4B3ME

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3mE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mE02
4KQVA 2F4VI 4DR6I 4DR3E 1FKAE 4WUDA 2CPNA 1N0UA 2V34A 4DV4E 1IBKI 3C4BA 1Z59A 2EZ6A 4JI7I 1ZM4A 4JI4I 4Z7YA 2VQEE 1WUUA 2HK3A 2L2MA 1DARA 4DR2I 2NUGA 1N32I 4HYMA 5L3JA 4OX9I 3J81Q 4DR3I 4GKKE 2F4VE 4LF9E 1BKNA 3QT5A 2RS6A 1N33I 3ZM7A 1XHKA 4X66I 1HNZE 4K0KE 1IBLI 4DU7A 1Z0BA 5IT9C 3P1XA 1YYWA 4M1KA 4DPWA 2LTRA 4DR5E 1HNWE 4DV1I 2Q2EB 4WFTA 2VF3A 5LMUI 4GKJE 3T1YI 4JI5E 2VQEI 4YY3I 1T4NA 2KHXA 1KVKA 4B3SI 1NHIA 2E1RA 1XMOE 2DB2A 4FWDA 1IBMI 2GS8A 5LMNE 1PIEA 2HFUA 2LRSA 1MG7A 1FJGE 5GMEA 3J7AG 3GONA 2ZBKB 4DV2I 1ZBTA 2L2KB 2UUAE 3WU3A 4NXNI 2LUQA 1D6TA 1OJ4A 1XMOI 1X48A 4FWGA 1N32E 2NPFA 3J80C 2UXDE 1MU5A 4B3TE 1B62A 3ADGA 4LF6E 1ELOA 3VYYA 3LPSA 4JI0I 4DXLA 4X62I 2IHR1 1Z0EA 1NZ0A 3M6AA 1IBME 2JVAA 2X7IA 3ZZ0A 4USMA 3ZKDA 2BM0A 3JAMQ 4DR7I 1U2RA 4JI2I 4DV1E 4LF7I 4DV7E 2LBSB 2YT4A 3ZZTA 4EMDA 1FJGI 1IBKE 4X62E 4DU8A 2HKJA 4X65I 4WYQB 1XMQI 4JI4E 2AJ4A 4DV7I 2UU9I 3HULA 4PU9A 4M2ZA 1XMQE 3PYEA 2RS7A 2V2QA 4LF5E 4DV5I 1O0WA 4LF7E 4RPFA 3WU4A 4HACB 4HXZA 4JI1E 4NXNE 4DPUA 1FWKA 4DV3I 4UTGA 2VQFI 4JI7E 4K0KI 2A2DA 1RQ0A 1GQEA 1H73A 2UUBI 4URLA 1J26A 4B3TI 1K47A 3J7AM 1Z5AA 1Z5CA 2LJPA 4ZVIA 2NA2A 2UXCE 1N36I 4OOGC 1RREA 1EI1A 4OX9E 4DKKA 2UUCE 4NXMI 2RTXA 3QT7A 4JG4A 4M30A 4DV0E 2V2ZA 4KHPI 2HKEA 3ADIA 2BV3A 1FI4A 4JI3E 1Z0WA 4B3MI 4DV0I 4FN5A 2L3CA 2V8PA 1UILA 3B8HA 4MYTA 3ADJA 4P7AA 4DUYI 1Z0TA 2B3TB 4LF5I 1YZ9A 2ZM6I 1Z5BA 4JI3I 1KIJA 4I3HA 4XTJA 1UEKA 4JI8I 4DPXA 3PYGA 4X65E 1YYOA 2UUBE 3OTOE 4WUCA 5FLXQ 2CZ9A 4X8WA 4DUZE 1ZM3A 4DR6E 4GKKI 3HTXA 4GKJI 3QT8A 4P52A 4LF8I 1Z0VA 4B3RI 1J5EI 4YHHI 2LUPB 1X47A 1X49A 2L33A 2BM1A 3C4TA 4DPTA 1UHZA 3LTOA 3J81C 3B78A 1Z0CA 2VQFE 4DR1I 1N0VC 3PYFA 2UXBI 4LF6I 1WHQA 1Z0GA 4DUYE 3V5RA 1S4EA 1NHJA 2EFGA 3OTOI 4DR4E 5A2QQ 1N36E 1HR0I 5IWAI 4R1FA 5GMDA 4DV6E 2MDRA 2A2CA 4LF4I 4NXME 2NUEA 2UUCI 1YYKA 3Q1QA 1XNRE 1EKZA 4B3SE 2HFSA 4YHHE 4DV3E 3ZZUA 4DR7E 1RC7A 2N3GA 4LFBI 2DMYA 2HHHI 4DR5I 3VYXA 2R3VA 4JI0E 4B3ME 2XEXA 3J7Yp 2LJHA 2RSMA 2HK2A 3J80Q 1PVGA 1WHNA 1H74A 1A6FA 3F0NA 4PRXA 1XNQE 4B3RE 1H7SA 2NUFA 2UUAI 4LF4E 1NHHA 2L2NA 3B82A 1XNRI 2E5LE 4AQYI 5BR8E 4HACA 1MX0A 2V2VA 4JI2E 5CFFE 1N33E 4LF8E 4DR2E 4LFCE 1RR9A 5FLXC 3K17A 4UT4A 4DUZI 5BR8I 4X64I 4KHPE 2ZITA 1QU6A 1FWLA 5LMNI 2DIXA 2B7TA 2L3JA 1KTVA 4X66E 5IWAE 3T1YE 4WUBA 4LFCI 4JYAI 2WW4A 1N34I 3QT6A 3WU5A 3ADLA 1I94I 1FNMA 2OI2A 2N3HA 1VISA 3LLHA 4JI6I 4DR1E 4DV2E 4DV6I 5A2QC 4JI8E 1STUA 4USKA 3JAMC 2B7VA 1EA6A 3D4JA 4JV5I 1T4OA 1ZXNA 1T4LB 1PKPA 3T1HI 2UXBE 2LTSA 4LF9I 3LNUA 1HNXI 2JY9A 2R42A 1H7UA 4AQYE 4X64E 2E5LI 1KKHA 3V2UC 3K1JA 3H4LA 2UU9E 4LFAE 1HR0E 4ED4A 4JI6E 3T1HE 2ZM6E 4PRVA 1HNWI 2HHHE 4DV5E 1QZRA 3WU6A 5IT9Q 1N34E 3ZKBA 4HY1A 1ZM9A 4FWHA 1ZXMA 1ZM2A 1IBLE 2X36A 1DI2A 4LFAI 2DEJA 1B63A 1H72C 4Z7CA 4MYUA 4DV4I 1HNZI 4JI1I 5LL6R 1J5EE 1XNQI 4JI5I 5LMUE 2DEIA 1HNXE 4YY3E 2J7KA 2UXDI 4FW9A 1S16A 4LFBE 2UXCI 4DR4I 3CWVA 4JYAE 1I94E 3PYDA 4DPYA 4JV5E
chains in the Genus database with same CATH superfamily
1WJPA 4KQVA 4QNKA 2F4VI 4OO1B 2VESA 4DR6I 1MGTA 1ZBQA 4DR3E 1FKAE 2WBUA 4BA1B 4WUDA 2CPNA 1N0UA 4F54A 3M7ND 2YTPA 2V34A 4DV4E 2EOJA 2EOHA 1IBKI 3EPHA 3C4BA 3IWCA 2EM6A 1Z59A 2EQ3A 2EZ6A 4JI7I 1PJSA 1ZM4A 3IWBA 5F3WA 4JI4I 4MLQA 4Z7YA 2VQEE 4LCFA 1WUUA 2HK3A 2L2MA 2L8TA 1DARA 1UDQA 4DR2I 2EM7A 4O5GA 2NUGA 3BGHA 4HYMA 5L3JA 4OX9I 3J81Q 1N32I 2C38B 4DR3I 2YTFA 4GKKE 3CDIA 2EN2A 2LT7A 2F4VE 2HGHA 4LF9E 2IOQA 2EN7A 2WBTA 1SR9A 5KL6A 2EN4A 1BKNA 2JEAB 3QT5A 2BR2B 2GPIA 2RS6A 2JOXA 1N33I 1EH8A 3ZM7A 1XHKA 2YTNA 3PS2A 2YTIA 2D9HA 4F9CB 4X66I 1HNZE 4K0KE 2EPPA 5K36B 1IBLI 1IQSA 2O1UA 2JT2A 4DU7A 5IT9C 1Z0BA 2DGCA 3P1XA 1A1FA 4WXDA 1YYWA 1YSAC 4M1KA 4DPWA 2VRDA 2LTRA 4B3RI 2C39B 4FK5C 5DNLA 4DR5E 3ECRA 1HNWE 2GHFA 1E3HA 2Q2EB 4DV1I 4WFTA 2MKNA 2JEAA 2VF3A 4BHCA 4DMIA 5LMUI 2YU5A 4GKJE 1HK7A 3T1YI 4JI5E 2VQEI 4YY3I 1T4NA 2KHXA 5KL3A 1KVKA 4B3SI 3HXLA 1NHIA 2E1RA 2E1MA 1XMOE 2DB2A 4FWDA 2EOQA 1IBMI 2GS8A 4N3OA 3TQMA 5AASA 5LMNE 1ZR9A 1PIEA 2HFUA 2LRSA 1BB8A 3RMPA 1P47A 1KJKA 1MG7A 1E3PA 1FJGE 5C0XC 2YTGA 2DRPA 5JEAF 3J7AG 5GMEA 1RMDA 2EN1A 2EL5A 3GONA 4R2PA 2ELYA 2ZBKB 2J65A 4DV2I 4BMJA 1ZBTA 2WZOA 2L2KB 2UUAE 3WU3A 2ADRA 4NXNI 2LUQA 3P3EA 2PO0B 1D6TA 1OJ4A 4RH8A 1XMOI 4ZYDA 2GO4A 1A1GA 5EKWA 1X48A 4FWGA 1N32E 1X3CA 3MHSC 4R8OA 2NPFA 4OKGA 3J80C 2UXDE 1MU5A 4F2JC 1A1IA 2YWQA 4B3TE 1XXEA 1B62A 3ADGA 4LF6E 1ELOA 3VYYA 2EWLA 4BS9A 3LPSA 4BHBA 3JTZA 1AH5A 4JI0I 4DXLA 4X62I 2V87A 2IHR1 1Z0EA 1BBGA 1G2FC 4IZJB 1NZ0A 3GMEA 3M6AA 4WXCA 2JR1A 1IBME 1YPNA 2JVAA 4L8NA 2X7IA 3ZZ0A 4USMA 2ENCA 3EPKA 3ZKDA 2YRMA 5C0XA 2FTXB 2BM0A 5DNXA 3JAMQ 2LCEA 5ELWA 3K6QA 4QNJA 4DR7I 2FGGA 1U2RA 4TUIA 2UUCI 4NHRA 4JI2I 4R2SA 4MLVA 4U3DA 4DV1E 4M9VC 2K4VA 4LF7I 1ZU1A 2EOFA 4DV7E 2LBSB 2YT4A 4LCGA 3ZZTA 2EM0A 4EMDA 1FJGI 1IBKE 4X62E 3H1CA 4DU8A 2GLIA 3KWRA 2HKJA 4X65I 4WYQB 1XMQI 2GQ0A 2MC6A 4JI4E 2AJ4A 4DV7I 2UU9I 2HC5A 3HULA 4LPFA 4PU9A 4OO1C 2JPAA 2Z5EA 4L5NC 4M2ZA 3UK3C 1XMQE 3P76A 2EM3A 1KYQA 3PYEA 1F2IG 5AE1A 1N3GA 2EM9A 4Q35B 5A6BA 2NN6F 2RS7A 2O3ZA 2V2QA 2PNZB 2EORA 4LF5E 2V86A 5K36F 4DV5I 1O0WA 4WX9A 3JU0A 4LF7E 1A1KA 4P78A 4RPFA 3PRYA 4HACB 2WNRA 2DLKA 4HXZA 3WU4A 2BA0G 4JI1E 2DLQA 4NXNE 4OO1A 4DPUA 2YRHA 2R1FA 2YTOA 1FWKA 4DV3I 2JE6B 2EL4A 3GCMA 3HPSA 4UTGA 2VQFI 4JI7E 5JEAB 4K0KI 5A6BD 2A2DA 1RQ0A 1GQEA 1UN6B 4KWYA 1H73A 2Q8UA 2UUBI 5A6AA 4URLA 1J26A 4B3TI 4R03A 1DGCA 2EM5A 1TF6A 2EM2A 1K47A 3J7AM 4OO1D 1Z5AA 4GZNC 1Z5CA 1Y5YA 4KZSA 3Q6MA 4ISAA 3LMLA 2BB8A 2PO0A 2LJPA 4ZVIA 2NA2A 2JE6A 2Z5CA 4IZKB 2UXCE 1N36I 4R2AA 2JYAA 3M99B 3AUZA 2EMIA 4OOGC 1RREA 2CGEA 1EI1A 2EMXA 2EOMA 4P7DA 2EMZA 4OX9E 2YTEA 2JXPA 4DKKA 2CSHA 2UUCE 4NXMI 2JOBA 2RTXA 3QT7A 4JG4A 5DRQA 4IFDC 5K36E 4M30A 4DV0E 2V2ZA 4KHPI 2HKEA 3ADIA 2BV3A 4FW5A 4IFDA 1X6HA 1FI4A 5JEAE 4ZYHA 3M85G 4JI3E 3OMLA 1Z0WA 2A25A 2L92A 4B3MI 4DV0I 3HPZA 2MDGA 1YHCA 4FN5A 4WPYA 4WSGA 2L3CA 2PO2A 2ODRD 5C0XB 2V8PA 2EMYA 1UILA 3B8HA 2M9AA 3L7ZB 3ADJA 3H09A 4MYTA 1PJQA 3DF6A 4P7AA 4DUYI 5KL5A 1Z0TA 4IZJD 2B3TB 4LF5I 3QG5C 1YZ9A 4IZJA 1Z5BA 2ZM6I 4JI3I 4WSPA 2EPOA 1KIJA 4I3HA 4XTJA 5ADZA 1Y4SA 2NN6D 3THOB 2WBSA 1UEKA 2C39A 1A1HA 2JEBA 4GQUA 4JI8I 4DPXA 3PYGA 4X65E 1YYOA 2UUBE 1R6LA 3OTOE 4MQYA 4WUCA 5FLXQ 4OO1E 1YUIA 5AC5A 2CZ9A 3PS1A 4X8WA 4DUZE 4F6MA 1TF3A 4DR6E 1ZM3A 3L7ZA 4GKKI 5FWKA 3HTXA 4GKJI 3QT8A 2LMZA 1JK1A 4P52A 2IESA 5AE2A 1IQOA 4LF8I 3DJWA 1Z0VA 3KZYA 2DMIA 2LJUA 4R2QA 1X6EA 1RHYA 2LUPB 1X47A 1UDNA 4YHHI 1J5EI 1X49A 2O1VA 2L33A 4M0VA 2BM1A 3C4TA 4ZYEA 2Z5BB 5LLQA 4DPTA 1UHZA 2EMFA 3J81C 2BA1G 3LTOA 2IOPA 1OYSA 4U3BA 4R2EA 4AM3A 3B78A 1T38A 1Z0CA 2VQFE 4DR1I 4R2RA 3EPLA 3EQ1A 3MHHC 3BF2A 3BIDA 1N0VC 3K85A 5KL4A 3PYFA 2UXBI 4LF6I 1WHQA 4J3DA 3BBGA 1Z0GA 4AIDA 3P3GA 1WRJA 4DUYE 3V5RA 3ZOQB 1S4EA 2NN6C 1NHJA 2Z5BA 2C37A 2EFGA 3C6KA 2E72A 2PNLA 2RPCA 2RQLA 2J7JA 2EL6A 3U1YA 4FW3A 4MU4A 2DSYA 4MU1A 4DR4E 3OTOI 5A2QQ 1N36E 5JEAD 1HR0I 1EH7A 4BCAA 3B4TA 2LVHA 1UBDC 5IWAI 2M7QA 4R1FA 5GMDA 4F9AB 2MDRA 4DV6E 2A2CA 2WCC3 4LF4I 4NXME 3FIGA 2NUEA 1YYKA 1YH8A 2RSIA 4MU0A 2EOEA 5DRPA 2EPLX 2EP3A 1USUA 5DRRA 4AIMA 3Q1QA 1XNRE 2EMCA 2V85A 5JEAC 1EKZA 1Z1BA 4B3SE 2ODRC 5A6JA 2HFSA 5TSEA 4YHHE 2BR2A 4DV3E 3ZZUA 4DR7E 2PNZA 1X6FA 1RC7A 2N3GA 4MDTA 2O1TA 4LFBI 1L4SA 2DMYA 1NCSA 1YFHA 2V8QB 2VF1A 2HHHI 2EOIA 4DR5I 1USVA 2YSPA 4NBQA 1G2DC 3VYXA 2F1DA 2R3VA 3THNA 4BC7A 4JI0E 2EOZA 2EMBA 2YSOA 3M7NG 5C0XD 2PO2B 4B3ME 2XEXA 1A1LA 3J7Yp 2LJHA 2RSMA 5AE3A 2HK2A 4IFDE 3J80Q 1PVGA 3CDJA 1WHNA 2Z5CB 4IZKA 4IFDB 3EPJA 4OZEA 1H74A 1UDOA 1A6FA 2YTQA 2IERA 2EPCA 2NABA 1PDAA 3F0NA 1X5WA 4FW7A 2EPZA 4PRXA 3KRNA 3PS3A 1XNQE 4B3RE 1H7SA 2NUFA 2EPMX 2UUAI 1PJTA 2B9DA 2CG9A 2LV2A 4LOMA 2ENHA 2JEBB 4LF4E 1NHHA 2WP8A 5JEAA 2EPRA 2L2NA 4FW6A 3B82A 2EQ0A 5AC4A 1MEYC 3U1KA 1XNRI 5DNYA 1UDSA 4IFDD 3L00A 1A1JA 2WP8B 4R2CA 2E5LE 2EN8A 4NZVA 2CTDA 4AQYI 2BBGA 5BR8E 4HACA 2M4IA 1MX0A 2V2VA 3AV0A 4HTGA 2PO1B 4BA2A 4JI2E 3P06A 2M1SA 3MSWA 3M85D 4IJDA 5CFFE 4IS9A 1N33E 4BBYA 2EMHA 2GO3A 5DROA 4LF8E 1Y6ZA 3F6HA 2CVEA 4DR2E 4LFCE 2G7HA 1RR9A 5A6KA 5FLXC 2MC5A 2EOXA 2R76A 3K17A 2HJJA 4UT4A 5KL7A 2WNRB 4DUZI 5BR8I 4X64I 4R2DA 1OYRA 4OO1F 4KHPE 2ZITA 1QU6A 2ELZA 1FWLA 2EMGA 3HQ1A 1Y4UA 5LMNI 4LCHA 2EMWA 2EM4A 2KOUA 1JK2A 2DIXA 2B7TA 2L3JA 1B69A 1KTVA 3DD6A 4X66E 5IWAE 2F8BA 5C0XF 3T1YE 1Y60A 4WUBA 4LFCI 4JYAI 2WW4A 1N34I 2ENAA 4MU3A 3QT6A 2EPXA 2PNMA 1WXRA 2EMAA 5KL2A 4O24A 2YU8A 3WU5A 3ADLA 1QNTA 2V89A 2O1WA 1I94I 5K36C 1BBOA 1FNMA 2OI2A 2N3HA 1VI7A 1SFEA 4LTYA 1VISA 4RHBB 3LLHA 2NN6B 4JI6I 4DR1E 3KZZA 4DV2E 4DV6I 2I9IA 5A2QC 3NZKA 1OYPA 4JI8E 2NN6A 1DQ3A 1STUA 1ZAAC 5K36A 4F6NA 4TUGA 4USKA 2EN3A 3JAMC 3VHTB 2B7VA 4LU9A 1EA6A 1R6MA 3D4JA 2C38A 2LE2A 4JV5I 1T4OA 3Q6NA 1ZXNA 5IV8B 1T4LB 2KONA 3UHMA 1PKPA 3T1HI 3F6GA 2UXBE 2LTSA 2PRTA 2C37B 2V83A 3LNUA 5C0XE 1HNXI 2YZTA 4IS1C 4LF9I 5K36D 3HJCA 2EE8A 2H36X 4Q28A 2EMKA 3P3CA 2EPUA 2JY9A 3VK6A 5A69A 2UXCI 1GZ6A 2R42A 1H7UA 2YPNA 2N8XA 4AQYE 4X64E 2E5LI 1KKHA 4O4KA 1YUJA 3K1JA 3V2UC 4BC9A 1AAYA 3H4LA 2UU9E 4LFAE 1HR0E 1TN9A 1P42A 3GLLA 4ED4A 2VE7C 1T39A 4JI6E 3T1HE 3C6MA 1IMUA 5EL9A 5IXMB 4BA1A 2ZM6E 2I13A 4PRVA 2MKDA 1HNWI 2EOSA 4ZYGA 1NEIA 2HHHE 4DV5E 2EM8A 2V88A 1QZRA 3WU6A 4O43A 2EPAA 2YRKA 5IT9Q 1N34E 3ZKBA 2PO1A 2EPKX 4BA2B 2AE8A 4J8ZA 4HY1A 1ZM9A 2BA0D 2EQ1A 2L6MA 4FWHA 4IFDF 4GEQB 1ZXMA 1ZM2A 1IBLE 2EN6A 2X36A 2K7IA 4HEIA 1GTKA 1DI2A 2EMLA 4FW4A 4LFAI 2DEJA 1B63A 2EPNA 4X9JA 1H72C 2BA1D 2JP9A 4Z7CA 5T6JA 2NN6E 2CT1A 4MYUA 4DV4I 4F9BB 3HKMA 1HNZI 4JI1I 2YTDA 5LL6R 1J5EE 4N4RB 1XNQI 4JI5I 2EJ4A 2EOOA 5LMUE 2DEIA 1EH6A 2FV4B 2LO3A 1HNXE 2YTJA 4YY3E 4I8OA 1LLMC 2EOYA 2JWOA 2J7KA 1S16A 4LFBE 4FW9A 2UXDI 4DR4I 3CWVA 4JYAE 1I94E 3PYDA 3IWDA 4DPYA 4JV5E
chains in the Genus database with same CATH topology
4KQVA 2F4VI 4DR6I 4DR3E 1ZBQA 1FKAE 4WUDA 2CPNA 1N0UA 4F54A 2V34A 4DV4E 1IBKI 3C4BA 3IWCA 1Z59A 2EZ6A 4JI7I 1ZM4A 3IWBA 5F3WA 4JI4I 4Z7YA 2VQEE 1WUUA 2HK3A 2L2MA 2L8TA 1DARA 4DR2I 2NUGA 1N32I 4HYMA 5L3JA 4OX9I 3J81Q 4DR3I 4GKKE 2F4VE 4LF9E 2IOQA 1SR9A 1BKNA 3QT5A 2RS6A 2JOXA 1N33I 3ZM7A 1XHKA 4F9CB 4X66I 1HNZE 4K0KE 1IBLI 2O1UA 4DU7A 5IT9C 1Z0BA 3P1XA 1YYWA 4M1KA 4DPWA 2LTRA 4DR5E 1HNWE 4DV1I 2Q2EB 4WFTA 2VF3A 4DMIA 5LMUI 4GKJE 1HK7A 3T1YI 4JI5E 2VQEI 4YY3I 1T4NA 2KHXA 1KVKA 4B3SI 3HXLA 1NHIA 2E1RA 2E1MA 1XMOE 2DB2A 4FWDA 1IBMI 2GS8A 4N3OA 5AASA 5LMNE 1PIEA 2HFUA 2LRSA 3RMPA 1MG7A 1FJGE 3J7AG 5GMEA 3GONA 2ZBKB 4DV2I 4BMJA 1ZBTA 2WZOA 2L2KB 2UUAE 3WU3A 4NXNI 2LUQA 1D6TA 1OJ4A 1XMOI 1X48A 4FWGA 1N32E 4R8OA 2NPFA 3J80C 2UXDE 1MU5A 4B3TE 1B62A 3ADGA 4LF6E 1ELOA 3VYYA 2EWLA 4BS9A 3LPSA 3JTZA 4JI0I 4DXLA 4X62I 2V87A 2IHR1 1Z0EA 4IZJB 1NZ0A 3M6AA 2JR1A 1IBME 2JVAA 2X7IA 4L8NA 3ZZ0A 4USMA 3ZKDA 2FTXB 2BM0A 3JAMQ 3K6QA 4DR7I 2FGGA 1U2RA 4TUIA 4JI2I 4DV1E 2K4VA 4LF7I 4DV7E 2LBSB 2YT4A 3ZZTA 4EMDA 1FJGI 1IBKE 4X62E 4DU8A 2HKJA 3KWRA 4X65I 4WYQB 1XMQI 2GQ0A 2MC6A 4JI4E 2AJ4A 4DV7I 2UU9I 3HULA 4PU9A 2Z5EA 4L5NC 4M2ZA 1XMQE 3PYEA 5AE1A 2RS7A 2V2QA 4LF5E 2V86A 4DV5I 1O0WA 4LF7E 3JU0A 4P78A 4RPFA 3PRYA 4HACB 4HXZA 3WU4A 4JI1E 4NXNE 4DPUA 1FWKA 4DV3I 3HPSA 4UTGA 2VQFI 4JI7E 4K0KI 2A2DA 1RQ0A 1GQEA 1H73A 2UUBI 4URLA 1J26A 4B3TI 4R03A 1K47A 3J7AM 1Z5AA 1Z5CA 3Q6MA 4KZSA 3LMLA 2LJPA 4ZVIA 2NA2A 2Z5CA 4IZKB 2UXCE 1N36I 3AUZA 4OOGC 1RREA 2CGEA 1EI1A 4P7DA 4OX9E 4DKKA 2UUCE 4NXMI 2JOBA 2RTXA 3QT7A 4JG4A 4M30A 4DV0E 2V2ZA 4KHPI 2HKEA 3ADIA 2BV3A 1FI4A 4JI3E 3OMLA 1Z0WA 2L92A 4B3MI 4DV0I 3HPZA 4FN5A 4WPYA 2L3CA 2ODRD 2V8PA 1UILA 3B8HA 4MYTA 3ADJA 3H09A 3DF6A 4P7AA 4DUYI 4IZJD 1Z0TA 2B3TB 4LF5I 1YZ9A 2ZM6I 4IZJA 1Z5BA 4JI3I 4WSPA 1KIJA 4I3HA 4XTJA 5ADZA 1Y4SA 1UEKA 4JI8I 4DPXA 3PYGA 4X65E 1YYOA 2UUBE 3OTOE 4WUCA 5FLXQ 2CZ9A 4X8WA 4DUZE 1ZM3A 4DR6E 4GKKI 5FWKA 3HTXA 4GKJI 3QT8A 2LMZA 4P52A 5AE2A 4LF8I 3DJWA 1Z0VA 4B3RI 1J5EI 4YHHI 2LUPB 1X47A 1X49A 2O1VA 2L33A 4M0VA 2BM1A 3C4TA 2Z5BB 4DPTA 1UHZA 3J81C 3LTOA 2IOPA 3B78A 1Z0CA 2VQFE 4DR1I 3K85A 1N0VC 3PYFA 2UXBI 4LF6I 1WHQA 1Z0GA 4DUYE 3V5RA 3ZOQB 1S4EA 1NHJA 2Z5BA 2EFGA 2PNLA 2DSYA 3OTOI 4DR4E 5A2QQ 1N36E 1HR0I 4BCAA 5IWAI 2M7QA 4R1FA 5GMDA 4F9AB 2MDRA 4DV6E 2A2CA 4LF4I 4NXME 3FIGA 2NUEA 1YYKA 2UUCI 3Q1QA 1USUA 1XNRE 2V85A 1EKZA 4B3SE 2ODRC 2HFSA 4YHHE 4DV3E 3ZZUA 4DR7E 1RC7A 2N3GA 2O1TA 4LFBI 2DMYA 2V8QB 2VF1A 2HHHI 4DR5I 1USVA 3VYXA 2R3VA 4BC7A 4JI0E 4B3ME 2XEXA 3J7Yp 2LJHA 2RSMA 5AE3A 2HK2A 3J80Q 1PVGA 1WHNA 2Z5CB 4IZKA 1H74A 1A6FA 3F0NA 4PRXA 1XNQE 4B3RE 1H7SA 2NUFA 2UUAI 2B9DA 2CG9A 4LF4E 1NHHA 2L2NA 3B82A 1XNRI 5DNYA 2E5LE 4AQYI 5BR8E 4HACA 2M4IA 1MX0A 2V2VA 3AV0A 4JI2E 3P06A 2M1SA 3MSWA 5CFFE 1N33E 4BBYA 4LF8E 1Y6ZA 3F6HA 4DR2E 4LFCE 2G7HA 1RR9A 5FLXC 2MC5A 3K17A 4UT4A 4DUZI 5BR8I 4X64I 4KHPE 2ZITA 1QU6A 1FWLA 3HQ1A 1Y4UA 5LMNI 2KOUA 2DIXA 2B7TA 2L3JA 1KTVA 4X66E 5IWAE 2F8BA 3T1YE 4WUBA 4LFCI 4JYAI 2WW4A 1N34I 3QT6A 2PNMA 1WXRA 3WU5A 3ADLA 2V89A 2O1WA 1I94I 1FNMA 2OI2A 2N3HA 4LTYA 1VISA 3LLHA 4JI6I 4DR1E 4DV2E 4DV6I 5A2QC 4JI8E 1DQ3A 1STUA 4TUGA 4USKA 3JAMC 2B7VA 4LU9A 1EA6A 3D4JA 4JV5I 2LE2A 1T4OA 3Q6NA 1ZXNA 1T4LB 2KONA 1PKPA 3T1HI 3F6GA 2UXBE 2LTSA 4LF9I 3LNUA 2V83A 1HNXI 2YZTA 3HJCA 2H36X 4Q28A 2JY9A 3VK6A 1GZ6A 2R42A 1H7UA 4AQYE 4X64E 2E5LI 1KKHA 3V2UC 3K1JA 4BC9A 3H4LA 2UU9E 4LFAE 1HR0E 4ED4A 2VE7C 4JI6E 3T1HE 2ZM6E 4PRVA 1HNWI 2HHHE 4DV5E 2V88A 1QZRA 3WU6A 5IT9Q 1N34E 3ZKBA 4J8ZA 4HY1A 1ZM9A 4FWHA 2L6MA 4GEQB 1ZXMA 1ZM2A 1IBLE 2X36A 1DI2A 4LFAI 2DEJA 1B63A 1H72C 4Z7CA 5T6JA 4MYUA 4DV4I 4F9BB 1HNZI 4JI1I 5LL6R 1J5EE 1XNQI 4JI5I 5LMUE 2DEIA 2FV4B 1HNXE 4YY3E 2J7KA 4I8OA 2UXDI 4FW9A 2JWOA 1S16A 4LFBE 2UXCI 4DR4I 3CWVA 4JYAE 1I94E 3PYDA 3IWDA 4DPYA 4JV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQV A;  2F4V I;  4DR6 I;  4DR3 E;  1FKA E;  4WUD A;  2CPN A;  1N0U A;  2V34 A;  4DV4 E;  1IBK I;  3C4B A;  1Z59 A;  2EZ6 A;  4JI7 I;  1ZM4 A;  4JI4 I;  4Z7Y A;  2VQE E;  1WUU A;  2HK3 A;  2L2M A;  1DAR A;  4DR2 I;  2NUG A;  1N32 I;  4HYM A;  5L3J A;  4OX9 I;  3J81 Q;  4DR3 I;  4GKK E;  2F4V E;  4LF9 E;  1BKN A;  3QT5 A;  2RS6 A;  1N33 I;  3ZM7 A;  1XHK A;  4X66 I;  1HNZ E;  4K0K E;  1IBL I;  4DU7 A;  1Z0B A;  5IT9 C;  3P1X A;  1YYW A;  4M1K A;  4DPW A;  2LTR A;  4DR5 E;  1HNW E;  4DV1 I;  2Q2E B;  4WFT A;  2VF3 A;  5LMU I;  4GKJ E;  3T1Y I;  4JI5 E;  2VQE I;  4YY3 I;  1T4N A;  2KHX A;  1KVK A;  4B3S I;  1NHI A;  2E1R A;  1XMO E;  2DB2 A;  4FWD A;  1IBM I;  2GS8 A;  5LMN E;  1PIE A;  2HFU A;  2LRS A;  1MG7 A;  1FJG E;  5GME A;  3J7A G;  3GON A;  2ZBK B;  4DV2 I;  1ZBT A;  2L2K B;  2UUA E;  3WU3 A;  4NXN I;  2LUQ A;  1D6T A;  1OJ4 A;  1XMO I;  1X48 A;  4FWG A;  1N32 E;  2NPF A;  3J80 C;  2UXD E;  1MU5 A;  4B3T E;  1B62 A;  3ADG A;  4LF6 E;  1ELO A;  3VYY A;  3LPS A;  4JI0 I;  4DXL A;  4X62 I;  2IHR 1;  1Z0E A;  1NZ0 A;  3M6A A;  1IBM E;  2JVA A;  2X7I A;  3ZZ0 A;  4USM A;  3ZKD A;  2BM0 A;  3JAM Q;  4DR7 I;  1U2R A;  4JI2 I;  4DV1 E;  4LF7 I;  4DV7 E;  2LBS B;  2YT4 A;  3ZZT A;  4EMD A;  1FJG I;  1IBK E;  4X62 E;  4DU8 A;  2HKJ A;  4X65 I;  4WYQ B;  1XMQ I;  4JI4 E;  2AJ4 A;  4DV7 I;  2UU9 I;  3HUL A;  4PU9 A;  4M2Z A;  1XMQ E;  3PYE A;  2RS7 A;  2V2Q A;  4LF5 E;  4DV5 I;  1O0W A;  4LF7 E;  4RPF A;  3WU4 A;  4HAC B;  4HXZ A;  4JI1 E;  4NXN E;  4DPU A;  1FWK A;  4DV3 I;  4UTG A;  2VQF I;  4JI7 E;  4K0K I;  2A2D A;  1RQ0 A;  1GQE A;  1H73 A;  2UUB I;  4URL A;  1J26 A;  4B3T I;  1K47 A;  3J7A M;  1Z5A A;  1Z5C A;  2LJP A;  4ZVI A;  2NA2 A;  2UXC E;  1N36 I;  4OOG C;  1RRE A;  1EI1 A;  4OX9 E;  4DKK A;  2UUC E;  4NXM I;  2RTX A;  3QT7 A;  4JG4 A;  4M30 A;  4DV0 E;  2V2Z A;  4KHP I;  2HKE A;  3ADI A;  2BV3 A;  1FI4 A;  4JI3 E;  1Z0W A;  4B3M I;  4DV0 I;  4FN5 A;  2L3C A;  2V8P A;  1UIL A;  3B8H A;  4MYT A;  3ADJ A;  4P7A A;  4DUY I;  1Z0T A;  2B3T B;  4LF5 I;  1YZ9 A;  2ZM6 I;  1Z5B A;  4JI3 I;  1KIJ A;  4I3H A;  4XTJ A;  1UEK A;  4JI8 I;  4DPX A;  3PYG A;  4X65 E;  1YYO A;  2UUB E;  3OTO E;  4WUC A;  5FLX Q;  2CZ9 A;  4X8W A;  4DUZ E;  1ZM3 A;  4DR6 E;  4GKK I;  3HTX A;  4GKJ I;  3QT8 A;  4P52 A;  4LF8 I;  1Z0V A;  4B3R I;  1J5E I;  4YHH I;  2LUP B;  1X47 A;  1X49 A;  2L33 A;  2BM1 A;  3C4T A;  4DPT A;  1UHZ A;  3LTO A;  3J81 C;  3B78 A;  1Z0C A;  2VQF E;  4DR1 I;  1N0V C;  3PYF A;  2UXB I;  4LF6 I;  1WHQ A;  1Z0G A;  4DUY E;  3V5R A;  1S4E A;  1NHJ A;  2EFG A;  3OTO I;  4DR4 E;  5A2Q Q;  1N36 E;  1HR0 I;  5IWA I;  4R1F A;  5GMD A;  4DV6 E;  2MDR A;  2A2C A;  4LF4 I;  4NXM E;  2NUE A;  2UUC I;  1YYK A;  3Q1Q A;  1XNR E;  1EKZ A;  4B3S E;  2HFS A;  4YHH E;  4DV3 E;  3ZZU A;  4DR7 E;  1RC7 A;  2N3G A;  4LFB I;  2DMY A;  2HHH I;  4DR5 I;  3VYX A;  2R3V A;  4JI0 E;  4B3M E;  2XEX A;  3J7Y p;  2LJH A;  2RSM A;  2HK2 A;  3J80 Q;  1PVG A;  1WHN A;  1H74 A;  1A6F A;  3F0N A;  4PRX A;  1XNQ E;  4B3R E;  1H7S A;  2NUF A;  2UUA I;  4LF4 E;  1NHH A;  2L2N A;  3B82 A;  1XNR I;  2E5L E;  4AQY I;  5BR8 E;  4HAC A;  1MX0 A;  2V2V A;  4JI2 E;  5CFF E;  1N33 E;  4LF8 E;  4DR2 E;  4LFC E;  1RR9 A;  5FLX C;  3K17 A;  4UT4 A;  4DUZ I;  5BR8 I;  4X64 I;  4KHP E;  2ZIT A;  1QU6 A;  1FWL A;  5LMN I;  2DIX A;  2B7T A;  2L3J A;  1KTV A;  4X66 E;  5IWA E;  3T1Y E;  4WUB A;  4LFC I;  4JYA I;  2WW4 A;  1N34 I;  3QT6 A;  3WU5 A;  3ADL A;  1I94 I;  1FNM A;  2OI2 A;  2N3H A;  1VIS A;  3LLH A;  4JI6 I;  4DR1 E;  4DV2 E;  4DV6 I;  5A2Q C;  4JI8 E;  1STU A;  4USK A;  3JAM C;  2B7V A;  1EA6 A;  3D4J A;  4JV5 I;  1T4O A;  1ZXN A;  1T4L B;  1PKP A;  3T1H I;  2UXB E;  2LTS A;  4LF9 I;  3LNU A;  1HNX I;  2JY9 A;  2R42 A;  1H7U A;  4AQY E;  4X64 E;  2E5L I;  1KKH A;  3V2U C;  3K1J A;  3H4L A;  2UU9 E;  4LFA E;  1HR0 E;  4ED4 A;  4JI6 E;  3T1H E;  2ZM6 E;  4PRV A;  1HNW I;  2HHH E;  4DV5 E;  1QZR A;  3WU6 A;  5IT9 Q;  1N34 E;  3ZKB A;  4HY1 A;  1ZM9 A;  4FWH A;  1ZXM A;  1ZM2 A;  1IBL E;  2X36 A;  1DI2 A;  4LFA I;  2DEJ A;  1B63 A;  1H72 C;  4Z7C A;  4MYU A;  4DV4 I;  1HNZ I;  4JI1 I;  5LL6 R;  1J5E E;  1XNQ I;  4JI5 I;  5LMU E;  2DEI A;  1HNX E;  4YY3 E;  2J7K A;  2UXD I;  4FW9 A;  1S16 A;  4LFB E;  2UXC I;  4DR4 I;  3CWV A;  4JYA E;  1I94 E;  3PYD A;  4DPY A;  4JV5 E; 
#chains in the Genus database with same CATH topology
 1WJP A;  4KQV A;  4QNK A;  2F4V I;  4OO1 B;  2VES A;  4DR6 I;  1MGT A;  1ZBQ A;  4DR3 E;  1FKA E;  2WBU A;  4BA1 B;  4WUD A;  2CPN A;  1N0U A;  4F54 A;  3M7N D;  2YTP A;  2V34 A;  4DV4 E;  2EOJ A;  2EOH A;  1IBK I;  3EPH A;  3C4B A;  3IWC A;  2EM6 A;  1Z59 A;  2EQ3 A;  2EZ6 A;  4JI7 I;  1PJS A;  1ZM4 A;  3IWB A;  5F3W A;  4JI4 I;  4MLQ A;  4Z7Y A;  2VQE E;  4LCF A;  1WUU A;  2HK3 A;  2L2M A;  2L8T A;  1DAR A;  1UDQ A;  4DR2 I;  2EM7 A;  4O5G A;  2NUG A;  3BGH A;  4HYM A;  5L3J A;  4OX9 I;  3J81 Q;  1N32 I;  2C38 B;  4DR3 I;  2YTF A;  4GKK E;  3CDI A;  2EN2 A;  2LT7 A;  2F4V E;  2HGH A;  4LF9 E;  2IOQ A;  2EN7 A;  2WBT A;  1SR9 A;  5KL6 A;  2EN4 A;  1BKN A;  2JEA B;  3QT5 A;  2BR2 B;  2GPI A;  2RS6 A;  2JOX A;  1N33 I;  1EH8 A;  3ZM7 A;  1XHK A;  2YTN A;  3PS2 A;  2YTI A;  2D9H A;  4F9C B;  4X66 I;  1HNZ E;  4K0K E;  2EPP A;  5K36 B;  1IBL I;  1IQS A;  2O1U A;  2JT2 A;  4DU7 A;  5IT9 C;  1Z0B A;  2DGC A;  3P1X A;  1A1F A;  4WXD A;  1YYW A;  1YSA C;  4M1K A;  4DPW A;  2VRD A;  2LTR A;  4B3R I;  2C39 B;  4FK5 C;  5DNL A;  4DR5 E;  3ECR A;  1HNW E;  2GHF A;  1E3H A;  2Q2E B;  4DV1 I;  4WFT A;  2MKN A;  2JEA A;  2VF3 A;  4BHC A;  4DMI A;  5LMU I;  2YU5 A;  4GKJ E;  1HK7 A;  3T1Y I;  4JI5 E;  2VQE I;  4YY3 I;  1T4N A;  2KHX A;  5KL3 A;  1KVK A;  4B3S I;  3HXL A;  1NHI A;  2E1R A;  2E1M A;  1XMO E;  2DB2 A;  4FWD A;  2EOQ A;  1IBM I;  2GS8 A;  4N3O A;  3TQM A;  5AAS A;  5LMN E;  1ZR9 A;  1PIE A;  2HFU A;  2LRS A;  1BB8 A;  3RMP A;  1P47 A;  1KJK A;  1MG7 A;  1E3P A;  1FJG E;  5C0X C;  2YTG A;  2DRP A;  5JEA F;  3J7A G;  5GME A;  1RMD A;  2EN1 A;  2EL5 A;  3GON A;  4R2P A;  2ELY A;  2ZBK B;  2J65 A;  4DV2 I;  4BMJ A;  1ZBT A;  2WZO A;  2L2K B;  2UUA E;  3WU3 A;  2ADR A;  4NXN I;  2LUQ A;  3P3E A;  2PO0 B;  1D6T A;  1OJ4 A;  4RH8 A;  1XMO I;  4ZYD A;  2GO4 A;  1A1G A;  5EKW A;  1X48 A;  4FWG A;  1N32 E;  1X3C A;  3MHS C;  4R8O A;  2NPF A;  4OKG A;  3J80 C;  2UXD E;  1MU5 A;  4F2J C;  1A1I A;  2YWQ A;  4B3T E;  1XXE A;  1B62 A;  3ADG A;  4LF6 E;  1ELO A;  3VYY A;  2EWL A;  4BS9 A;  3LPS A;  4BHB A;  3JTZ A;  1AH5 A;  4JI0 I;  4DXL A;  4X62 I;  2V87 A;  2IHR 1;  1Z0E A;  1BBG A;  1G2F C;  4IZJ B;  1NZ0 A;  3GME A;  3M6A A;  4WXC A;  2JR1 A;  1IBM E;  1YPN A;  2JVA A;  4L8N A;  2X7I A;  3ZZ0 A;  4USM A;  2ENC A;  3EPK A;  3ZKD A;  2YRM A;  5C0X A;  2FTX B;  2BM0 A;  5DNX A;  3JAM Q;  2LCE A;  5ELW A;  3K6Q A;  4QNJ A;  4DR7 I;  2FGG A;  1U2R A;  4TUI A;  2UUC I;  4NHR A;  4JI2 I;  4R2S A;  4MLV A;  4U3D A;  4DV1 E;  4M9V C;  2K4V A;  4LF7 I;  1ZU1 A;  2EOF A;  4DV7 E;  2LBS B;  2YT4 A;  4LCG A;  3ZZT A;  2EM0 A;  4EMD A;  1FJG I;  1IBK E;  4X62 E;  3H1C A;  4DU8 A;  2GLI A;  3KWR A;  2HKJ A;  4X65 I;  4WYQ B;  1XMQ I;  2GQ0 A;  2MC6 A;  4JI4 E;  2AJ4 A;  4DV7 I;  2UU9 I;  2HC5 A;  3HUL A;  4LPF A;  4PU9 A;  4OO1 C;  2JPA A;  2Z5E A;  4L5N C;  4M2Z A;  3UK3 C;  1XMQ E;  3P76 A;  2EM3 A;  1KYQ A;  3PYE A;  1F2I G;  5AE1 A;  1N3G A;  2EM9 A;  4Q35 B;  5A6B A;  2NN6 F;  2RS7 A;  2O3Z A;  2V2Q A;  2PNZ B;  2EOR A;  4LF5 E;  2V86 A;  5K36 F;  4DV5 I;  1O0W A;  4WX9 A;  3JU0 A;  4LF7 E;  1A1K A;  4P78 A;  4RPF A;  3PRY A;  4HAC B;  2WNR A;  2DLK A;  4HXZ A;  3WU4 A;  2BA0 G;  4JI1 E;  2DLQ A;  4NXN E;  4OO1 A;  4DPU A;  2YRH A;  2R1F A;  2YTO A;  1FWK A;  4DV3 I;  2JE6 B;  2EL4 A;  3GCM A;  3HPS A;  4UTG A;  2VQF I;  4JI7 E;  5JEA B;  4K0K I;  5A6B D;  2A2D A;  1RQ0 A;  1GQE A;  1UN6 B;  4KWY A;  1H73 A;  2Q8U A;  2UUB I;  5A6A A;  4URL A;  1J26 A;  4B3T I;  4R03 A;  1DGC A;  2EM5 A;  1TF6 A;  2EM2 A;  1K47 A;  3J7A M;  4OO1 D;  1Z5A A;  4GZN C;  1Z5C A;  1Y5Y A;  4KZS A;  3Q6M A;  4ISA A;  3LML A;  2BB8 A;  2PO0 A;  2LJP A;  4ZVI A;  2NA2 A;  2JE6 A;  2Z5C A;  4IZK B;  2UXC E;  1N36 I;  4R2A A;  2JYA A;  3M99 B;  3AUZ A;  2EMI A;  4OOG C;  1RRE A;  2CGE A;  1EI1 A;  2EMX A;  2EOM A;  4P7D A;  2EMZ A;  4OX9 E;  2YTE A;  2JXP A;  4DKK A;  2CSH A;  2UUC E;  4NXM I;  2JOB A;  2RTX A;  3QT7 A;  4JG4 A;  5DRQ A;  4IFD C;  5K36 E;  4M30 A;  4DV0 E;  2V2Z A;  4KHP I;  2HKE A;  3ADI A;  2BV3 A;  4FW5 A;  4IFD A;  1X6H A;  1FI4 A;  5JEA E;  4ZYH A;  3M85 G;  4JI3 E;  3OML A;  1Z0W A;  2A25 A;  2L92 A;  4B3M I;  4DV0 I;  3HPZ A;  2MDG A;  1YHC A;  4FN5 A;  4WPY A;  4WSG A;  2L3C A;  2PO2 A;  2ODR D;  5C0X B;  2V8P A;  2EMY A;  1UIL A;  3B8H A;  2M9A A;  3L7Z B;  3ADJ A;  3H09 A;  4MYT A;  1PJQ A;  3DF6 A;  4P7A A;  4DUY I;  5KL5 A;  1Z0T A;  4IZJ D;  2B3T B;  4LF5 I;  3QG5 C;  1YZ9 A;  4IZJ A;  1Z5B A;  2ZM6 I;  4JI3 I;  4WSP A;  2EPO A;  1KIJ A;  4I3H A;  4XTJ A;  5ADZ A;  1Y4S A;  2NN6 D;  3THO B;  2WBS A;  1UEK A;  2C39 A;  1A1H A;  2JEB A;  4GQU A;  4JI8 I;  4DPX A;  3PYG A;  4X65 E;  1YYO A;  2UUB E;  1R6L A;  3OTO E;  4MQY A;  4WUC A;  5FLX Q;  4OO1 E;  1YUI A;  5AC5 A;  2CZ9 A;  3PS1 A;  4X8W A;  4DUZ E;  4F6M A;  1TF3 A;  4DR6 E;  1ZM3 A;  3L7Z A;  4GKK I;  5FWK A;  3HTX A;  4GKJ I;  3QT8 A;  2LMZ A;  1JK1 A;  4P52 A;  2IES A;  5AE2 A;  1IQO A;  4LF8 I;  3DJW A;  1Z0V A;  3KZY A;  2DMI A;  2LJU A;  4R2Q A;  1X6E A;  1RHY A;  2LUP B;  1X47 A;  1UDN A;  4YHH I;  1J5E I;  1X49 A;  2O1V A;  2L33 A;  4M0V A;  2BM1 A;  3C4T A;  4ZYE A;  2Z5B B;  5LLQ A;  4DPT A;  1UHZ A;  2EMF A;  3J81 C;  2BA1 G;  3LTO A;  2IOP A;  1OYS A;  4U3B A;  4R2E A;  4AM3 A;  3B78 A;  1T38 A;  1Z0C A;  2VQF E;  4DR1 I;  4R2R A;  3EPL A;  3EQ1 A;  3MHH C;  3BF2 A;  3BID A;  1N0V C;  3K85 A;  5KL4 A;  3PYF A;  2UXB I;  4LF6 I;  1WHQ A;  4J3D A;  3BBG A;  1Z0G A;  4AID A;  3P3G A;  1WRJ A;  4DUY E;  3V5R A;  3ZOQ B;  1S4E A;  2NN6 C;  1NHJ A;  2Z5B A;  2C37 A;  2EFG A;  3C6K A;  2E72 A;  2PNL A;  2RPC A;  2RQL A;  2J7J A;  2EL6 A;  3U1Y A;  4FW3 A;  4MU4 A;  2DSY A;  4MU1 A;  4DR4 E;  3OTO I;  5A2Q Q;  1N36 E;  5JEA D;  1HR0 I;  1EH7 A;  4BCA A;  3B4T A;  2LVH A;  1UBD C;  5IWA I;  2M7Q A;  4R1F A;  5GMD A;  4F9A B;  2MDR A;  4DV6 E;  2A2C A;  2WCC 3;  4LF4 I;  4NXM E;  3FIG A;  2NUE A;  1YYK A;  1YH8 A;  2RSI A;  4MU0 A;  2EOE A;  5DRP A;  2EPL X;  2EP3 A;  1USU A;  5DRR A;  4AIM A;  3Q1Q A;  1XNR E;  2EMC A;  2V85 A;  5JEA C;  1EKZ A;  1Z1B A;  4B3S E;  2ODR C;  5A6J A;  2HFS A;  5TSE A;  4YHH E;  2BR2 A;  4DV3 E;  3ZZU A;  4DR7 E;  2PNZ A;  1X6F A;  1RC7 A;  2N3G A;  4MDT A;  2O1T A;  4LFB I;  1L4S A;  2DMY A;  1NCS A;  1YFH A;  2V8Q B;  2VF1 A;  2HHH I;  2EOI A;  4DR5 I;  1USV A;  2YSP A;  4NBQ A;  1G2D C;  3VYX A;  2F1D A;  2R3V A;  3THN A;  4BC7 A;  4JI0 E;  2EOZ A;  2EMB A;  2YSO A;  3M7N G;  5C0X D;  2PO2 B;  4B3M E;  2XEX A;  1A1L A;  3J7Y p;  2LJH A;  2RSM A;  5AE3 A;  2HK2 A;  4IFD E;  3J80 Q;  1PVG A;  3CDJ A;  1WHN A;  2Z5C B;  4IZK A;  4IFD B;  3EPJ A;  4OZE A;  1H74 A;  1UDO A;  1A6F A;  2YTQ A;  2IER A;  2EPC A;  2NAB A;  1PDA A;  3F0N A;  1X5W A;  4FW7 A;  2EPZ A;  4PRX A;  3KRN A;  3PS3 A;  1XNQ E;  4B3R E;  1H7S A;  2NUF A;  2EPM X;  2UUA I;  1PJT A;  2B9D A;  2CG9 A;  2LV2 A;  4LOM A;  2ENH A;  2JEB B;  4LF4 E;  1NHH A;  2WP8 A;  5JEA A;  2EPR A;  2L2N A;  4FW6 A;  3B82 A;  2EQ0 A;  5AC4 A;  1MEY C;  3U1K A;  1XNR I;  5DNY A;  1UDS A;  4IFD D;  3L00 A;  1A1J A;  2WP8 B;  4R2C A;  2E5L E;  2EN8 A;  4NZV A;  2CTD A;  4AQY I;  2BBG A;  5BR8 E;  4HAC A;  2M4I A;  1MX0 A;  2V2V A;  3AV0 A;  4HTG A;  2PO1 B;  4BA2 A;  4JI2 E;  3P06 A;  2M1S A;  3MSW A;  3M85 D;  4IJD A;  5CFF E;  4IS9 A;  1N33 E;  4BBY A;  2EMH A;  2GO3 A;  5DRO A;  4LF8 E;  1Y6Z A;  3F6H A;  2CVE A;  4DR2 E;  4LFC E;  2G7H A;  1RR9 A;  5A6K A;  5FLX C;  2MC5 A;  2EOX A;  2R76 A;  3K17 A;  2HJJ A;  4UT4 A;  5KL7 A;  2WNR B;  4DUZ I;  5BR8 I;  4X64 I;  4R2D A;  1OYR A;  4OO1 F;  4KHP E;  2ZIT A;  1QU6 A;  2ELZ A;  1FWL A;  2EMG A;  3HQ1 A;  1Y4U A;  5LMN I;  4LCH A;  2EMW A;  2EM4 A;  2KOU A;  1JK2 A;  2DIX A;  2B7T A;  2L3J A;  1B69 A;  1KTV A;  3DD6 A;  4X66 E;  5IWA E;  2F8B A;  5C0X F;  3T1Y E;  1Y60 A;  4WUB A;  4LFC I;  4JYA I;  2WW4 A;  1N34 I;  2ENA A;  4MU3 A;  3QT6 A;  2EPX A;  2PNM A;  1WXR A;  2EMA A;  5KL2 A;  4O24 A;  2YU8 A;  3WU5 A;  3ADL A;  1QNT A;  2V89 A;  2O1W A;  1I94 I;  5K36 C;  1BBO A;  1FNM A;  2OI2 A;  2N3H A;  1VI7 A;  1SFE A;  4LTY A;  1VIS A;  4RHB B;  3LLH A;  2NN6 B;  4JI6 I;  4DR1 E;  3KZZ A;  4DV2 E;  4DV6 I;  2I9I A;  5A2Q C;  3NZK A;  1OYP A;  4JI8 E;  2NN6 A;  1DQ3 A;  1STU A;  1ZAA C;  5K36 A;  4F6N A;  4TUG A;  4USK A;  2EN3 A;  3JAM C;  3VHT B;  2B7V A;  4LU9 A;  1EA6 A;  1R6M A;  3D4J A;  2C38 A;  2LE2 A;  4JV5 I;  1T4O A;  3Q6N A;  1ZXN A;  5IV8 B;  1T4L B;  2KON A;  3UHM A;  1PKP A;  3T1H I;  3F6G A;  2UXB E;  2LTS A;  2PRT A;  2C37 B;  2V83 A;  3LNU A;  5C0X E;  1HNX I;  2YZT A;  4IS1 C;  4LF9 I;  5K36 D;  3HJC A;  2EE8 A;  2H36 X;  4Q28 A;  2EMK A;  3P3C A;  2EPU A;  2JY9 A;  3VK6 A;  5A69 A;  2UXC I;  1GZ6 A;  2R42 A;  1H7U A;  2YPN A;  2N8X A;  4AQY E;  4X64 E;  2E5L I;  1KKH A;  4O4K A;  1YUJ A;  3K1J A;  3V2U C;  4BC9 A;  1AAY A;  3H4L A;  2UU9 E;  4LFA E;  1HR0 E;  1TN9 A;  1P42 A;  3GLL A;  4ED4 A;  2VE7 C;  1T39 A;  4JI6 E;  3T1H E;  3C6M A;  1IMU A;  5EL9 A;  5IXM B;  4BA1 A;  2ZM6 E;  2I13 A;  4PRV A;  2MKD A;  1HNW I;  2EOS A;  4ZYG A;  1NEI A;  2HHH E;  4DV5 E;  2EM8 A;  2V88 A;  1QZR A;  3WU6 A;  4O43 A;  2EPA A;  2YRK A;  5IT9 Q;  1N34 E;  3ZKB A;  2PO1 A;  2EPK X;  4BA2 B;  2AE8 A;  4J8Z A;  4HY1 A;  1ZM9 A;  2BA0 D;  2EQ1 A;  2L6M A;  4FWH A;  4IFD F;  4GEQ B;  1ZXM A;  1ZM2 A;  1IBL E;  2EN6 A;  2X36 A;  2K7I A;  4HEI A;  1GTK A;  1DI2 A;  2EML A;  4FW4 A;  4LFA I;  2DEJ A;  1B63 A;  2EPN A;  4X9J A;  1H72 C;  2BA1 D;  2JP9 A;  4Z7C A;  5T6J A;  2NN6 E;  2CT1 A;  4MYU A;  4DV4 I;  4F9B B;  3HKM A;  1HNZ I;  4JI1 I;  2YTD A;  5LL6 R;  1J5E E;  4N4R B;  1XNQ I;  4JI5 I;  2EJ4 A;  2EOO A;  5LMU E;  2DEI A;  1EH6 A;  2FV4 B;  2LO3 A;  1HNX E;  2YTJ A;  4YY3 E;  4I8O A;  1LLM C;  2EOY A;  2JWO A;  2J7K A;  1S16 A;  4LFB E;  4FW9 A;  2UXD I;  4DR4 I;  3CWV A;  4JYA E;  1I94 E;  3PYD A;  3IWD A;  4DPY A;  4JV5 E; 
#chains in the Genus database with same CATH homology
 4KQV A;  2F4V I;  4DR6 I;  4DR3 E;  1ZBQ A;  1FKA E;  4WUD A;  2CPN A;  1N0U A;  4F54 A;  2V34 A;  4DV4 E;  1IBK I;  3C4B A;  3IWC A;  1Z59 A;  2EZ6 A;  4JI7 I;  1ZM4 A;  3IWB A;  5F3W A;  4JI4 I;  4Z7Y A;  2VQE E;  1WUU A;  2HK3 A;  2L2M A;  2L8T A;  1DAR A;  4DR2 I;  2NUG A;  1N32 I;  4HYM A;  5L3J A;  4OX9 I;  3J81 Q;  4DR3 I;  4GKK E;  2F4V E;  4LF9 E;  2IOQ A;  1SR9 A;  1BKN A;  3QT5 A;  2RS6 A;  2JOX A;  1N33 I;  3ZM7 A;  1XHK A;  4F9C B;  4X66 I;  1HNZ E;  4K0K E;  1IBL I;  2O1U A;  4DU7 A;  5IT9 C;  1Z0B A;  3P1X A;  1YYW A;  4M1K A;  4DPW A;  2LTR A;  4DR5 E;  1HNW E;  4DV1 I;  2Q2E B;  4WFT A;  2VF3 A;  4DMI A;  5LMU I;  4GKJ E;  1HK7 A;  3T1Y I;  4JI5 E;  2VQE I;  4YY3 I;  1T4N A;  2KHX A;  1KVK A;  4B3S I;  3HXL A;  1NHI A;  2E1R A;  2E1M A;  1XMO E;  2DB2 A;  4FWD A;  1IBM I;  2GS8 A;  4N3O A;  5AAS A;  5LMN E;  1PIE A;  2HFU A;  2LRS A;  3RMP A;  1MG7 A;  1FJG E;  3J7A G;  5GME A;  3GON A;  2ZBK B;  4DV2 I;  4BMJ A;  1ZBT A;  2WZO A;  2L2K B;  2UUA E;  3WU3 A;  4NXN I;  2LUQ A;  1D6T A;  1OJ4 A;  1XMO I;  1X48 A;  4FWG A;  1N32 E;  4R8O A;  2NPF A;  3J80 C;  2UXD E;  1MU5 A;  4B3T E;  1B62 A;  3ADG A;  4LF6 E;  1ELO A;  3VYY A;  2EWL A;  4BS9 A;  3LPS A;  3JTZ A;  4JI0 I;  4DXL A;  4X62 I;  2V87 A;  2IHR 1;  1Z0E A;  4IZJ B;  1NZ0 A;  3M6A A;  2JR1 A;  1IBM E;  2JVA A;  2X7I A;  4L8N A;  3ZZ0 A;  4USM A;  3ZKD A;  2FTX B;  2BM0 A;  3JAM Q;  3K6Q A;  4DR7 I;  2FGG A;  1U2R A;  4TUI A;  4JI2 I;  4DV1 E;  2K4V A;  4LF7 I;  4DV7 E;  2LBS B;  2YT4 A;  3ZZT A;  4EMD A;  1FJG I;  1IBK E;  4X62 E;  4DU8 A;  2HKJ A;  3KWR A;  4X65 I;  4WYQ B;  1XMQ I;  2GQ0 A;  2MC6 A;  4JI4 E;  2AJ4 A;  4DV7 I;  2UU9 I;  3HUL A;  4PU9 A;  2Z5E A;  4L5N C;  4M2Z A;  1XMQ E;  3PYE A;  5AE1 A;  2RS7 A;  2V2Q A;  4LF5 E;  2V86 A;  4DV5 I;  1O0W A;  4LF7 E;  3JU0 A;  4P78 A;  4RPF A;  3PRY A;  4HAC B;  4HXZ A;  3WU4 A;  4JI1 E;  4NXN E;  4DPU A;  1FWK A;  4DV3 I;  3HPS A;  4UTG A;  2VQF I;  4JI7 E;  4K0K I;  2A2D A;  1RQ0 A;  1GQE A;  1H73 A;  2UUB I;  4URL A;  1J26 A;  4B3T I;  4R03 A;  1K47 A;  3J7A M;  1Z5A A;  1Z5C A;  3Q6M A;  4KZS A;  3LML A;  2LJP A;  4ZVI A;  2NA2 A;  2Z5C A;  4IZK B;  2UXC E;  1N36 I;  3AUZ A;  4OOG C;  1RRE A;  2CGE A;  1EI1 A;  4P7D A;  4OX9 E;  4DKK A;  2UUC E;  4NXM I;  2JOB A;  2RTX A;  3QT7 A;  4JG4 A;  4M30 A;  4DV0 E;  2V2Z A;  4KHP I;  2HKE A;  3ADI A;  2BV3 A;  1FI4 A;  4JI3 E;  3OML A;  1Z0W A;  2L92 A;  4B3M I;  4DV0 I;  3HPZ A;  4FN5 A;  4WPY A;  2L3C A;  2ODR D;  2V8P A;  1UIL A;  3B8H A;  4MYT A;  3ADJ A;  3H09 A;  3DF6 A;  4P7A A;  4DUY I;  4IZJ D;  1Z0T A;  2B3T B;  4LF5 I;  1YZ9 A;  2ZM6 I;  4IZJ A;  1Z5B A;  4JI3 I;  4WSP A;  1KIJ A;  4I3H A;  4XTJ A;  5ADZ A;  1Y4S A;  1UEK A;  4JI8 I;  4DPX A;  3PYG A;  4X65 E;  1YYO A;  2UUB E;  3OTO E;  4WUC A;  5FLX Q;  2CZ9 A;  4X8W A;  4DUZ E;  1ZM3 A;  4DR6 E;  4GKK I;  5FWK A;  3HTX A;  4GKJ I;  3QT8 A;  2LMZ A;  4P52 A;  5AE2 A;  4LF8 I;  3DJW A;  1Z0V A;  4B3R I;  1J5E I;  4YHH I;  2LUP B;  1X47 A;  1X49 A;  2O1V A;  2L33 A;  4M0V A;  2BM1 A;  3C4T A;  2Z5B B;  4DPT A;  1UHZ A;  3J81 C;  3LTO A;  2IOP A;  3B78 A;  1Z0C A;  2VQF E;  4DR1 I;  3K85 A;  1N0V C;  3PYF A;  2UXB I;  4LF6 I;  1WHQ A;  1Z0G A;  4DUY E;  3V5R A;  3ZOQ B;  1S4E A;  1NHJ A;  2Z5B A;  2EFG A;  2PNL A;  2DSY A;  3OTO I;  4DR4 E;  5A2Q Q;  1N36 E;  1HR0 I;  4BCA A;  5IWA I;  2M7Q A;  4R1F A;  5GMD A;  4F9A B;  2MDR A;  4DV6 E;  2A2C A;  4LF4 I;  4NXM E;  3FIG A;  2NUE A;  1YYK A;  2UUC I;  3Q1Q A;  1USU A;  1XNR E;  2V85 A;  1EKZ A;  4B3S E;  2ODR C;  2HFS A;  4YHH E;  4DV3 E;  3ZZU A;  4DR7 E;  1RC7 A;  2N3G A;  2O1T A;  4LFB I;  2DMY A;  2V8Q B;  2VF1 A;  2HHH I;  4DR5 I;  1USV A;  3VYX A;  2R3V A;  4BC7 A;  4JI0 E;  4B3M E;  2XEX A;  3J7Y p;  2LJH A;  2RSM A;  5AE3 A;  2HK2 A;  3J80 Q;  1PVG A;  1WHN A;  2Z5C B;  4IZK A;  1H74 A;  1A6F A;  3F0N A;  4PRX A;  1XNQ E;  4B3R E;  1H7S A;  2NUF A;  2UUA I;  2B9D A;  2CG9 A;  4LF4 E;  1NHH A;  2L2N A;  3B82 A;  1XNR I;  5DNY A;  2E5L E;  4AQY I;  5BR8 E;  4HAC A;  2M4I A;  1MX0 A;  2V2V A;  3AV0 A;  4JI2 E;  3P06 A;  2M1S A;  3MSW A;  5CFF E;  1N33 E;  4BBY A;  4LF8 E;  1Y6Z A;  3F6H A;  4DR2 E;  4LFC E;  2G7H A;  1RR9 A;  5FLX C;  2MC5 A;  3K17 A;  4UT4 A;  4DUZ I;  5BR8 I;  4X64 I;  4KHP E;  2ZIT A;  1QU6 A;  1FWL A;  3HQ1 A;  1Y4U A;  5LMN I;  2KOU A;  2DIX A;  2B7T A;  2L3J A;  1KTV A;  4X66 E;  5IWA E;  2F8B A;  3T1Y E;  4WUB A;  4LFC I;  4JYA I;  2WW4 A;  1N34 I;  3QT6 A;  2PNM A;  1WXR A;  3WU5 A;  3ADL A;  2V89 A;  2O1W A;  1I94 I;  1FNM A;  2OI2 A;  2N3H A;  4LTY A;  1VIS A;  3LLH A;  4JI6 I;  4DR1 E;  4DV2 E;  4DV6 I;  5A2Q C;  4JI8 E;  1DQ3 A;  1STU A;  4TUG A;  4USK A;  3JAM C;  2B7V A;  4LU9 A;  1EA6 A;  3D4J A;  4JV5 I;  2LE2 A;  1T4O A;  3Q6N A;  1ZXN A;  1T4L B;  2KON A;  1PKP A;  3T1H I;  3F6G A;  2UXB E;  2LTS A;  4LF9 I;  3LNU A;  2V83 A;  1HNX I;  2YZT A;  3HJC A;  2H36 X;  4Q28 A;  2JY9 A;  3VK6 A;  1GZ6 A;  2R42 A;  1H7U A;  4AQY E;  4X64 E;  2E5L I;  1KKH A;  3V2U C;  3K1J A;  4BC9 A;  3H4L A;  2UU9 E;  4LFA E;  1HR0 E;  4ED4 A;  2VE7 C;  4JI6 E;  3T1H E;  2ZM6 E;  4PRV A;  1HNW I;  2HHH E;  4DV5 E;  2V88 A;  1QZR A;  3WU6 A;  5IT9 Q;  1N34 E;  3ZKB A;  4J8Z A;  4HY1 A;  1ZM9 A;  4FWH A;  2L6M A;  4GEQ B;  1ZXM A;  1ZM2 A;  1IBL E;  2X36 A;  1DI2 A;  4LFA I;  2DEJ A;  1B63 A;  1H72 C;  4Z7C A;  5T6J A;  4MYU A;  4DV4 I;  4F9B B;  1HNZ I;  4JI1 I;  5LL6 R;  1J5E E;  1XNQ I;  4JI5 I;  5LMU E;  2DEI A;  2FV4 B;  1HNX E;  4YY3 E;  2J7K A;  4I8O A;  2UXD I;  4FW9 A;  2JWO A;  1S16 A;  4LFB E;  2UXC I;  4DR4 I;  3CWV A;  4JYA E;  1I94 E;  3PYD A;  3IWD A;  4DPY A;  4JV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...