKK E;  1HNW E;  1USV A;  4DR3 E;  1HK7 A;  4IZK B;  4DR2 E;  4JI4 I;  1IBM I;  1HNZ E;  3LNU A;  4PU9 A;  3Q1Q A;  4IZJ D;  4DV6 E;  1QZR A;  2HHH I;  4DR3 I;  4UT4 A;  3J81 C;  1HNX E;  1KKH A;  3PYG A;  1KTV A;  2CZ9 A;  5LMU E;  4LFA I;  4DR5 I;  1WUU A;  4YY3 E;  2HK3 A;  4JI6 E;  3T1Y I;  4LF7 I;  1RRE A;  4DU8 A;  1KVK A;  2AJ4 A;  2V34 A;  4FWD A;  1Z0C A;  1N36 I;  1ZM9 A;  4B3M I;  1Z0W A;  4MYU A;  3ZKB A;  4PRV A;  1ZM4 A;  4LF6 I;  4B3T E;  4JI0 I;  1XMQ E;  3WU5 A;  1NHH A;  4N3O A;  4DV0 I;  2UUA E;  2HFU A;  4X64 I;  2X7I A;  1FNM A;  4B3R E;  5BR8 I;  1EI1 A;  2UXD E;  1MX0 A;  1VIS A;  1H7S A;  2UXC E;  1USU A;  1Z0G A;  4B3S I;  3JAM Q;  4X66 E;  1Y4U A;  4DPU A;  2DEJ A;  4AQY E;  4LF9 E;  1H74 A;  4URL A;  4DPY A;  4JI3 I;  1N34 I;  1IBL I;  2LJP A;  2IOP A;  4NXM E;  1K47 A;  3K85 A;  4JYA I;  3HJC A;  2GS8 A;  4DUY E;  4JI3 E;  5A2Q Q;  1H73 A;  3M6A A;  4WUD A;  2GQ0 A;  1PVG A;  1IBM E;  1ZM2 A;  4NXN E;  4IZK A;  4DV4 E;  1B63 A;  4XTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...