4B3ME

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3mE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mE02
3JAMC 4X65E 1IBKI 4B3SI 4JI5E 3PYFA 3WU3A 2BM1A 1I94E 2IHR1 3T1YE 3HULA 1HNXI 2WW4A 4JV5I 4DV1I 2UU9I 1MG7A 3JAMQ 2X36A 1OJ4A 1NHIA 4DPYA 4DU7A 4OOGC 1D6TA 2R42A 5FLXC 1UEKA 1O0WA 2V2VA 3T1HI 4DV0E 4KHPI 3WU4A 1XNRE 3F0NA 1Z5BA 5FLXQ 2VQFI 4YY3I 4LFAI 2MDRA 4JYAE 4DR3E 1T4OA 4LFCE 3PYDA 2CZ9A 2RS6A 4HY1A 1Z5AA 3K1JA 1K47A 4GKKI 3OTOE 4LF4I 2EZ6A 2RTXA 3D4JA 1FI4A 2ZITA 4B3MI 2OI2A 5LL6R 4DPXA 5GMDA 2HFSA 4JI6I 4WUBA 2L2MA 3WU6A 2LTRA 1N36I 1EI1A 4NXMI 3VYXA 1H72C 2DEIA 4LF9I 4JI2E 2BM0A 4OX9E 1H73A 4Z7CA 4DR5I 1ZM2A 2N3GA 2DIXA 4FWHA 4JI4E 4RPFA 2V2ZA 2V34A 4JI0E 2R3VA 4FW9A 5LMUE 5BR8E 3PYGA 4HACB 1ZXNA 4DV4E 1A6FA 2B3TB 5IWAE 1N33E 4KQVA 4DUZI 1T4LB 1Z0BA 4B3RI 1B63A 1B62A 2YT4A 4NXNE 1DARA 2EFGA 2J7KA 2LJHA 1QZRA 2VQEI 2B7TA 4LFBE 3V2UC 1XNQI 1WHQA 1WHNA 1IBLI 4PU9A 1Z0EA 4JG4A 4JI8E 1S4EA 1Z59A 2F4VE 1ZM9A 4B3TI 1N32I 3ZZ0A 4DR2I 3ADJA 1YYWA 1S16A 4UT4A 4DR7E 4X66I 2RSMA 4LF5E 3P1XA 1H74A 1J26A 4DV2E 1FNMA 2LJPA 1H7SA 2DEJA 4X65I 4DR4I 2HKEA 2ZBKB 1Z0WA 2A2DA 4AQYI 2LUQA 3QT7A 2NUGA 5L3JA 3B78A 1EKZA 1IBME 2UXBE 4X62E 4YHHE 4DV1E 2L3CA 1PKPA 4GKJI 4XTJA 2KHXA 4LF7E 1XNRI 3Q1QA 4JI1I 4ZVIA 1NHHA 4M1KA 2ZM6I 1FJGI 2NA2A 5LMNE 4DR3I 1HR0I 4JYAI 3T1HE 4KHPE 3H4LA 2UUBI 4I3HA 4LF6I 1U2RA 1RQ0A 1HNZE 1N34I 1KIJA 1Z0CA 2CPNA 1MU5A 4LFAE 4DUYI 4LF8I 2L3JA 1J5EI 4ED4A 4WUCA 1RR9A 1X47A 5IT9C 4X8WA 4GKKE 1N0VC 2HK2A 4USKA 4JI3I 3WU5A 4K0KI 1STUA 2NUFA 4B3ME 1ZM4A 1YYOA 4P7AA 5IT9Q 3M6AA 4JI6E 1HNWI 4EMDA 4USMA 3ZKBA 3ZM7A 1N36E 4NXME 4DR6I 4LF9E 4JI4I 1KKHA 4DR1E 3ADLA 2HFUA 4DR5E 1FWKA 3B82A 1UILA 2LUPB 1XMOE 5BR8I 2UXDI 1XHKA 5GMEA 2X7IA 4PRVA 1PIEA 3J80C 1WUUA 2UUCI 3GONA 3K17A 3J80Q 1X49A 3B8HA 4JI7E 2XEXA 1FWLA 4DV6E 1FKAE 3J7AM 4DV7I 4DUZE 4M2ZA 4B3RE 3PYEA 3QT8A 4UTGA 4M30A 2UUAI 3LNUA 4URLA 4JI8I 4FN5A 2UXCI 2VQEE 2A2CA 2AJ4A 4DV3I 1IBLE 4HXZA 2E5LI 4DV5I 2N3HA 2HHHI 2LBSB 4X64I 2DB2A 1XMQE 4B3TE 4WYQB 3ADGA 4JI5I 1I94I 3T1YI 1RC7A 4X66E 1N0UA 3LTOA 1IBKE 4B3SE 1QU6A 4DR4E 1HNXE 3C4TA 4JV5E 2UU9E 1IBMI 3ZZUA 2UXBI 3V5RA 4X62I 1UHZA 4HYMA 4YHHI 2DMYA 4DV0I 4AQYE 4DKKA 4WFTA 4Z7YA 4LF7I 5CFFE 3J81C 2BV3A 2V8PA 4LFCI 4GKJE 5LMNI 2HKJA 1Z0GA 4PRXA 2VQFE 3J81Q 1T4NA 2VF3A 4YY3E 3ADIA 4DPUA 4JI1E 1BKNA 4HACA 3OTOI 1HNZI 2ZM6E 5A2QC 1FJGE 3VYYA 1HR0E 2L2KB 2UUBE 4LF6E 1N34E 4LF4E 1KVKA 5A2QQ 4JI2I 4DUYE 1Z0TA 2JY9A 4LF8E 4MYUA 4FWDA 2JVAA 4OX9I 1J5EE 2L2NA 4MYTA 3CWVA 2Q2EB 4R1FA 4DPWA 2GS8A 3QT6A 4JI3E 4JI0I 4K0KE 4DR1I 2V2QA 1DI2A 1PVGA 4DU8A 5LMUI 1Z5CA 1HNWE 1EA6A 1RREA 4DV4I 1ZM3A 1XMOI 4DPTA 4DR6E 5IWAI 1N33I 2NUEA 2LTSA 1NZ0A 1VISA 2B7VA 2RS7A 4NXNI 4DXLA 2UXDE 2HK3A 3J7Yp 4LFBI 4JI7I 4WUDA 4FWGA 4DV6I 3LLHA 3J7AG 1ZXMA 1H7UA 1NHJA 2UUCE 2E1RA 1MX0A 2L33A 1GQEA 2LRSA 2F4VI 3C4BA 1XNQE 3ZZTA 4P52A 4DV7E 4DR7I 4LF5I 3ZKDA 1ELOA 3QT5A 4DV2I 2UUAE 1KTVA 1N32E 4DR2E 2UXCE 1XMQI 1ZBTA 1YYKA 4DV3E 3LPSA 1YZ9A 2E5LE 2NPFA 4DV5E 2HHHE 4X64E 1X48A 3HTXA 1Z0VA
chains in the Genus database with same CATH superfamily
3JAMC 2EM0A 2EM4A 3F6GA 4X65E 2EM7A 1IBKI 3GLLA 1Y4SA 4B3SI 3KRNA 2EPNA 2JP9A 4JI5E 3PYFA 3WU3A 2BM1A 1I94E 2IHR1 3T1YE 3HULA 4MDTA 1HNXI 3F6HA 4R2SA 2WW4A 4ZYDA 3BF2A 4JV5I 1IMUA 4R2QA 4DV1I 2UU9I 2EMXA 3VK6A 1MG7A 3JAMQ 3JU0A 3U1KA 2X36A 4LPFA 2KOUA 1NCSA 5A6JA 1OJ4A 2MKDA 1NHIA 3RMPA 4DPYA 3U1YA 4DU7A 4OOGC 1D6TA 4F6NA 2R42A 1UDSA 2GPIA 3THNA 5FLXC 2EPAA 1UEKA 2DGCA 1O0WA 2YU5A 1G2DC 2V2VA 5DNXA 2YTNA 3T1HI 4DV0E 4KHPI 3WU4A 2HJJA 4O4KA 1XNRE 3F0NA 4ZYHA 1Z5BA 5FLXQ 2VQFI 4JYAI 2ADRA 1MGTA 2I9IA 3PS3A 4YY3I 4L8NA 4LFAI 2EOMA 2MDRA 3B4TA 3DD6A 5KL5A 1X6EA 4DR3E 4JYAE 4BC7A 1T4OA 4LFCE 1XXEA 3PYDA 4P7DA 2CZ9A 2RS6A 1E3HA 4HY1A 1WXRA 1Z5AA 4WSGA 3K1JA 1K47A 4GKKI 1E3PA 2MKNA 5DRQA 4R2AA 2JOXA 4F9CB 3OTOE 2K7IA 2EMBA 2MC5A 5JEAA 4LF4I 2EZ6A 1B69A 2RTXA 3D4JA 1FI4A 2V8QB 1N3GA 2ZITA 2YZTA 2IOQA 2OI2A 4B3MI 5LL6R 3M85D 1AAYA 5KL2A 4DPXA 5GMDA 2F8BA 2HFSA 4JI6I 2EQ1A 4WUBA 2EOSA 2M7QA 2EMZA 3HXLA 2L2MA 3WU6A 5JEAD 2LTRA 1N36I 4IZKA 3JTZA 2BB8A 1EI1A 3VYXA 1WJPA 2PNZA 4NXMI 1H72C 2DEIA 4LF9I 3L7ZA 4JI2E 2EM6A 5AC5A 2BM0A 2WP8B 5JEAC 4OX9E 4RHBB 4WPYA 2M1SA 5AASA 1H73A 3EPLA 4Z7CA 4DR5I 2ENAA 5AE3A 1ZM2A 2VESA 4LU9A 2N3GA 2DIXA 4FWHA 4JI4E 1UDNA 4RPFA 2PO2A 2V2ZA 4FW7A 4WXCA 2V34A 2YTEA 4JI0E 1RMDA 4BHBA 2R3VA 1P47A 4FW9A 1UDOA 5JEAF 1BBOA 5LMUE 4J8ZA 5BR8E 3PYGA 2YSOA 4HACB 3UK3C 2EPPA 1ZXNA 4DV4E 2I13A 2Z5BB 1IQSA 2JT2A 2V87A 1A6FA 2B3TB 5IWAE 2C37A 1N33E 2J65A 3GMEA 4KQVA 3M7ND 4FW3A 1JK2A 2N8XA 4DUZI 5A6AA 4GZNC 1T4LB 1Z0BA 1B63A 4B3RI 3HPZA 1B62A 4MLVA 3EQ1A 4R2DA 2O1VA 4MQYA 2LE2A 2YT4A 4NXNE 4N3OA 1DARA 2EOJA 2Q8UA 2EFGA 2J7KA 2LJHA 2RSIA 1QZRA 2GQ0A 2VQEI 2B7TA 4LFBE 2EMAA 3V2UC 1XNQI 1WHQA 1WHNA 2BR2A 4M9VC 4NZVA 4PU9A 1IBLI 2EWLA 3KZZA 1Z0EA 1DGCA 2BA1G 4JG4A 1ZR9A 5K36A 2EN3A 4BA2B 3EPHA 4JI8E 1UDQA 1S4EA 1Z59A 2YRMA 3HKMA 4IZJA 2F4VE 2M9AA 1ZM9A 4B3TI 3HPSA 1TN9A 1N32I 3P3GA 3L7ZB 3ZZ0A 2PRTA 4DR2I 1UN6B 3ADJA 2EL5A 1YYWA 1S16A 2IESA 4UT4A 5K36D 4R2PA 4BMJA 4DR7E 4X66I 2RSMA 4LF5E 3P1XA 2WCC3 4IZJD 4LCFA 1H74A 1X5WA 1J26A 5K36C 5TSEA 4OO1D 4DV2E 1FNMA 4WSPA 2LJPA 1ZBQA 4HTGA 1H7SA 2GLIA 2DEJA 3P06A 5DRRA 1DQ3A 4X65I 1R6LA 4DR4I 2HKEA 5JEAE 4OO1C 2YU8A 2VF1A 2JE6A 2NABA 2GHFA 1SFEA 2LO3A 2IOPA 2ZBKB 4IFDA 3ZOQB 2FV4B 1Z0WA 4BCAA 2A2DA 4AQYI 2LUQA 3QT7A 5IV8B 2EM9A 2NUGA 2EOXA 5K36F 1JK1A 5A6KA 2EN4A 1EKZA 2O3ZA 3B78A 5L3JA 4IFDD 4BS9A 2C37B 1IBME 2UXBE 4X62E 2MDGA 4FW5A 4MU0A 4OO1F 4YHHE 4QNKA 2V85A 4BBYA 1A1FA 4DV1E 2L3CA 1PKPA 4IFDC 2LCEA 3OMLA 1EH6A 4GKJI 4XTJA 2KHXA 3VHTB 1A1HA 3ECRA 4LF7E 4FK5C 1XNRI 3Q1QA 2EM5A 2FTXB 2PO1B 2Z5CA 2EPMX 2YTGA 4JI1I 4F2JC 4MU4A 4N4RB 5LLQA 4ZVIA 1NHHA 4M1KA 2ZM6I 1FJGI 2NA2A 3Q6NA 3EPJA 4NHRA 5LMNE 3P3EA 2EPUA 3T1HE 1A1KA 4AIDA 2EN6A 4DR3I 4KHPE 3H4LA 1HR0I 3MHSC 2ENCA 1USUA 2UUBI 4IFDF 4I3HA 4LF6I 2E1MA 1TF3A 1U2RA 1RQ0A 3BBGA 1HNZE 4OKGA 1KIJA 1N34I 1Z0CA 2CPNA 2YRHA 1MU5A 4LFAE 4DUYI 4LF8I 4BA1A 2JEBB 2L3JA 1J5EI 5DROA 1YFHA 2LVHA 2O1WA 2NN6A 4ED4A 4AIMA 1Y5YA 2WBTA 4WUCA 2EPOA 1RR9A 1X47A 5IT9C 4X8WA 2EOQA 4GKKE 2EM8A 1N0VC 2HK2A 1G2FC 4USKA 2NN6D 3EPKA 2C38A 2JPAA 4JI3I 4IJDA 3WU5A 5C0XA 4K0KI 5K36E 1STUA 2NUFA 4B3ME 5ELWA 4IS1C 1TF6A 1OYRA 2G7HA 1ZM4A 1YYOA 1BB8A 4P7AA 5IT9Q 2DRPA 2NN6C 2EOOA 4JI6E 3M6AA 1HNWI 4EMDA 3M99B 2YTJA 1IQOA 3ZKBA 4USMA 4OO1E 1WRJA 1A1GA 1N36E 3ZM7A 4NXME 2YTOA 2O1UA 5C0XD 2J7JA 4LTYA 4LF9E 4JI4I 4DR6I 1KKHA 4DR1E 4R8OA 1YSAC 2EPCA 1ZU1A 3ADLA 2HFUA 1X6FA 1AH5A 2V88A 5C0XC 4F6MA 4DR5E 1YUJA 1FWKA 3IWCA 3B82A 1UILA 2LUPB 1XMOE 5BR8I 2UXDI 3IWDA 2NN6F 4AM3A 2HC5A 4BC9A 2EOEA 1XHKA 1OYSA 1MEYC 5AE2A 5DNYA 1UBDC 5GMEA 2EOYA 1A1LA 2DLQA 2LV2A 3J80C 2EM3A 2EOZA 5KL6A 1PIEA 2X7IA 4PRVA 4F9BB 4IFDE 2VE7C 2A25A 2YTFA 1WUUA 4MU3A 1YH8A 3UHMA 2UUCI 2HGHA 2WNRA 4FW6A 2EPZA 4BHCA 3GONA 2JYAA 5C0XF 1OYPA 3AV0A 3MSWA 4O43A 3K17A 2VRDA 5JEAB 3MHHC 2YTDA 3J80Q 1X49A 3B8HA 4JI7E 3KWRA 1FWLA 2XEXA 3GCMA 4FW4A 1HK7A 4I8OA 2RPCA 4DV6E 4BA1B 2YTIA 2R76A 1FKAE 4U3DA 4DV7I 3J7AM 4M0VA 4DUZE 2EMGA 2BBGA 4M2ZA 4B3RE 3PYEA 3QT8A 4Q35B 4UTGA 2KONA 2YWQA 4QNJA 4X9JA 4M30A 2EMIA 3LNUA 2WZOA 4IZKB 2PNZB 4URLA 2UUAI 3M7NG 4OO1A 4JI8I 3H1CA 2BA0G 4FN5A 2UXCI 2VQEE 2EOHA 2A2CA 2AJ4A 4DV3I 1IBLE 4HXZA 2E5LI 4DMIA 1PJQA 4DV5I 2N3HA 2EMYA 4P78A 4R2RA 2LBSB 4X64I 5KL7A 2HHHI 1KJKA 4OZEA 2DB2A 4GQUA 1Y60A 1P42A 4KWYA 2D9HA 2PO2B 1XMQE 4B3TE 4MLQA 5DNLA 2EQ0A 4WYQB 3ADGA 2EPKX 3DF6A 4JI5I 1I94I 3T1YI 2LJUA 4ZYGA 1RC7A 2DLKA 2C39A 4X66E 1N0UA 2NN6E 3LTOA 2PO0A 5AC4A 1IBKE 4B3SE 1QU6A 3IWBA 2JEAA 2LT7A 3THOB 4DR4E 3BGHA 2GO4A 1HNXE 4IS9A 5C0XE 3C4TA 5F3WA 2UU9E 4JV5E 2IERA 3ZZUA 1IBMI 2UXBI 1ZAAC 3V5RA 2EJ4A 4O24A 4X62I 1UHZA 5KL4A 4HYMA 2WNRB 4YHHI 1PJTA 2K4VA 2WP8A 2DMYA 4DV0I 4AQYE 2EMKA 4L5NC 2EMLA 4DKKA 4WFTA 1X6HA 4GEQB 1RHYA 2BR2B 2CVEA 3CDJA 4Z7YA 5A6BA 4LF7I 4HEIA 1PJSA 3P76A 3HJCA 5CFFE 3PS2A 3J81C 5K36B 2BV3A 1Y4UA 1F2IG 3C6KA 2EOIA 2V8PA 4IZJB 1KYQA 4LFCI 1PDAA 4GKJE 4OO1B 5LMNI 5A6BD 1A1IA 1Z0GA 2HKJA 1Y6ZA 3Q6MA 4PRXA 2VQFE 3J81Q 1T4NA 1QNTA 2VF3A 4YY3E 2EORA 3ADIA 4DPUA 4JI1E 3C6MA 1BKNA 4HACA 3OTOI 1HNZI 2GO3A 4R03A 3AUZA 3QG5C 2Z5BA 2CT1A 2YTQA 5A2QC 2ZM6E 1FJGE 5DRPA 3VYYA 1HR0E 2R1FA 2ODRD 4WX9A 5EL9A 2L2KB 2EQ3A 2UUBE 3PS1A 4LF6E 2JE6B 3L00A 2ODRC 2JXPA 4TUGA 1N34E 4LF4E 2YPNA 4IFDB 1KVKA 5A2QQ 4JI2I 3H09A 4DUYE 1Z0TA 2C39B 2JY9A 2DMIA 4LF8E 4MYUA 2EPLX 2JVAA 4FWDA 4OX9I 3TQMA 2EMWA 2L2NA 1J5EE 2PO0B 2YRKA 2EPRA 3CWVA 4MYTA 2E72A 2EE8A 2Q2EB 4O5GA 2YSPA 4MU1A 2JEAB 3M85G 1A1JA 4R1FA 5FWKA 4BA2A 2EN7A 4DPWA 4ISAA 2L8TA 1YHCA 2GS8A 3QT6A 4JI3E 5AE1A 4K0KE 4JI0I 4DR1I 2V2QA 2EMCA 1DI2A 2AE8A 1PVGA 2FGGA 4LCGA 4DU8A 5LMUI 1Z5CA 1HNWE 5EKWA 3P3CA 2Z5CB 1EA6A 1VI7A 1RREA 5A69A 5IXMB 4DV4I 1ZM3A 2B9DA 1XMOI 2CG9A 4DPTA 4DR6E 2EPXA 1T39A 2O1TA 5IWAI 3NZKA 1N33I 1YPNA 5T6JA 2CTDA 2NUEA 5KL3A 4RH8A 2WBSA 2LTSA 4WXDA 1NZ0A 2EMFA 3K6QA 2PNMA 1VISA 2B7VA 1BBGA 2RS7A 4NXNI 2MC6A 4DXLA 2JOBA 2UXDE 2HK3A 3J7Yp 3BIDA 2BA1D 2EN2A 1L4SA 2JR1A 4LFBI 4TUIA 2EL4A 4R2CA 3DJWA 4JI7I 4J3DA 4WUDA 4R2EA 2NN6B 4FWGA 4DV6I 3LLHA 3J7AG 1ZXMA 1H7UA 1NHJA 2BA0D 2UUCE 2E1RA 1T38A 1MX0A 2L33A 2LMZA 3FIGA 1Z1BA 4ZYEA 1EH8A 4U3BA 1SR9A 1GQEA 2LRSA 2PNLA 2F4VI 2L92A 3C4BA 2V83A 1XNQE 2CSHA 2M4IA 2C38B 2ELYA 1YUIA 3ZZTA 5C0XB 3LMLA 2WBUA 4F9AB 4P52A 2EM2A 2PO1A 4DV7E 2CGEA 4DR7I 4NBQA 4LF5I 1USVA 2JWOA 3ZKDA 1ELOA 1GTKA 4F54A 2Z5EA 3QT5A 4DV2I 3CDIA 2UUAE 1KTVA 4LCHA 2EN8A 2H36X 2YTPA 2EP3A 1LLMC 1N32E 3PRYA 3KZYA 4KZSA 4DR2E 2UXCE 4LOMA 1X3CA 1XMQI 2V86A 1ZBTA 4Q28A 2F1DA 3K85A 1EH7A 2JEBA 2ENHA 1YYKA 4DV3E 3LPSA 2EMHA 2DSYA 1YZ9A 5ADZA 2ELZA 3HQ1A 2RQLA 2E5LE 1R6MA 2NPFA 2V89A 2EOFA 4DV5E 2HHHE 1GZ6A 2L6MA 1NEIA 2EL6A 4X64E 1X48A 3HTXA 1Z0VA 2EN1A
chains in the Genus database with same CATH topology
3JAMC 3F6GA 4X65E 1IBKI 1Y4SA 4B3SI 4JI5E 3PYFA 3WU3A 2BM1A 1I94E 2IHR1 3T1YE 3HULA 1HNXI 3F6HA 2WW4A 4JV5I 4DV1I 2UU9I 1MG7A 3VK6A 3JAMQ 3JU0A 2X36A 2KOUA 1OJ4A 1NHIA 3RMPA 4DPYA 4DU7A 4OOGC 1D6TA 2R42A 5FLXC 1UEKA 1O0WA 2V2VA 3T1HI 4DV0E 4KHPI 3WU4A 1XNRE 3F0NA 1Z5BA 5FLXQ 2VQFI 4YY3I 4L8NA 4LFAI 2MDRA 4JYAE 4DR3E 4BC7A 1T4OA 4LFCE 3PYDA 4P7DA 2CZ9A 2RS6A 4HY1A 1WXRA 1Z5AA 3K1JA 1K47A 4GKKI 2JOXA 4F9CB 3OTOE 2MC5A 4LF4I 2EZ6A 2RTXA 3D4JA 1FI4A 2V8QB 2ZITA 4B3MI 2YZTA 2IOQA 2OI2A 5LL6R 4DPXA 5GMDA 2F8BA 2HFSA 4JI6I 4WUBA 2M7QA 3HXLA 2L2MA 3WU6A 2LTRA 1N36I 4IZKA 3JTZA 1EI1A 4NXMI 3VYXA 1H72C 2DEIA 4LF9I 4JI2E 2BM0A 4OX9E 4WPYA 2M1SA 5AASA 1H73A 4Z7CA 4DR5I 5AE3A 1ZM2A 4LU9A 2N3GA 2DIXA 4FWHA 4JI4E 4RPFA 2V2ZA 2V34A 4JI0E 2R3VA 4FW9A 5LMUE 4J8ZA 5BR8E 3PYGA 4HACB 1ZXNA 4DV4E 2Z5BB 2V87A 1A6FA 2B3TB 5IWAE 1N33E 4KQVA 4DUZI 1T4LB 1Z0BA 4B3RI 1B63A 3HPZA 1B62A 2O1VA 2LE2A 2YT4A 4NXNE 4N3OA 1DARA 2EFGA 2J7KA 2LJHA 1QZRA 2GQ0A 2VQEI 2B7TA 4LFBE 3V2UC 1XNQI 1WHQA 1WHNA 1IBLI 4PU9A 2EWLA 1Z0EA 4JG4A 4JI8E 1S4EA 1Z59A 4IZJA 2F4VE 1ZM9A 4B3TI 3HPSA 1N32I 3ZZ0A 4DR2I 3ADJA 1YYWA 1S16A 4UT4A 4BMJA 4DR7E 4X66I 2RSMA 4LF5E 3P1XA 4IZJD 1H74A 1J26A 4DV2E 1FNMA 4WSPA 2LJPA 1ZBQA 1H7SA 2DEJA 3P06A 1DQ3A 4X65I 4DR4I 2HKEA 2VF1A 2IOPA 2ZBKB 3ZOQB 2FV4B 1Z0WA 4BCAA 2A2DA 4AQYI 2LUQA 3QT7A 2NUGA 5L3JA 3B78A 1EKZA 4BS9A 1IBME 2UXBE 4X62E 4YHHE 2V85A 4BBYA 4DV1E 2L3CA 1PKPA 3OMLA 4GKJI 4XTJA 2KHXA 4LF7E 1XNRI 3Q1QA 2FTXB 2Z5CA 4JI1I 4ZVIA 1NHHA 4M1KA 2ZM6I 1FJGI 2NA2A 3Q6NA 5LMNE 4DR3I 1HR0I 4JYAI 3T1HE 4KHPE 3H4LA 1USUA 2UUBI 4I3HA 4LF6I 2E1MA 1U2RA 1RQ0A 1HNZE 1N34I 1KIJA 1Z0CA 2CPNA 1MU5A 4LFAE 4DUYI 4LF8I 2L3JA 1J5EI 2O1WA 4ED4A 4WUCA 1RR9A 1X47A 5IT9C 4X8WA 4GKKE 1N0VC 2HK2A 4USKA 4JI3I 3WU5A 4K0KI 1STUA 2NUFA 4B3ME 2G7HA 1ZM4A 1YYOA 4P7AA 5IT9Q 3M6AA 4JI6E 1HNWI 4EMDA 4USMA 3ZKBA 3ZM7A 1N36E 4NXME 2O1UA 4DR6I 4LTYA 4LF9E 4JI4I 1KKHA 4DR1E 4R8OA 3ADLA 2HFUA 2V88A 4DR5E 1FWKA 3IWCA 3B82A 1UILA 2LUPB 1XMOE 5BR8I 2UXDI 3IWDA 4BC9A 1XHKA 5AE2A 5DNYA 5GMEA 2X7IA 4PRVA 3J80C 1PIEA 4F9BB 2VE7C 1WUUA 2UUCI 3GONA 3AV0A 3MSWA 3K17A 3J80Q 1X49A 3B8HA 4JI7E 3KWRA 1FWLA 2XEXA 1HK7A 4I8OA 4DV6E 1FKAE 3J7AM 4DV7I 4M0VA 4DUZE 4M2ZA 4B3RE 3PYEA 3QT8A 4UTGA 2KONA 4M30A 2UUAI 3LNUA 2WZOA 4IZKB 4URLA 4JI8I 4FN5A 2UXCI 2VQEE 2A2CA 2AJ4A 4DV3I 1IBLE 4HXZA 2E5LI 4DMIA 4DV5I 2N3HA 4P78A 2HHHI 2LBSB 4X64I 2DB2A 1XMQE 4B3TE 4WYQB 3ADGA 4JI5I 3DF6A 1I94I 3T1YI 1RC7A 4X66E 1N0UA 3LTOA 1IBKE 4B3SE 1QU6A 3IWBA 4DR4E 1HNXE 3C4TA 5F3WA 2UU9E 4JV5E 1IBMI 3ZZUA 2UXBI 3V5RA 4X62I 1UHZA 4HYMA 4YHHI 2K4VA 2DMYA 4DV0I 4AQYE 4L5NC 4DKKA 4WFTA 4GEQB 4Z7YA 4LF7I 3HJCA 5CFFE 3J81C 2BV3A 1Y4UA 2V8PA 4IZJB 4LFCI 4GKJE 5LMNI 2HKJA 1Z0GA 1Y6ZA 3Q6MA 4PRXA 2VQFE 3J81Q 1T4NA 2VF3A 4YY3E 3ADIA 4DPUA 4JI1E 1BKNA 4HACA 3OTOI 1HNZI 4R03A 3AUZA 2Z5BA 5A2QC 2ZM6E 1FJGE 3VYYA 1HR0E 2ODRD 2L2KB 2UUBE 4LF6E 1N34E 2ODRC 4TUGA 4LF4E 1KVKA 5A2QQ 4JI2I 3H09A 4DUYE 1Z0TA 2JY9A 4LF8E 4MYUA 4FWDA 2JVAA 4OX9I 1J5EE 2L2NA 4MYTA 3CWVA 2Q2EB 4R1FA 5FWKA 4DPWA 2L8TA 2GS8A 3QT6A 4JI3E 5AE1A 4K0KE 4JI0I 4DR1I 2V2QA 1DI2A 1PVGA 2FGGA 4DU8A 5LMUI 1Z5CA 1HNWE 2Z5CB 1EA6A 1RREA 4DV4I 1ZM3A 2B9DA 1XMOI 4DPTA 4DR6E 2O1TA 5IWAI 1N33I 5T6JA 2NUEA 2LTSA 1NZ0A 2PNMA 3K6QA 1VISA 2B7VA 2RS7A 4NXNI 2MC6A 4DXLA 2JOBA 2UXDE 2HK3A 3J7Yp 2JR1A 4LFBI 4TUIA 3DJWA 4JI7I 4WUDA 4FWGA 4DV6I 3LLHA 3J7AG 1ZXMA 1H7UA 1NHJA 2UUCE 2E1RA 1MX0A 2L33A 2LMZA 3FIGA 1SR9A 1GQEA 2LRSA 2PNLA 2F4VI 2L92A 3C4BA 2V83A 1XNQE 2M4IA 3ZZTA 3LMLA 4F9AB 4P52A 4DV7E 2CGEA 4DR7I 4LF5I 1USVA 2JWOA 3ZKDA 1ELOA 4F54A 3QT5A 2Z5EA 4DV2I 2UUAE 1KTVA 2H36X 3PRYA 1N32E 4KZSA 4DR2E 2UXCE 1XMQI 2V86A 1ZBTA 4Q28A 3K85A 1YYKA 4DV3E 3LPSA 2DSYA 1YZ9A 5ADZA 3HQ1A 2E5LE 2NPFA 2V89A 4DV5E 2HHHE 1GZ6A 2L6MA 4X64E 1X48A 3HTXA 1Z0VA 2CG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM C;  4X65 E;  1IBK I;  4B3S I;  4JI5 E;  3PYF A;  3WU3 A;  2BM1 A;  1I94 E;  2IHR 1;  3T1Y E;  3HUL A;  1HNX I;  2WW4 A;  4JV5 I;  4DV1 I;  2UU9 I;  1MG7 A;  3JAM Q;  2X36 A;  1OJ4 A;  1NHI A;  4DPY A;  4DU7 A;  4OOG C;  1D6T A;  2R42 A;  5FLX C;  1UEK A;  1O0W A;  2V2V A;  3T1H I;  4DV0 E;  4KHP I;  3WU4 A;  1XNR E;  3F0N A;  1Z5B A;  5FLX Q;  2VQF I;  4YY3 I;  4LFA I;  2MDR A;  4JYA E;  4DR3 E;  1T4O A;  4LFC E;  3PYD A;  2CZ9 A;  2RS6 A;  4HY1 A;  1Z5A A;  3K1J A;  1K47 A;  4GKK I;  3OTO E;  4LF4 I;  2EZ6 A;  2RTX A;  3D4J A;  1FI4 A;  2ZIT A;  4B3M I;  2OI2 A;  5LL6 R;  4DPX A;  5GMD A;  2HFS A;  4JI6 I;  4WUB A;  2L2M A;  3WU6 A;  2LTR A;  1N36 I;  1EI1 A;  4NXM I;  3VYX A;  1H72 C;  2DEI A;  4LF9 I;  4JI2 E;  2BM0 A;  4OX9 E;  1H73 A;  4Z7C A;  4DR5 I;  1ZM2 A;  2N3G A;  2DIX A;  4FWH A;  4JI4 E;  4RPF A;  2V2Z A;  2V34 A;  4JI0 E;  2R3V A;  4FW9 A;  5LMU E;  5BR8 E;  3PYG A;  4HAC B;  1ZXN A;  4DV4 E;  1A6F A;  2B3T B;  5IWA E;  1N33 E;  4KQV A;  4DUZ I;  1T4L B;  1Z0B A;  4B3R I;  1B63 A;  1B62 A;  2YT4 A;  4NXN E;  1DAR A;  2EFG A;  2J7K A;  2LJH A;  1QZR A;  2VQE I;  2B7T A;  4LFB E;  3V2U C;  1XNQ I;  1WHQ A;  1WHN A;  1IBL I;  4PU9 A;  1Z0E A;  4JG4 A;  4JI8 E;  1S4E A;  1Z59 A;  2F4V E;  1ZM9 A;  4B3T I;  1N32 I;  3ZZ0 A;  4DR2 I;  3ADJ A;  1YYW A;  1S16 A;  4UT4 A;  4DR7 E;  4X66 I;  2RSM A;  4LF5 E;  3P1X A;  1H74 A;  1J26 A;  4DV2 E;  1FNM A;  2LJP A;  1H7S A;  2DEJ A;  4X65 I;  4DR4 I;  2HKE A;  2ZBK B;  1Z0W A;  2A2D A;  4AQY I;  2LUQ A;  3QT7 A;  2NUG A;  5L3J A;  3B78 A;  1EKZ A;  1IBM E;  2UXB E;  4X62 E;  4YHH E;  4DV1 E;  2L3C A;  1PKP A;  4GKJ I;  4XTJ A;  2KHX A;  4LF7 E;  1XNR I;  3Q1Q A;  4JI1 I;  4ZVI A;  1NHH A;  4M1K A;  2ZM6 I;  1FJG I;  2NA2 A;  5LMN E;  4DR3 I;  1HR0 I;  4JYA I;  3T1H E;  4KHP E;  3H4L A;  2UUB I;  4I3H A;  4LF6 I;  1U2R A;  1RQ0 A;  1HNZ E;  1N34 I;  1KIJ A;  1Z0C A;  2CPN A;  1MU5 A;  4LFA E;  4DUY I;  4LF8 I;  2L3J A;  1J5E I;  4ED4 A;  4WUC A;  1RR9 A;  1X47 A;  5IT9 C;  4X8W A;  4GKK E;  1N0V C;  2HK2 A;  4USK A;  4JI3 I;  3WU5 A;  4K0K I;  1STU A;  2NUF A;  4B3M E;  1ZM4 A;  1YYO A;  4P7A A;  5IT9 Q;  3M6A A;  4JI6 E;  1HNW I;  4EMD A;  4USM A;  3ZKB A;  3ZM7 A;  1N36 E;  4NXM E;  4DR6 I;  4LF9 E;  4JI4 I;  1KKH A;  4DR1 E;  3ADL A;  2HFU A;  4DR5 E;  1FWK A;  3B82 A;  1UIL A;  2LUP B;  1XMO E;  5BR8 I;  2UXD I;  1XHK A;  5GME A;  2X7I A;  4PRV A;  1PIE A;  3J80 C;  1WUU A;  2UUC I;  3GON A;  3K17 A;  3J80 Q;  1X49 A;  3B8H A;  4JI7 E;  2XEX A;  1FWL A;  4DV6 E;  1FKA E;  3J7A M;  4DV7 I;  4DUZ E;  4M2Z A;  4B3R E;  3PYE A;  3QT8 A;  4UTG A;  4M30 A;  2UUA I;  3LNU A;  4URL A;  4JI8 I;  4FN5 A;  2UXC I;  2VQE E;  2A2C A;  2AJ4 A;  4DV3 I;  1IBL E;  4HXZ A;  2E5L I;  4DV5 I;  2N3H A;  2HHH I;  2LBS B;  4X64 I;  2DB2 A;  1XMQ E;  4B3T E;  4WYQ B;  3ADG A;  4JI5 I;  1I94 I;  3T1Y I;  1RC7 A;  4X66 E;  1N0U A;  3LTO A;  1IBK E;  4B3S E;  1QU6 A;  4DR4 E;  1HNX E;  3C4T A;  4JV5 E;  2UU9 E;  1IBM I;  3ZZU A;  2UXB I;  3V5R A;  4X62 I;  1UHZ A;  4HYM A;  4YHH I;  2DMY A;  4DV0 I;  4AQY E;  4DKK A;  4WFT A;  4Z7Y A;  4LF7 I;  5CFF E;  3J81 C;  2BV3 A;  2V8P A;  4LFC I;  4GKJ E;  5LMN I;  2HKJ A;  1Z0G A;  4PRX A;  2VQF E;  3J81 Q;  1T4N A;  2VF3 A;  4YY3 E;  3ADI A;  4DPU A;  4JI1 E;  1BKN A;  4HAC A;  3OTO I;  1HNZ I;  2ZM6 E;  5A2Q C;  1FJG E;  3VYY A;  1HR0 E;  2L2K B;  2UUB E;  4LF6 E;  1N34 E;  4LF4 E;  1KVK A;  5A2Q Q;  4JI2 I;  4DUY E;  1Z0T A;  2JY9 A;  4LF8 E;  4MYU A;  4FWD A;  2JVA A;  4OX9 I;  1J5E E;  2L2N A;  4MYT A;  3CWV A;  2Q2E B;  4R1F A;  4DPW A;  2GS8 A;  3QT6 A;  4JI3 E;  4JI0 I;  4K0K E;  4DR1 I;  2V2Q A;  1DI2 A;  1PVG A;  4DU8 A;  5LMU I;  1Z5C A;  1HNW E;  1EA6 A;  1RRE A;  4DV4 I;  1ZM3 A;  1XMO I;  4DPT A;  4DR6 E;  5IWA I;  1N33 I;  2NUE A;  2LTS A;  1NZ0 A;  1VIS A;  2B7V A;  2RS7 A;  4NXN I;  4DXL A;  2UXD E;  2HK3 A;  3J7Y p;  4LFB I;  4JI7 I;  4WUD A;  4FWG A;  4DV6 I;  3LLH A;  3J7A G;  1ZXM A;  1H7U A;  1NHJ A;  2UUC E;  2E1R A;  1MX0 A;  2L33 A;  1GQE A;  2LRS A;  2F4V I;  3C4B A;  1XNQ E;  3ZZT A;  4P52 A;  4DV7 E;  4DR7 I;  4LF5 I;  3ZKD A;  1ELO A;  3QT5 A;  4DV2 I;  2UUA E;  1KTV A;  1N32 E;  4DR2 E;  2UXC E;  1XMQ I;  1ZBT A;  1YYK A;  4DV3 E;  3LPS A;  1YZ9 A;  2E5L E;  2NPF A;  4DV5 E;  2HHH E;  4X64 E;  1X48 A;  3HTX A;  1Z0V A; 
#chains in the Genus database with same CATH topology
 3JAM C;  2EM0 A;  2EM4 A;  3F6G A;  4X65 E;  2EM7 A;  1IBK I;  3GLL A;  1Y4S A;  4B3S I;  3KRN A;  2EPN A;  2JP9 A;  4JI5 E;  3PYF A;  3WU3 A;  2BM1 A;  1I94 E;  2IHR 1;  3T1Y E;  3HUL A;  4MDT A;  1HNX I;  3F6H A;  4R2S A;  2WW4 A;  4ZYD A;  3BF2 A;  4JV5 I;  1IMU A;  4R2Q A;  4DV1 I;  2UU9 I;  2EMX A;  3VK6 A;  1MG7 A;  3JAM Q;  3JU0 A;  3U1K A;  2X36 A;  4LPF A;  2KOU A;  1NCS A;  5A6J A;  1OJ4 A;  2MKD A;  1NHI A;  3RMP A;  4DPY A;  3U1Y A;  4DU7 A;  4OOG C;  1D6T A;  4F6N A;  2R42 A;  1UDS A;  2GPI A;  3THN A;  5FLX C;  2EPA A;  1UEK A;  2DGC A;  1O0W A;  2YU5 A;  1G2D C;  2V2V A;  5DNX A;  2YTN A;  3T1H I;  4DV0 E;  4KHP I;  3WU4 A;  2HJJ A;  4O4K A;  1XNR E;  3F0N A;  4ZYH A;  1Z5B A;  5FLX Q;  2VQF I;  4JYA I;  2ADR A;  1MGT A;  2I9I A;  3PS3 A;  4YY3 I;  4L8N A;  4LFA I;  2EOM A;  2MDR A;  3B4T A;  3DD6 A;  5KL5 A;  1X6E A;  4DR3 E;  4JYA E;  4BC7 A;  1T4O A;  4LFC E;  1XXE A;  3PYD A;  4P7D A;  2CZ9 A;  2RS6 A;  1E3H A;  4HY1 A;  1WXR A;  1Z5A A;  4WSG A;  3K1J A;  1K47 A;  4GKK I;  1E3P A;  2MKN A;  5DRQ A;  4R2A A;  2JOX A;  4F9C B;  3OTO E;  2K7I A;  2EMB A;  2MC5 A;  5JEA A;  4LF4 I;  2EZ6 A;  1B69 A;  2RTX A;  3D4J A;  1FI4 A;  2V8Q B;  1N3G A;  2ZIT A;  2YZT A;  2IOQ A;  2OI2 A;  4B3M I;  5LL6 R;  3M85 D;  1AAY A;  5KL2 A;  4DPX A;  5GMD A;  2F8B A;  2HFS A;  4JI6 I;  2EQ1 A;  4WUB A;  2EOS A;  2M7Q A;  2EMZ A;  3HXL A;  2L2M A;  3WU6 A;  5JEA D;  2LTR A;  1N36 I;  4IZK A;  3JTZ A;  2BB8 A;  1EI1 A;  3VYX A;  1WJP A;  2PNZ A;  4NXM I;  1H72 C;  2DEI A;  4LF9 I;  3L7Z A;  4JI2 E;  2EM6 A;  5AC5 A;  2BM0 A;  2WP8 B;  5JEA C;  4OX9 E;  4RHB B;  4WPY A;  2M1S A;  5AAS A;  1H73 A;  3EPL A;  4Z7C A;  4DR5 I;  2ENA A;  5AE3 A;  1ZM2 A;  2VES A;  4LU9 A;  2N3G A;  2DIX A;  4FWH A;  4JI4 E;  1UDN A;  4RPF A;  2PO2 A;  2V2Z A;  4FW7 A;  4WXC A;  2V34 A;  2YTE A;  4JI0 E;  1RMD A;  4BHB A;  2R3V A;  1P47 A;  4FW9 A;  1UDO A;  5JEA F;  1BBO A;  5LMU E;  4J8Z A;  5BR8 E;  3PYG A;  2YSO A;  4HAC B;  3UK3 C;  2EPP A;  1ZXN A;  4DV4 E;  2I13 A;  2Z5B B;  1IQS A;  2JT2 A;  2V87 A;  1A6F A;  2B3T B;  5IWA E;  2C37 A;  1N33 E;  2J65 A;  3GME A;  4KQV A;  3M7N D;  4FW3 A;  1JK2 A;  2N8X A;  4DUZ I;  5A6A A;  4GZN C;  1T4L B;  1Z0B A;  1B63 A;  4B3R I;  3HPZ A;  1B62 A;  4MLV A;  3EQ1 A;  4R2D A;  2O1V A;  4MQY A;  2LE2 A;  2YT4 A;  4NXN E;  4N3O A;  1DAR A;  2EOJ A;  2Q8U A;  2EFG A;  2J7K A;  2LJH A;  2RSI A;  1QZR A;  2GQ0 A;  2VQE I;  2B7T A;  4LFB E;  2EMA A;  3V2U C;  1XNQ I;  1WHQ A;  1WHN A;  2BR2 A;  4M9V C;  4NZV A;  4PU9 A;  1IBL I;  2EWL A;  3KZZ A;  1Z0E A;  1DGC A;  2BA1 G;  4JG4 A;  1ZR9 A;  5K36 A;  2EN3 A;  4BA2 B;  3EPH A;  4JI8 E;  1UDQ A;  1S4E A;  1Z59 A;  2YRM A;  3HKM A;  4IZJ A;  2F4V E;  2M9A A;  1ZM9 A;  4B3T I;  3HPS A;  1TN9 A;  1N32 I;  3P3G A;  3L7Z B;  3ZZ0 A;  2PRT A;  4DR2 I;  1UN6 B;  3ADJ A;  2EL5 A;  1YYW A;  1S16 A;  2IES A;  4UT4 A;  5K36 D;  4R2P A;  4BMJ A;  4DR7 E;  4X66 I;  2RSM A;  4LF5 E;  3P1X A;  2WCC 3;  4IZJ D;  4LCF A;  1H74 A;  1X5W A;  1J26 A;  5K36 C;  5TSE A;  4OO1 D;  4DV2 E;  1FNM A;  4WSP A;  2LJP A;  1ZBQ A;  4HTG A;  1H7S A;  2GLI A;  2DEJ A;  3P06 A;  5DRR A;  1DQ3 A;  4X65 I;  1R6L A;  4DR4 I;  2HKE A;  5JEA E;  4OO1 C;  2YU8 A;  2VF1 A;  2JE6 A;  2NAB A;  2GHF A;  1SFE A;  2LO3 A;  2IOP A;  2ZBK B;  4IFD A;  3ZOQ B;  2FV4 B;  1Z0W A;  4BCA A;  2A2D A;  4AQY I;  2LUQ A;  3QT7 A;  5IV8 B;  2EM9 A;  2NUG A;  2EOX A;  5K36 F;  1JK1 A;  5A6K A;  2EN4 A;  1EKZ A;  2O3Z A;  3B78 A;  5L3J A;  4IFD D;  4BS9 A;  2C37 B;  1IBM E;  2UXB E;  4X62 E;  2MDG A;  4FW5 A;  4MU0 A;  4OO1 F;  4YHH E;  4QNK A;  2V85 A;  4BBY A;  1A1F A;  4DV1 E;  2L3C A;  1PKP A;  4IFD C;  2LCE A;  3OML A;  1EH6 A;  4GKJ I;  4XTJ A;  2KHX A;  3VHT B;  1A1H A;  3ECR A;  4LF7 E;  4FK5 C;  1XNR I;  3Q1Q A;  2EM5 A;  2FTX B;  2PO1 B;  2Z5C A;  2EPM X;  2YTG A;  4JI1 I;  4F2J C;  4MU4 A;  4N4R B;  5LLQ A;  4ZVI A;  1NHH A;  4M1K A;  2ZM6 I;  1FJG I;  2NA2 A;  3Q6N A;  3EPJ A;  4NHR A;  5LMN E;  3P3E A;  2EPU A;  3T1H E;  1A1K A;  4AID A;  2EN6 A;  4DR3 I;  4KHP E;  3H4L A;  1HR0 I;  3MHS C;  2ENC A;  1USU A;  2UUB I;  4IFD F;  4I3H A;  4LF6 I;  2E1M A;  1TF3 A;  1U2R A;  1RQ0 A;  3BBG A;  1HNZ E;  4OKG A;  1KIJ A;  1N34 I;  1Z0C A;  2CPN A;  2YRH A;  1MU5 A;  4LFA E;  4DUY I;  4LF8 I;  4BA1 A;  2JEB B;  2L3J A;  1J5E I;  5DRO A;  1YFH A;  2LVH A;  2O1W A;  2NN6 A;  4ED4 A;  4AIM A;  1Y5Y A;  2WBT A;  4WUC A;  2EPO A;  1RR9 A;  1X47 A;  5IT9 C;  4X8W A;  2EOQ A;  4GKK E;  2EM8 A;  1N0V C;  2HK2 A;  1G2F C;  4USK A;  2NN6 D;  3EPK A;  2C38 A;  2JPA A;  4JI3 I;  4IJD A;  3WU5 A;  5C0X A;  4K0K I;  5K36 E;  1STU A;  2NUF A;  4B3M E;  5ELW A;  4IS1 C;  1TF6 A;  1OYR A;  2G7H A;  1ZM4 A;  1YYO A;  1BB8 A;  4P7A A;  5IT9 Q;  2DRP A;  2NN6 C;  2EOO A;  4JI6 E;  3M6A A;  1HNW I;  4EMD A;  3M99 B;  2YTJ A;  1IQO A;  3ZKB A;  4USM A;  4OO1 E;  1WRJ A;  1A1G A;  1N36 E;  3ZM7 A;  4NXM E;  2YTO A;  2O1U A;  5C0X D;  2J7J A;  4LTY A;  4LF9 E;  4JI4 I;  4DR6 I;  1KKH A;  4DR1 E;  4R8O A;  1YSA C;  2EPC A;  1ZU1 A;  3ADL A;  2HFU A;  1X6F A;  1AH5 A;  2V88 A;  5C0X C;  4F6M A;  4DR5 E;  1YUJ A;  1FWK A;  3IWC A;  3B82 A;  1UIL A;  2LUP B;  1XMO E;  5BR8 I;  2UXD I;  3IWD A;  2NN6 F;  4AM3 A;  2HC5 A;  4BC9 A;  2EOE A;  1XHK A;  1OYS A;  1MEY C;  5AE2 A;  5DNY A;  1UBD C;  5GME A;  2EOY A;  1A1L A;  2DLQ A;  2LV2 A;  3J80 C;  2EM3 A;  2EOZ A;  5KL6 A;  1PIE A;  2X7I A;  4PRV A;  4F9B B;  4IFD E;  2VE7 C;  2A25 A;  2YTF A;  1WUU A;  4MU3 A;  1YH8 A;  3UHM A;  2UUC I;  2HGH A;  2WNR A;  4FW6 A;  2EPZ A;  4BHC A;  3GON A;  2JYA A;  5C0X F;  1OYP A;  3AV0 A;  3MSW A;  4O43 A;  3K17 A;  2VRD A;  5JEA B;  3MHH C;  2YTD A;  3J80 Q;  1X49 A;  3B8H A;  4JI7 E;  3KWR A;  1FWL A;  2XEX A;  3GCM A;  4FW4 A;  1HK7 A;  4I8O A;  2RPC A;  4DV6 E;  4BA1 B;  2YTI A;  2R76 A;  1FKA E;  4U3D A;  4DV7 I;  3J7A M;  4M0V A;  4DUZ E;  2EMG A;  2BBG A;  4M2Z A;  4B3R E;  3PYE A;  3QT8 A;  4Q35 B;  4UTG A;  2KON A;  2YWQ A;  4QNJ A;  4X9J A;  4M30 A;  2EMI A;  3LNU A;  2WZO A;  4IZK B;  2PNZ B;  4URL A;  2UUA I;  3M7N G;  4OO1 A;  4JI8 I;  3H1C A;  2BA0 G;  4FN5 A;  2UXC I;  2VQE E;  2EOH A;  2A2C A;  2AJ4 A;  4DV3 I;  1IBL E;  4HXZ A;  2E5L I;  4DMI A;  1PJQ A;  4DV5 I;  2N3H A;  2EMY A;  4P78 A;  4R2R A;  2LBS B;  4X64 I;  5KL7 A;  2HHH I;  1KJK A;  4OZE A;  2DB2 A;  4GQU A;  1Y60 A;  1P42 A;  4KWY A;  2D9H A;  2PO2 B;  1XMQ E;  4B3T E;  4MLQ A;  5DNL A;  2EQ0 A;  4WYQ B;  3ADG A;  2EPK X;  3DF6 A;  4JI5 I;  1I94 I;  3T1Y I;  2LJU A;  4ZYG A;  1RC7 A;  2DLK A;  2C39 A;  4X66 E;  1N0U A;  2NN6 E;  3LTO A;  2PO0 A;  5AC4 A;  1IBK E;  4B3S E;  1QU6 A;  3IWB A;  2JEA A;  2LT7 A;  3THO B;  4DR4 E;  3BGH A;  2GO4 A;  1HNX E;  4IS9 A;  5C0X E;  3C4T A;  5F3W A;  2UU9 E;  4JV5 E;  2IER A;  3ZZU A;  1IBM I;  2UXB I;  1ZAA C;  3V5R A;  2EJ4 A;  4O24 A;  4X62 I;  1UHZ A;  5KL4 A;  4HYM A;  2WNR B;  4YHH I;  1PJT A;  2K4V A;  2WP8 A;  2DMY A;  4DV0 I;  4AQY E;  2EMK A;  4L5N C;  2EML A;  4DKK A;  4WFT A;  1X6H A;  4GEQ B;  1RHY A;  2BR2 B;  2CVE A;  3CDJ A;  4Z7Y A;  5A6B A;  4LF7 I;  4HEI A;  1PJS A;  3P76 A;  3HJC A;  5CFF E;  3PS2 A;  3J81 C;  5K36 B;  2BV3 A;  1Y4U A;  1F2I G;  3C6K A;  2EOI A;  2V8P A;  4IZJ B;  1KYQ A;  4LFC I;  1PDA A;  4GKJ E;  4OO1 B;  5LMN I;  5A6B D;  1A1I A;  1Z0G A;  2HKJ A;  1Y6Z A;  3Q6M A;  4PRX A;  2VQF E;  3J81 Q;  1T4N A;  1QNT A;  2VF3 A;  4YY3 E;  2EOR A;  3ADI A;  4DPU A;  4JI1 E;  3C6M A;  1BKN A;  4HAC A;  3OTO I;  1HNZ I;  2GO3 A;  4R03 A;  3AUZ A;  3QG5 C;  2Z5B A;  2CT1 A;  2YTQ A;  5A2Q C;  2ZM6 E;  1FJG E;  5DRP A;  3VYY A;  1HR0 E;  2R1F A;  2ODR D;  4WX9 A;  5EL9 A;  2L2K B;  2EQ3 A;  2UUB E;  3PS1 A;  4LF6 E;  2JE6 B;  3L00 A;  2ODR C;  2JXP A;  4TUG A;  1N34 E;  4LF4 E;  2YPN A;  4IFD B;  1KVK A;  5A2Q Q;  4JI2 I;  3H09 A;  4DUY E;  1Z0T A;  2C39 B;  2JY9 A;  2DMI A;  4LF8 E;  4MYU A;  2EPL X;  2JVA A;  4FWD A;  4OX9 I;  3TQM A;  2EMW A;  2L2N A;  1J5E E;  2PO0 B;  2YRK A;  2EPR A;  3CWV A;  4MYT A;  2E72 A;  2EE8 A;  2Q2E B;  4O5G A;  2YSP A;  4MU1 A;  2JEA B;  3M85 G;  1A1J A;  4R1F A;  5FWK A;  4BA2 A;  2EN7 A;  4DPW A;  4ISA A;  2L8T A;  1YHC A;  2GS8 A;  3QT6 A;  4JI3 E;  5AE1 A;  4K0K E;  4JI0 I;  4DR1 I;  2V2Q A;  2EMC A;  1DI2 A;  2AE8 A;  1PVG A;  2FGG A;  4LCG A;  4DU8 A;  5LMU I;  1Z5C A;  1HNW E;  5EKW A;  3P3C A;  2Z5C B;  1EA6 A;  1VI7 A;  1RRE A;  5A69 A;  5IXM B;  4DV4 I;  1ZM3 A;  2B9D A;  1XMO I;  2CG9 A;  4DPT A;  4DR6 E;  2EPX A;  1T39 A;  2O1T A;  5IWA I;  3NZK A;  1N33 I;  1YPN A;  5T6J A;  2CTD A;  2NUE A;  5KL3 A;  4RH8 A;  2WBS A;  2LTS A;  4WXD A;  1NZ0 A;  2EMF A;  3K6Q A;  2PNM A;  1VIS A;  2B7V A;  1BBG A;  2RS7 A;  4NXN I;  2MC6 A;  4DXL A;  2JOB A;  2UXD E;  2HK3 A;  3J7Y p;  3BID A;  2BA1 D;  2EN2 A;  1L4S A;  2JR1 A;  4LFB I;  4TUI A;  2EL4 A;  4R2C A;  3DJW A;  4JI7 I;  4J3D A;  4WUD A;  4R2E A;  2NN6 B;  4FWG A;  4DV6 I;  3LLH A;  3J7A G;  1ZXM A;  1H7U A;  1NHJ A;  2BA0 D;  2UUC E;  2E1R A;  1T38 A;  1MX0 A;  2L33 A;  2LMZ A;  3FIG A;  1Z1B A;  4ZYE A;  1EH8 A;  4U3B A;  1SR9 A;  1GQE A;  2LRS A;  2PNL A;  2F4V I;  2L92 A;  3C4B A;  2V83 A;  1XNQ E;  2CSH A;  2M4I A;  2C38 B;  2ELY A;  1YUI A;  3ZZT A;  5C0X B;  3LML A;  2WBU A;  4F9A B;  4P52 A;  2EM2 A;  2PO1 A;  4DV7 E;  2CGE A;  4DR7 I;  4NBQ A;  4LF5 I;  1USV A;  2JWO A;  3ZKD A;  1ELO A;  1GTK A;  4F54 A;  2Z5E A;  3QT5 A;  4DV2 I;  3CDI A;  2UUA E;  1KTV A;  4LCH A;  2EN8 A;  2H36 X;  2YTP A;  2EP3 A;  1LLM C;  1N32 E;  3PRY A;  3KZY A;  4KZS A;  4DR2 E;  2UXC E;  4LOM A;  1X3C A;  1XMQ I;  2V86 A;  1ZBT A;  4Q28 A;  2F1D A;  3K85 A;  1EH7 A;  2JEB A;  2ENH A;  1YYK A;  4DV3 E;  3LPS A;  2EMH A;  2DSY A;  1YZ9 A;  5ADZ A;  2ELZ A;  3HQ1 A;  2RQL A;  2E5L E;  1R6M A;  2NPF A;  2V89 A;  2EOF A;  4DV5 E;  2HHH E;  1GZ6 A;  2L6M A;  1NEI A;  2EL6 A;  4X64 E;  1X48 A;  3HTX A;  1Z0V A;  2EN1 A; 
#chains in the Genus database with same CATH homology
 3JAM C;  3F6G A;  4X65 E;  1IBK I;  1Y4S A;  4B3S I;  4JI5 E;  3PYF A;  3WU3 A;  2BM1 A;  1I94 E;  2IHR 1;  3T1Y E;  3HUL A;  1HNX I;  3F6H A;  2WW4 A;  4JV5 I;  4DV1 I;  2UU9 I;  1MG7 A;  3VK6 A;  3JAM Q;  3JU0 A;  2X36 A;  2KOU A;  1OJ4 A;  1NHI A;  3RMP A;  4DPY A;  4DU7 A;  4OOG C;  1D6T A;  2R42 A;  5FLX C;  1UEK A;  1O0W A;  2V2V A;  3T1H I;  4DV0 E;  4KHP I;  3WU4 A;  1XNR E;  3F0N A;  1Z5B A;  5FLX Q;  2VQF I;  4YY3 I;  4L8N A;  4LFA I;  2MDR A;  4JYA E;  4DR3 E;  4BC7 A;  1T4O A;  4LFC E;  3PYD A;  4P7D A;  2CZ9 A;  2RS6 A;  4HY1 A;  1WXR A;  1Z5A A;  3K1J A;  1K47 A;  4GKK I;  2JOX A;  4F9C B;  3OTO E;  2MC5 A;  4LF4 I;  2EZ6 A;  2RTX A;  3D4J A;  1FI4 A;  2V8Q B;  2ZIT A;  4B3M I;  2YZT A;  2IOQ A;  2OI2 A;  5LL6 R;  4DPX A;  5GMD A;  2F8B A;  2HFS A;  4JI6 I;  4WUB A;  2M7Q A;  3HXL A;  2L2M A;  3WU6 A;  2LTR A;  1N36 I;  4IZK A;  3JTZ A;  1EI1 A;  4NXM I;  3VYX A;  1H72 C;  2DEI A;  4LF9 I;  4JI2 E;  2BM0 A;  4OX9 E;  4WPY A;  2M1S A;  5AAS A;  1H73 A;  4Z7C A;  4DR5 I;  5AE3 A;  1ZM2 A;  4LU9 A;  2N3G A;  2DIX A;  4FWH A;  4JI4 E;  4RPF A;  2V2Z A;  2V34 A;  4JI0 E;  2R3V A;  4FW9 A;  5LMU E;  4J8Z A;  5BR8 E;  3PYG A;  4HAC B;  1ZXN A;  4DV4 E;  2Z5B B;  2V87 A;  1A6F A;  2B3T B;  5IWA E;  1N33 E;  4KQV A;  4DUZ I;  1T4L B;  1Z0B A;  4B3R I;  1B63 A;  3HPZ A;  1B62 A;  2O1V A;  2LE2 A;  2YT4 A;  4NXN E;  4N3O A;  1DAR A;  2EFG A;  2J7K A;  2LJH A;  1QZR A;  2GQ0 A;  2VQE I;  2B7T A;  4LFB E;  3V2U C;  1XNQ I;  1WHQ A;  1WHN A;  1IBL I;  4PU9 A;  2EWL A;  1Z0E A;  4JG4 A;  4JI8 E;  1S4E A;  1Z59 A;  4IZJ A;  2F4V E;  1ZM9 A;  4B3T I;  3HPS A;  1N32 I;  3ZZ0 A;  4DR2 I;  3ADJ A;  1YYW A;  1S16 A;  4UT4 A;  4BMJ A;  4DR7 E;  4X66 I;  2RSM A;  4LF5 E;  3P1X A;  4IZJ D;  1H74 A;  1J26 A;  4DV2 E;  1FNM A;  4WSP A;  2LJP A;  1ZBQ A;  1H7S A;  2DEJ A;  3P06 A;  1DQ3 A;  4X65 I;  4DR4 I;  2HKE A;  2VF1 A;  2IOP A;  2ZBK B;  3ZOQ B;  2FV4 B;  1Z0W A;  4BCA A;  2A2D A;  4AQY I;  2LUQ A;  3QT7 A;  2NUG A;  5L3J A;  3B78 A;  1EKZ A;  4BS9 A;  1IBM E;  2UXB E;  4X62 E;  4YHH E;  2V85 A;  4BBY A;  4DV1 E;  2L3C A;  1PKP A;  3OML A;  4GKJ I;  4XTJ A;  2KHX A;  4LF7 E;  1XNR I;  3Q1Q A;  2FTX B;  2Z5C A;  4JI1 I;  4ZVI A;  1NHH A;  4M1K A;  2ZM6 I;  1FJG I;  2NA2 A;  3Q6N A;  5LMN E;  4DR3 I;  1HR0 I;  4JYA I;  3T1H E;  4KHP E;  3H4L A;  1USU A;  2UUB I;  4I3H A;  4LF6 I;  2E1M A;  1U2R A;  1RQ0 A;  1HNZ E;  1N34 I;  1KIJ A;  1Z0C A;  2CPN A;  1MU5 A;  4LFA E;  4DUY I;  4LF8 I;  2L3J A;  1J5E I;  2O1W A;  4ED4 A;  4WUC A;  1RR9 A;  1X47 A;  5IT9 C;  4X8W A;  4GKK E;  1N0V C;  2HK2 A;  4USK A;  4JI3 I;  3WU5 A;  4K0K I;  1STU A;  2NUF A;  4B3M E;  2G7H A;  1ZM4 A;  1YYO A;  4P7A A;  5IT9 Q;  3M6A A;  4JI6 E;  1HNW I;  4EMD A;  4USM A;  3ZKB A;  3ZM7 A;  1N36 E;  4NXM E;  2O1U A;  4DR6 I;  4LTY A;  4LF9 E;  4JI4 I;  1KKH A;  4DR1 E;  4R8O A;  3ADL A;  2HFU A;  2V88 A;  4DR5 E;  1FWK A;  3IWC A;  3B82 A;  1UIL A;  2LUP B;  1XMO E;  5BR8 I;  2UXD I;  3IWD A;  4BC9 A;  1XHK A;  5AE2 A;  5DNY A;  5GME A;  2X7I A;  4PRV A;  3J80 C;  1PIE A;  4F9B B;  2VE7 C;  1WUU A;  2UUC I;  3GON A;  3AV0 A;  3MSW A;  3K17 A;  3J80 Q;  1X49 A;  3B8H A;  4JI7 E;  3KWR A;  1FWL A;  2XEX A;  1HK7 A;  4I8O A;  4DV6 E;  1FKA E;  3J7A M;  4DV7 I;  4M0V A;  4DUZ E;  4M2Z A;  4B3R E;  3PYE A;  3QT8 A;  4UTG A;  2KON A;  4M30 A;  2UUA I;  3LNU A;  2WZO A;  4IZK B;  4URL A;  4JI8 I;  4FN5 A;  2UXC I;  2VQE E;  2A2C A;  2AJ4 A;  4DV3 I;  1IBL E;  4HXZ A;  2E5L I;  4DMI A;  4DV5 I;  2N3H A;  4P78 A;  2HHH I;  2LBS B;  4X64 I;  2DB2 A;  1XMQ E;  4B3T E;  4WYQ B;  3ADG A;  4JI5 I;  3DF6 A;  1I94 I;  3T1Y I;  1RC7 A;  4X66 E;  1N0U A;  3LTO A;  1IBK E;  4B3S E;  1QU6 A;  3IWB A;  4DR4 E;  1HNX E;  3C4T A;  5F3W A;  2UU9 E;  4JV5 E;  1IBM I;  3ZZU A;  2UXB I;  3V5R A;  4X62 I;  1UHZ A;  4HYM A;  4YHH I;  2K4V A;  2DMY A;  4DV0 I;  4AQY E;  4L5N C;  4DKK A;  4WFT A;  4GEQ B;  4Z7Y A;  4LF7 I;  3HJC A;  5CFF E;  3J81 C;  2BV3 A;  1Y4U A;  2V8P A;  4IZJ B;  4LFC I;  4GKJ E;  5LMN I;  2HKJ A;  1Z0G A;  1Y6Z A;  3Q6M A;  4PRX A;  2VQF E;  3J81 Q;  1T4N A;  2VF3 A;  4YY3 E;  3ADI A;  4DPU A;  4JI1 E;  1BKN A;  4HAC A;  3OTO I;  1HNZ I;  4R03 A;  3AUZ A;  2Z5B A;  5A2Q C;  2ZM6 E;  1FJG E;  3VYY A;  1HR0 E;  2ODR D;  2L2K B;  2UUB E;  4LF6 E;  1N34 E;  2ODR C;  4TUG A;  4LF4 E;  1KVK A;  5A2Q Q;  4JI2 I;  3H09 A;  4DUY E;  1Z0T A;  2JY9 A;  4LF8 E;  4MYU A;  4FWD A;  2JVA A;  4OX9 I;  1J5E E;  2L2N A;  4MYT A;  3CWV A;  2Q2E B;  4R1F A;  5FWK A;  4DPW A;  2L8T A;  2GS8 A;  3QT6 A;  4JI3 E;  5AE1 A;  4K0K E;  4JI0 I;  4DR1 I;  2V2Q A;  1DI2 A;  1PVG A;  2FGG A;  4DU8 A;  5LMU I;  1Z5C A;  1HNW E;  2Z5C B;  1EA6 A;  1RRE A;  4DV4 I;  1ZM3 A;  2B9D A;  1XMO I;  4DPT A;  4DR6 E;  2O1T A;  5IWA I;  1N33 I;  5T6J A;  2NUE A;  2LTS A;  1NZ0 A;  2PNM A;  3K6Q A;  1VIS A;  2B7V A;  2RS7 A;  4NXN I;  2MC6 A;  4DXL A;  2JOB A;  2UXD E;  2HK3 A;  3J7Y p;  2JR1 A;  4LFB I;  4TUI A;  3DJW A;  4JI7 I;  4WUD A;  4FWG A;  4DV6 I;  3LLH A;  3J7A G;  1ZXM A;  1H7U A;  1NHJ A;  2UUC E;  2E1R A;  1MX0 A;  2L33 A;  2LMZ A;  3FIG A;  1SR9 A;  1GQE A;  2LRS A;  2PNL A;  2F4V I;  2L92 A;  3C4B A;  2V83 A;  1XNQ E;  2M4I A;  3ZZT A;  3LML A;  4F9A B;  4P52 A;  4DV7 E;  2CGE A;  4DR7 I;  4LF5 I;  1USV A;  2JWO A;  3ZKD A;  1ELO A;  4F54 A;  3QT5 A;  2Z5E A;  4DV2 I;  2UUA E;  1KTV A;  2H36 X;  3PRY A;  1N32 E;  4KZS A;  4DR2 E;  2UXC E;  1XMQ I;  2V86 A;  1ZBT A;  4Q28 A;  3K85 A;  1YYK A;  4DV3 E;  3LPS A;  2DSY A;  1YZ9 A;  5ADZ A;  3HQ1 A;  2E5L E;  2NPF A;  2V89 A;  4DV5 E;  2HHH E;  1GZ6 A;  2L6M A;  4X64 E;  1X48 A;  3HTX A;  1Z0V A;  2CG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...