4B3ME

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3mE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mE02
1ELOA 4JI4I 4B3TE 4JI1E 1N36I 2CZ9A 4LFCE 3J7Yp 1IBLE 4JYAE 2L2KB 3V2UC 1X49A 3LTOA 4B3SE 1UHZA 4X62E 4LF9E 1NHJA 4YY3I 1HR0E 4DPUA 4LF5E 3VYXA 1ZM4A 3ADLA 1WUUA 3T1HE 1HNWE 4NXME 2F4VI 4DV6I 4KHPI 4LF4E 1N34I 1IBMI 1EKZA 4OOGC 4DKKA 4DV0E 3C4TA 3J80C 2HK2A 2N3HA 4DR6I 4P52A 2HFSA 4DXLA 4B3MI 4DR3E 1YYOA 4JV5I 1QZRA 2UXDE 2JY9A 2AJ4A 4HACA 3ZM7A 1BKNA 1PVGA 2VQEE 1KVKA 1X47A 4WUBA 2DB2A 2WW4A 2LBSB 2RTXA 4USKA 4JI3I 2MDRA 4FWDA 4DR2E 2V2QA 3J81C 1Z0CA 5A2QQ 4JI8I 2UUAI 1DI2A 4ED4A 4FWGA 3WU4A 1ZM2A 4UT4A 1H7SA 5LMUI 2NUGA 1XNQE 2NA2A 3WU6A 1YYWA 1Z0WA 2DEJA 3M6AA 1ZM3A 4M1KA 2JVAA 4Z7YA 4OX9I 4JI6I 2DEIA 1N36E 1PKPA 2XEXA 2UU9I 2EZ6A 4UTGA 3WU5A 3ZZUA 1Z5BA 3J7AM 4DPXA 4DR4E 4K0KI 4NXNI 5LMNI 1KTVA 4KQVA 2A2DA 4PRVA 4YY3E 1T4NA 3PYGA 1NHIA 4LF6I 1HNZI 2L2MA 4JI0I 4GKJE 2DMYA 1T4OA 2RSMA 2RS7A 3QT6A 4DV5I 2L2NA 4KHPE 2Q2EB 4P7AA 1RQ0A 1N34E 4JI7I 1KKHA 2ZBKB 4LF8I 5CFFE 1S16A 4XTJA 3P1XA 3B78A 3J7AG 1N0UA 1H73A 4I3HA 4B3ME 4JV5E 3HULA 2E5LI 3F0NA 4RPFA 1GQEA 1A6FA 1X48A 5A2QC 4DR1I 2B7TA 1Z0TA 5IT9C 4B3RI 4URLA 2BV3A 2KHXA 3B8HA 4DU7A 2HKJA 4JI8E 4DPWA 2V8PA 1XMOI 4M2ZA 1UEKA 2RS6A 2UXCE 2UXBI 2A2CA 1O0WA 4EMDA 3PYFA 1XMQI 3ZZ0A 1NZ0A 2HHHE 2VQFI 1WHQA 4X66I 1Z0VA 3GONA 4Z7CA 1NHHA 4DV4E 2UUBI 4AQYE 2LUPB 4OX9E 2HFUA 4JI6E 4JI2I 2N3GA 2BM0A 2IHR1 4HY1A 1ZXMA 2UU9E 4B3TI 3T1YE 3K17A 2HKEA 2R42A 1HNXE 4NXNE 5FLXQ 5LMNE 1J5EI 4FWHA 4JYAI 3JAMC 3OTOI 2L3JA 2DIXA 1U2RA 2V34A 4LF6E 4FN5A 1HNZE 2L3CA 1XHKA 4LF9I 1MX0A 1H72C 1STUA 4LF5I 5BR8I 1Z5CA 4X65E 4LFAE 4DV5E 1UILA 3T1HI 4WYQB 4JI7E 1IBKI 4JI4E 2B7VA 3H4LA 3PYDA 3ZKDA 4LF8E 4DUYI 4DR5I 1FNMA 2LTRA 3LPSA 1Z0EA 2HK3A 4X8WA 4MYTA 3J80Q 2UXDI 2UUCI 4HXZA 3C4BA 2V2VA 1N33I 2VQEI 4LFBI 1MG7A 2R3VA 5GMEA 2LUQA 1I94I 2F4VE 4DV6E 1IBME 1XMQE 2L33A 3J81Q 3V5RA 2VQFE 1Z0BA 3LNUA 4MYUA 1J26A 4DPYA 4DR6E 1H74A 1S4EA 2UUBE 4ZVIA 4PU9A 4YHHI 3QT5A 4DV7I 4WUDA 4JI5I 2LRSA 5IWAI 4JI2E 2GS8A 4HYMA 1K47A 2NPFA 4GKKI 4DU8A 1ZM9A 2E1RA 5FLXC 4DV2I 4JI3E 1N0VC 1YYKA 3QT8A 2ZM6I 2UUAE 4X64I 1B62A 4DV3I 1J5EE 4LF7I 3WU3A 4HACB 4DR4I 3OTOE 5LMUE 4DR7I 1D6TA 4USMA 4WUCA 4DV1I 2LJHA 5BR8E 2VF3A 2X7IA 5LL6R 3HTXA 2YT4A 4GKJI 1FJGI 1B63A 4DUZI 2NUFA 3QT7A 1N32I 1XNRI 1IBKE 1PIEA 2B3TB 4DUYE 4DR5E 1RREA 1KIJA 5L3JA 3LLHA 1EI1A 4JI1I 4K0KE 4LFCI 1IBLI 1RC7A 3Q1QA 2LTSA 1VISA 2UUCE 4B3SI 4M30A 4X62I 1N33E 4JI0E 1HR0I 4LFBE 1MU5A 1EA6A 3ZZTA 1I94E 1RR9A 1FWLA 1YZ9A 1OJ4A 1H7UA 2ZITA 3B82A 3D4JA 1QU6A 1HNWI 5IT9Q 4NXMI 2UXCI 2LJPA 2X36A 4WFTA 1FWKA 2J7KA 4LF4I 3ADGA 1FI4A 2HHHI 1WHNA 2V2ZA 4PRXA 1T4LB 4DV0I 3ADIA 3CWVA 4YHHE 4DPTA 4DV7E 2E5LE 4JI5E 1ZXNA 4DV4I 5IWAE 2CPNA 4AQYI 4DR3I 2NUEA 4GKKE 4DR1E 3K1JA 4DV2E 4B3RE 1Z5AA 4JG4A 2EFGA 1XMOE 2ZM6E 4X64E 3T1YI 3ZKBA 4DV3E 2UXBE 3ADJA 4DR2I 4LF7E 1HNXI 3VYYA 4DR7E 4FW9A 1FKAE 4R1FA 1ZBTA 4X66E 4DV1E 1XNQI 3PYEA 3JAMQ 1FJGE 4DUZE 1N32E 1DARA 2OI2A 1XNRE 4X65I 1Z0GA 4LFAI 2BM1A 1Z59A 5GMDA
chains in the Genus database with same CATH superfamily
4TUIA 1ELOA 2EL5A 4JI4I 4B3TE 2M7QA 5AE2A 2EOOA 4JI1E 2I9IA 1N36I 1SR9A 3THOB 5FWKA 4MU1A 1Z1BA 5F3WA 2CZ9A 2JWOA 2R76A 4LFCE 3J7Yp 4R2AA 2EOIA 2JOBA 5C0XB 1IBLE 4JYAE 2M4IA 1Y4UA 2Z5BA 2L2KB 3V2UC 1X49A 1Y5YA 3LTOA 2RQLA 2H36X 2C38B 4B3SE 1UHZA 1ZAAC 4X62E 4ZYDA 2LMZA 4LF9E 1NHJA 5DRPA 4YY3I 2IOQA 1HR0E 3PS2A 4DPUA 2V87A 2Z5CA 4LF5E 1BBGA 2E1MA 3VYXA 4IFDA 2NN6A 3MSWA 5JEAD 2EQ0A 1ZM4A 3ADLA 1RMDA 1WUUA 2ODRC 4OO1B 3T1HE 3CDJA 1OYSA 4FW3A 1A1JA 2JEAA 1HNWE 2VESA 3L7ZB 4TUGA 4NXME 2M1SA 2J7JA 2F4VI 3KZZA 4DV6I 3HQ1A 1R6LA 3GMEA 4LF4E 4IZJB 4KHPI 1N34I 1IBMI 4FW4A 2V88A 4IZKA 3MHSC 1EKZA 2C37B 3PS1A 4MU0A 1N3GA 4N3OA 4ZYEA 4OOGC 2PO1B 4DKKA 4DV0E 3C4TA 3AUZA 3J80C 2HK2A 2V83A 4BCAA 2N3HA 4DR6I 2YRMA 4IFDC 4P52A 2NN6C 2HFSA 4GEQB 1A1LA 4DXLA 4B3MI 4DR3E 1YYOA 4JV5I 2EM9A 1GTKA 1QZRA 2UXDE 2JY9A 2AJ4A 4HACA 3ZM7A 1EH7A 2Q8UA 3PS3A 1BKNA 1PVGA 5DROA 3Q6NA 2YPNA 2EOHA 2VQEE 1KVKA 1X47A 4F54A 2DB2A 1A1HA 2WW4A 4WUBA 2LBSB 2JYAA 2RTXA 4USKA 4JI3I 3P06A 1WJPA 2MDRA 1A1GA 4FWDA 3J81C 4DR2E 2V2QA 4NBQA 1Z0CA 5A2QQ 4JI8I 5K36D 4OO1A 4AM3A 2EMCA 1OYRA 2UUAI 2HC5A 1DI2A 4ED4A 2RSIA 4FWGA 3WU4A 1ZM2A 2EOEA 4UT4A 1YSAC 1H7SA 5JEAF 2DSYA 2YTNA 2YTPA 3FIGA 2NUGA 5LMUI 1XNQE 2EN7A 4WPYA 1NCSA 2NA2A 3WU6A 1NEIA 2BBGA 4O24A 1YYWA 1Z0WA 5C0XF 1ZR9A 2YTGA 4F2JC 2YTJA 1A1IA 2BA1G 2PNZA 2DEJA 2CVEA 3M6AA 2EN6A 2PO2A 4I8OA 4BA1B 1ZM3A 2LE2A 4M1KA 2JVAA 4Z7YA 4OX9I 2EORA 2LJUA 3MHHC 1VI7A 3F6HA 4JI6I 4F6NA 2EMWA 2DEIA 4R03A 4F9AB 5A6BD 1N36E 4O5GA 1PKPA 2EOMA 5KL4A 2EQ3A 2XEXA 2UU9I 2EN8A 2DMIA 3GCMA 1L4SA 2EZ6A 5KL2A 1PJSA 4UTGA 3WU5A 2JT2A 3DD6A 2WCC3 1BBOA 1Z5BA 3KWRA 2BB8A 3J7AM 4RH8A 1P47A 4DPXA 4DR4E 4K0KI 4NXNI 2EMBA 4Q28A 5LMNI 1X6FA 1KTVA 2BA0G 2YU8A 2ENAA 2CSHA 2A2DA 4KQVA 4PRVA 4ZYGA 5KL3A 2YRKA 4R2PA 4YY3E 1T4NA 1TF3A 2A25A 3PYGA 1ZU1A 5AC4A 1NHIA 2O3ZA 5K36F 2EM8A 2IESA 1E3PA 3IWCA 4LF6I 1HNZI 4QNKA 2L2MA 4JI0I 4R2CA 4GKJE 2JEBB 2PNMA 2DMYA 1G2DC 1T4OA 1E3HA 4LCFA 2RSMA 2EM5A 2GHFA 2K7IA 2DLQA 2RS7A 2YTEA 3QT6A 4DV5I 3HKMA 2L2NA 4KHPE 1T38A 4IFDE 1X3CA 2Q2EB 4P7AA 2EM2A 1RQ0A 1N34E 1ZBQA 2EPLX 2NN6E 1KKHA 2EPXA 4JI7I 4U3BA 4IS9A 3VK6A 2ZBKB 5TSEA 3KRNA 4LF8I 5CFFE 1S16A 5JEAB 2EMAA 4XTJA 2JPAA 3B4TA 1Y60A 2EOSA 2YZTA 3P1XA 3M7NG 3J7AG 2PNLA 3B78A 2ODRD 2C39B 1N0UA 2EMKA 3M7ND 2RPCA 4MLQA 1H73A 1R6MA 4I3HA 1BB8A 4P78A 4B3ME 1UDOA 3L00A 4JV5E 1JK1A 3HULA 2E5LI 3F0NA 1YFHA 4RPFA 2WP8A 2MDGA 3ECRA 4WX9A 2I13A 1GQEA 1A6FA 1X48A 2YTQA 5A2QC 2PRTA 4DR1I 2O1UA 2B7TA 2KONA 5IT9C 1Z0TA 1P42A 4B3RI 4URLA 2BV3A 2KHXA 2V85A 4IFDD 2MKDA 3B8HA 4DU7A 2NN6D 2HKJA 2GLIA 2G7HA 4JI8E 2V8PA 4DPWA 1XMOI 5A6AA 3QG5C 4M2ZA 2M9AA 2RS6A 2UXCE 1UEKA 4LOMA 2UXBI 2WBTA 5AC5A 2JE6A 3EQ1A 2MC5A 2A2CA 3U1YA 1O0WA 4EMDA 4L5NC 3PYFA 1XMQI 3ZZ0A 1SFEA 2EN4A 1WRJA 2LCEA 1NZ0A 2HHHE 3K85A 4OO1E 2V89A 2B9DA 1F2IG 2VQFI 1WHQA 4X66I 1Z0VA 2V8QB 3GONA 4BHBA 4Z7CA 1NHHA 5K36B 2DLKA 5AE1A 2LV2A 1G2FC 2EPZA 2EM4A 4DV4E 2UUBI 4AQYE 1LLMC 5C0XA 2YTFA 2L92A 3HPZA 2LUPB 4OX9E 1T39A 1OYPA 4JI6E 2HFUA 4JI2I 2JR1A 1USVA 2N3GA 2BM0A 2Z5EA 2IHR1 4HY1A 2C38A 1DQ3A 3P3GA 2EL4A 3HXLA 1ZXMA 2UU9E 4B3TI 5KL7A 1HK7A 3T1YE 3K17A 4O43A 2HKEA 1AAYA 1HNXE 4WSPA 2R42A 3TQMA 5KL5A 2D9HA 2WNRB 2ELZA 4F9BB 4NXNE 5FLXQ 5LMNE 3L7ZA 4FWHA 1J5EI 4R2DA 3OMLA 4JYAI 4N4RB 2VF1A 5T6JA 3JAMC 1IQOA 5C0XC 4HEIA 4IZJA 3OTOI 2HJJA 2L3JA 4IFDF 2DIXA 1TF6A 4NZVA 1U2RA 2C37A 2V34A 4LF6E 4J8ZA 4FN5A 1HNZE 2L3CA 1XHKA 4LF9I 5LLQA 1MX0A 2PO1A 3THNA 1H72C 1STUA 4LF5I 2BR2B 5BR8I 2BA1D 1Z5CA 4X65E 4LFAE 1XXEA 5K36A 4DV5E 3VHTB 1UDSA 1UILA 3T1HI 4WYQB 3K6QA 2EMLA 4JI7E 2E72A 3BBGA 3ZZUA 1IBKI 4OO1C 4JI4E 2B7VA 2L6MA 3H4LA 3PYDA 3UK3C 3ZKDA 4LF8E 2IOPA 1A1KA 4GQUA 4DUYI 2LO3A 4DR5I 3F6GA 4X9JA 1MEYC 1FNMA 1MGTA 5A69A 5EL9A 2LT7A 4L8NA 4F6MA 2LTRA 3LPSA 4BC7A 3BGHA 2ELYA 1YUJA 1Z0EA 2HK3A 4BA2B 2EMYA 2EPUA 1PJTA 3EPLA 4LPFA 2EM7A 4KZSA 4M9VC 2YSPA 4X8WA 4P7DA 5A6KA 3P3EA 4FW6A 4LCGA 4MYTA 4OKGA 2BA0D 3J80Q 2GQ0A 2UUCI 4HXZA 2UXDI 1YHCA 3Q6MA 3M99B 2EN2A 3C4BA 2VRDA 2V2VA 2VQEI 1N33I 4MLVA 2EN3A 4LFBI 1MG7A 2R3VA 5GMEA 2LUQA 1I94I 3IWBA 3U1KA 3HJCA 1GZ6A 2F4VE 2Z5BB 1QNTA 1KYQA 2EQ1A 3HPSA 3JU0A 4DV6E 1Y6ZA 1RHYA 4BA1A 1IBME 3C6KA 5AE3A 1XMQE 4LU9A 2L33A 4LCHA 2EM0A 5AASA 3J81Q 3V5RA 2VQFE 5IXMB 2DGCA 2FV4B 2L8TA 1Z0BA 2Z5CB 3LNUA 4IFDB 4MYUA 3DF6A 2NN6B 1IMUA 1J26A 4DPYA 4WXCA 4DR6E 1H74A 1S4EA 2EMXA 2KOUA 2UUBE 5DNYA 4ZVIA 2JEAB 1USUA 4PU9A 4YHHI 3QT5A 4DV7I 4WUDA 4JI5I 2EN1A 2FTXB 4ISAA 2LRSA 5IWAI 5A6JA 4JI2E 2F1DA 4IZKB 4BBYA 2GS8A 2HGHA 3JTZA 4HYMA 1K47A 2NPFA 4GKKI 4DU8A 1ZM9A 5C0XE 2E1RA 5FLXC 2YSOA 2J65A 2YRHA 4DV2I 4JI3E 1N0VC 2EPNA 5KL6A 2O1VA 2EM6A 5GMDA 4MU4A 4WSGA 1YYKA 3QT8A 3H1CA 2UUAE 2JEBA 4X64I 2VE7C 2ZM6I 1WXRA 1B62A 4DV3I 1J5EE 4LF7I 3H09A 3WU3A 4FW5A 4HACB 1UBDC 4DR4I 3OTOE 5LMUE 4DR7I 4R2QA 1D6TA 4USMA 3EPHA 1X6EA 2JP9A 2V86A 2DRPA 2EOJA 2WZOA 5ELWA 2FGGA 4WUCA 4OZEA 5DNLA 4DV1I 2EP3A 4FW7A 2LJHA 5JEAA 5BR8E 2EMIA 5LL6R 2VF3A 2X7IA 2K4VA 2YT4A 3HTXA 2C39A 1B69A 4GKJI 3C6MA 3CDIA 3NZKA 1FJGI 1B63A 4DUZI 2NUFA 4IJDA 3QT7A 1N32I 1XNRI 1IBKE 1PIEA 3ZOQB 2GO4A 5C0XD 5DRQA 2B3TB 2YU5A 4BHCA 4DUYE 4DR5E 5K36E 3EPJA 2EL6A 1RREA 2EPAA 1KIJA 3RMPA 5L3JA 3LLHA 1EI1A 3PRYA 4JI1I 2EWLA 4KWYA 2PNZB 2EOZA 1UDNA 2PO2B 5JEAC 4K0KE 4LFCI 2EMZA 4GZNC 4R8OA 3M85G 1IBLI 4OO1D 1RC7A 3Q1QA 2EOXA 3P76A 2O1WA 2LTSA 3M85D 1VISA 2UUCE 1YH8A 2IERA 2NN6F 4B3SI 4IZJD 4M30A 2WBSA 2YTDA 4X62I 1N33E 2AE8A 4AIMA 3EPKA 2NABA 4JI0E 1HR0I 4LFBE 5ADZA 1MU5A 1EA6A 3ZZTA 1I94E 4FK5C 1FWLA 1RR9A 2WBUA 1YZ9A 1OJ4A 2EJ4A 4LTYA 2MKNA 1H7UA 2ZITA 2GPIA 3B82A 3D4JA 4MDTA 2LVHA 1QU6A 4NHRA 2EPMX 1UN6B 1HNWI 5IT9Q 4O4KA 5IV8B 5DNXA 4NXMI 2UXCI 2N8XA 3IWDA 2LJPA 1PJQA 2X36A 1YPNA 4WFTA 1FWKA 1Y4SA 4R2RA 1IQSA 2J7KA 3P3CA 3ADGA 4LF4I 1FI4A 4MU3A 2JOXA 2EPKX 3DJWA 2HHHI 4R2SA 1WHNA 2EM3A 2V2ZA 2EMFA 4PRXA 2PO0B 1T4LB 4DV0I 2YTOA 3ADIA 3CWVA 1EH6A 4YHHE 4DPTA 4DV7E 2E5LE 1A1FA 1X5WA 4BC9A 4JI5E 1ZXNA 2GO3A 2WNRA 4DV4I 5IWAE 4HTGA 2CPNA 2CG9A 5K36C 4M0VA 2ENHA 4DR3I 2YWQA 4AQYI 4AIDA 2ADRA 2NUEA 4GKKE 2EPOA 4DR1E 1YUIA 5A6BA 3K1JA 4DV2E 2CT1A 4F9CB 4B3RE 1Z5AA 4JG4A 2R1FA 2EFGA 4OO1F 1PDAA 2EOYA 1XMOE 1EH8A 1X6HA 2ZM6E 2EMHA 4ZYHA 4X64E 1DGCA 1TN9A 3ZKBA 2EOQA 3T1YI 2BR2A 4BS9A 4DV3E 2UXBE 3GLLA 3ADJA 4QNJA 3UHMA 4DR2I 4LF7E 1HNXI 4WXDA 2EE8A 4IS1C 2WP8B 4DMIA 2CGEA 3BIDA 3VYYA 4DR7E 4FW9A 1KJKA 1JK2A 5DRRA 1FKAE 2CTDA 2F8BA 4BMJA 4R1FA 1ZBTA 2YTIA 4U3DA 4X66E 4DV1E 2EMGA 1XNQI 3KZYA 2O1TA 4MQYA 2EPCA 4R2EA 3PYEA 5EKWA 2ENCA 3JAMQ 2PO0A 1FJGE 2JXPA 4DUZE 2EPRA 1N32E 2EPPA 1DARA 3AV0A 1XNRE 2JE6B 2OI2A 2EOFA 1Z0GA 4X65I 4LFAI 4BA2A 2BM1A 2MC6A 1Z59A 4RHBB 5JEAE 3LMLA 4Q35B 1AH5A 4J3DA 1UDQA 3BF2A
chains in the Genus database with same CATH topology
4TUIA 1ELOA 4JI4I 4B3TE 2M7QA 5AE2A 4JI1E 1N36I 1SR9A 5FWKA 5F3WA 2CZ9A 2JWOA 4LFCE 3J7Yp 2JOBA 1IBLE 4JYAE 2M4IA 1Y4UA 2Z5BA 2L2KB 3V2UC 1X49A 3LTOA 2H36X 4B3SE 1UHZA 4X62E 2LMZA 4LF9E 1NHJA 4YY3I 2IOQA 1HR0E 4DPUA 2V87A 2Z5CA 4LF5E 2E1MA 3VYXA 3MSWA 1ZM4A 3ADLA 1WUUA 2ODRC 3T1HE 1HNWE 4TUGA 4NXME 2M1SA 2F4VI 4DV6I 3HQ1A 4IZJB 4KHPI 4LF4E 1N34I 1IBMI 2V88A 4IZKA 4N3OA 1EKZA 4OOGC 4DKKA 4DV0E 3C4TA 3AUZA 3J80C 2HK2A 2V83A 4BCAA 2N3HA 4DR6I 4P52A 2HFSA 4GEQB 4DXLA 4B3MI 4DR3E 1YYOA 4JV5I 1QZRA 2UXDE 2JY9A 2AJ4A 4HACA 3ZM7A 1BKNA 1PVGA 3Q6NA 2VQEE 1KVKA 1X47A 4F54A 2DB2A 4WUBA 2WW4A 2LBSB 2RTXA 4USKA 4JI3I 3P06A 2MDRA 4FWDA 3J81C 4DR2E 2V2QA 1Z0CA 5A2QQ 4JI8I 2UUAI 1DI2A 4ED4A 4FWGA 3WU4A 1ZM2A 4UT4A 1H7SA 2DSYA 3FIGA 5LMUI 2NUGA 1XNQE 4WPYA 2NA2A 3WU6A 1YYWA 1Z0WA 2DEJA 3M6AA 4I8OA 1ZM3A 2LE2A 4M1KA 2JVAA 4Z7YA 4OX9I 4JI6I 3F6HA 2DEIA 4R03A 4F9AB 1N36E 1PKPA 2XEXA 2UU9I 2EZ6A 4UTGA 3WU5A 3ZZUA 1Z5BA 3KWRA 3J7AM 4DPXA 4DR4E 4K0KI 4NXNI 4Q28A 5LMNI 1KTVA 4KQVA 2A2DA 4PRVA 4YY3E 1T4NA 3PYGA 1NHIA 3IWCA 4LF6I 1HNZI 2L2MA 4JI0I 4GKJE 2PNMA 2DMYA 1T4OA 2RSMA 2RS7A 3QT6A 4DV5I 2L2NA 4KHPE 2Q2EB 4P7AA 1RQ0A 1N34E 1ZBQA 4JI7I 1KKHA 3VK6A 2ZBKB 4LF8I 5CFFE 1S16A 4XTJA 2YZTA 3P1XA 3J7AG 2PNLA 3B78A 2ODRD 1N0UA 1H73A 4I3HA 4P78A 4B3ME 4JV5E 3HULA 2E5LI 3F0NA 4RPFA 1GQEA 1A6FA 1X48A 5A2QC 4DR1I 2O1UA 2B7TA 2KONA 5IT9C 1Z0TA 4B3RI 4URLA 2BV3A 2KHXA 2V85A 3B8HA 4DU7A 2HKJA 2G7HA 4JI8E 2V8PA 4DPWA 1XMOI 4M2ZA 1UEKA 2RS6A 2UXCE 2UXBI 2MC5A 2A2CA 1O0WA 4EMDA 4L5NC 3PYFA 1XMQI 3ZZ0A 1NZ0A 2HHHE 3K85A 2V89A 2B9DA 2VQFI 1WHQA 4X66I 1Z0VA 2V8QB 3GONA 4Z7CA 1NHHA 5AE1A 4DV4E 2UUBI 4AQYE 2L92A 3HPZA 2LUPB 4OX9E 2HFUA 4JI6E 4JI2I 2JR1A 1USVA 2N3GA 2BM0A 2Z5EA 2IHR1 4HY1A 1DQ3A 3HXLA 1ZXMA 2UU9E 4B3TI 1HK7A 3T1YE 3K17A 2HKEA 2R42A 1HNXE 4WSPA 4F9BB 4NXNE 5FLXQ 5LMNE 1J5EI 4FWHA 3OMLA 4JYAI 5T6JA 2VF1A 3JAMC 4IZJA 3OTOI 2L3JA 2DIXA 1U2RA 2V34A 4LF6E 4J8ZA 4FN5A 1HNZE 2L3CA 1XHKA 4LF9I 1MX0A 1H72C 1STUA 4LF5I 5BR8I 1Z5CA 4X65E 4LFAE 4DV5E 1UILA 3T1HI 4WYQB 3K6QA 4JI7E 1IBKI 4JI4E 2B7VA 2L6MA 3H4LA 3PYDA 3ZKDA 4LF8E 2IOPA 4DUYI 4DR5I 3F6GA 1FNMA 4L8NA 2LTRA 3LPSA 4BC7A 1Z0EA 2HK3A 4KZSA 4X8WA 4MYTA 4P7DA 3J80Q 2GQ0A 2UUCI 4HXZA 2UXDI 3Q6MA 3C4BA 2V2VA 1N33I 2VQEI 4LFBI 1MG7A 2R3VA 5GMEA 2LUQA 1I94I 3IWBA 3HJCA 1GZ6A 2F4VE 2Z5BB 3HPSA 3JU0A 4DV6E 1Y6ZA 1IBME 5AE3A 1XMQE 4LU9A 2L33A 5AASA 3J81Q 3V5RA 2VQFE 2FV4B 2L8TA 1Z0BA 2Z5CB 3LNUA 4MYUA 3DF6A 1J26A 4DPYA 4DR6E 1H74A 1S4EA 2KOUA 2UUBE 5DNYA 4ZVIA 1USUA 4PU9A 4YHHI 3QT5A 4DV7I 4WUDA 4JI5I 2FTXB 2LRSA 5IWAI 4JI2E 4IZKB 4BBYA 2GS8A 3JTZA 4HYMA 1K47A 2NPFA 4GKKI 4DU8A 1ZM9A 2E1RA 5FLXC 4DV2I 4JI3E 1N0VC 2O1VA 1YYKA 3QT8A 2ZM6I 2UUAE 4X64I 2VE7C 1WXRA 1B62A 4DV3I 1J5EE 4LF7I 3H09A 3WU3A 4HACB 4DR4I 3OTOE 5LMUE 4DR7I 1D6TA 4USMA 2V86A 2WZOA 2FGGA 4WUCA 4DV1I 2LJHA 5BR8E 2VF3A 5LL6R 2X7IA 3HTXA 2K4VA 2YT4A 4GKJI 1FJGI 1B63A 4DUZI 2NUFA 3QT7A 1N32I 1XNRI 1IBKE 1PIEA 3ZOQB 2B3TB 4DUYE 4DR5E 1RREA 1KIJA 3RMPA 5L3JA 3LLHA 1EI1A 3PRYA 4JI1I 2EWLA 4K0KE 4LFCI 4R8OA 1IBLI 1RC7A 3Q1QA 2O1WA 2LTSA 1VISA 2UUCE 4B3SI 4IZJD 4M30A 4X62I 1N33E 4JI0E 1HR0I 4LFBE 5ADZA 1MU5A 1EA6A 3ZZTA 1I94E 1RR9A 1FWLA 1YZ9A 1OJ4A 1H7UA 4LTYA 2ZITA 3B82A 3D4JA 1QU6A 1HNWI 5IT9Q 4NXMI 2UXCI 3IWDA 2LJPA 2X36A 4WFTA 1FWKA 1Y4SA 2J7KA 4LF4I 3ADGA 1FI4A 2JOXA 3DJWA 2HHHI 1WHNA 2V2ZA 4PRXA 1T4LB 4DV0I 3ADIA 3CWVA 4YHHE 4DPTA 4DV7E 2E5LE 4BC9A 4JI5E 1ZXNA 4DV4I 5IWAE 2CPNA 2CG9A 4M0VA 4DR3I 4AQYI 2NUEA 4GKKE 4DR1E 3K1JA 4DV2E 4F9CB 4B3RE 1Z5AA 4JG4A 2EFGA 1XMOE 2ZM6E 4X64E 3T1YI 3ZKBA 4BS9A 4DV3E 2UXBE 3ADJA 4DR2I 4LF7E 1HNXI 4DMIA 2CGEA 3VYYA 4DR7E 4FW9A 1FKAE 2F8BA 4BMJA 4R1FA 1ZBTA 4X66E 4DV1E 1XNQI 2O1TA 3PYEA 3JAMQ 1FJGE 4DUZE 1N32E 1DARA 2OI2A 3AV0A 1XNRE 4X65I 1Z0GA 4LFAI 2BM1A 2MC6A 1Z59A 3LMLA 5GMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELO A;  4JI4 I;  4B3T E;  4JI1 E;  1N36 I;  2CZ9 A;  4LFC E;  3J7Y p;  1IBL E;  4JYA E;  2L2K B;  3V2U C;  1X49 A;  3LTO A;  4B3S E;  1UHZ A;  4X62 E;  4LF9 E;  1NHJ A;  4YY3 I;  1HR0 E;  4DPU A;  4LF5 E;  3VYX A;  1ZM4 A;  3ADL A;  1WUU A;  3T1H E;  1HNW E;  4NXM E;  2F4V I;  4DV6 I;  4KHP I;  4LF4 E;  1N34 I;  1IBM I;  1EKZ A;  4OOG C;  4DKK A;  4DV0 E;  3C4T A;  3J80 C;  2HK2 A;  2N3H A;  4DR6 I;  4P52 A;  2HFS A;  4DXL A;  4B3M I;  4DR3 E;  1YYO A;  4JV5 I;  1QZR A;  2UXD E;  2JY9 A;  2AJ4 A;  4HAC A;  3ZM7 A;  1BKN A;  1PVG A;  2VQE E;  1KVK A;  1X47 A;  4WUB A;  2DB2 A;  2WW4 A;  2LBS B;  2RTX A;  4USK A;  4JI3 I;  2MDR A;  4FWD A;  4DR2 E;  2V2Q A;  3J81 C;  1Z0C A;  5A2Q Q;  4JI8 I;  2UUA I;  1DI2 A;  4ED4 A;  4FWG A;  3WU4 A;  1ZM2 A;  4UT4 A;  1H7S A;  5LMU I;  2NUG A;  1XNQ E;  2NA2 A;  3WU6 A;  1YYW A;  1Z0W A;  2DEJ A;  3M6A A;  1ZM3 A;  4M1K A;  2JVA A;  4Z7Y A;  4OX9 I;  4JI6 I;  2DEI A;  1N36 E;  1PKP A;  2XEX A;  2UU9 I;  2EZ6 A;  4UTG A;  3WU5 A;  3ZZU A;  1Z5B A;  3J7A M;  4DPX A;  4DR4 E;  4K0K I;  4NXN I;  5LMN I;  1KTV A;  4KQV A;  2A2D A;  4PRV A;  4YY3 E;  1T4N A;  3PYG A;  1NHI A;  4LF6 I;  1HNZ I;  2L2M A;  4JI0 I;  4GKJ E;  2DMY A;  1T4O A;  2RSM A;  2RS7 A;  3QT6 A;  4DV5 I;  2L2N A;  4KHP E;  2Q2E B;  4P7A A;  1RQ0 A;  1N34 E;  4JI7 I;  1KKH A;  2ZBK B;  4LF8 I;  5CFF E;  1S16 A;  4XTJ A;  3P1X A;  3B78 A;  3J7A G;  1N0U A;  1H73 A;  4I3H A;  4B3M E;  4JV5 E;  3HUL A;  2E5L I;  3F0N A;  4RPF A;  1GQE A;  1A6F A;  1X48 A;  5A2Q C;  4DR1 I;  2B7T A;  1Z0T A;  5IT9 C;  4B3R I;  4URL A;  2BV3 A;  2KHX A;  3B8H A;  4DU7 A;  2HKJ A;  4JI8 E;  4DPW A;  2V8P A;  1XMO I;  4M2Z A;  1UEK A;  2RS6 A;  2UXC E;  2UXB I;  2A2C A;  1O0W A;  4EMD A;  3PYF A;  1XMQ I;  3ZZ0 A;  1NZ0 A;  2HHH E;  2VQF I;  1WHQ A;  4X66 I;  1Z0V A;  3GON A;  4Z7C A;  1NHH A;  4DV4 E;  2UUB I;  4AQY E;  2LUP B;  4OX9 E;  2HFU A;  4JI6 E;  4JI2 I;  2N3G A;  2BM0 A;  2IHR 1;  4HY1 A;  1ZXM A;  2UU9 E;  4B3T I;  3T1Y E;  3K17 A;  2HKE A;  2R42 A;  1HNX E;  4NXN E;  5FLX Q;  5LMN E;  1J5E I;  4FWH A;  4JYA I;  3JAM C;  3OTO I;  2L3J A;  2DIX A;  1U2R A;  2V34 A;  4LF6 E;  4FN5 A;  1HNZ E;  2L3C A;  1XHK A;  4LF9 I;  1MX0 A;  1H72 C;  1STU A;  4LF5 I;  5BR8 I;  1Z5C A;  4X65 E;  4LFA E;  4DV5 E;  1UIL A;  3T1H I;  4WYQ B;  4JI7 E;  1IBK I;  4JI4 E;  2B7V A;  3H4L A;  3PYD A;  3ZKD A;  4LF8 E;  4DUY I;  4DR5 I;  1FNM A;  2LTR A;  3LPS A;  1Z0E A;  2HK3 A;  4X8W A;  4MYT A;  3J80 Q;  2UXD I;  2UUC I;  4HXZ A;  3C4B A;  2V2V A;  1N33 I;  2VQE I;  4LFB I;  1MG7 A;  2R3V A;  5GME A;  2LUQ A;  1I94 I;  2F4V E;  4DV6 E;  1IBM E;  1XMQ E;  2L33 A;  3J81 Q;  3V5R A;  2VQF E;  1Z0B A;  3LNU A;  4MYU A;  1J26 A;  4DPY A;  4DR6 E;  1H74 A;  1S4E A;  2UUB E;  4ZVI A;  4PU9 A;  4YHH I;  3QT5 A;  4DV7 I;  4WUD A;  4JI5 I;  2LRS A;  5IWA I;  4JI2 E;  2GS8 A;  4HYM A;  1K47 A;  2NPF A;  4GKK I;  4DU8 A;  1ZM9 A;  2E1R A;  5FLX C;  4DV2 I;  4JI3 E;  1N0V C;  1YYK A;  3QT8 A;  2ZM6 I;  2UUA E;  4X64 I;  1B62 A;  4DV3 I;  1J5E E;  4LF7 I;  3WU3 A;  4HAC B;  4DR4 I;  3OTO E;  5LMU E;  4DR7 I;  1D6T A;  4USM A;  4WUC A;  4DV1 I;  2LJH A;  5BR8 E;  2VF3 A;  2X7I A;  5LL6 R;  3HTX A;  2YT4 A;  4GKJ I;  1FJG I;  1B63 A;  4DUZ I;  2NUF A;  3QT7 A;  1N32 I;  1XNR I;  1IBK E;  1PIE A;  2B3T B;  4DUY E;  4DR5 E;  1RRE A;  1KIJ A;  5L3J A;  3LLH A;  1EI1 A;  4JI1 I;  4K0K E;  4LFC I;  1IBL I;  1RC7 A;  3Q1Q A;  2LTS A;  1VIS A;  2UUC E;  4B3S I;  4M30 A;  4X62 I;  1N33 E;  4JI0 E;  1HR0 I;  4LFB E;  1MU5 A;  1EA6 A;  3ZZT A;  1I94 E;  1RR9 A;  1FWL A;  1YZ9 A;  1OJ4 A;  1H7U A;  2ZIT A;  3B82 A;  3D4J A;  1QU6 A;  1HNW I;  5IT9 Q;  4NXM I;  2UXC I;  2LJP A;  2X36 A;  4WFT A;  1FWK A;  2J7K A;  4LF4 I;  3ADG A;  1FI4 A;  2HHH I;  1WHN A;  2V2Z A;  4PRX A;  1T4L B;  4DV0 I;  3ADI A;  3CWV A;  4YHH E;  4DPT A;  4DV7 E;  2E5L E;  4JI5 E;  1ZXN A;  4DV4 I;  5IWA E;  2CPN A;  4AQY I;  4DR3 I;  2NUE A;  4GKK E;  4DR1 E;  3K1J A;  4DV2 E;  4B3R E;  1Z5A A;  4JG4 A;  2EFG A;  1XMO E;  2ZM6 E;  4X64 E;  3T1Y I;  3ZKB A;  4DV3 E;  2UXB E;  3ADJ A;  4DR2 I;  4LF7 E;  1HNX I;  3VYY A;  4DR7 E;  4FW9 A;  1FKA E;  4R1F A;  1ZBT A;  4X66 E;  4DV1 E;  1XNQ I;  3PYE A;  3JAM Q;  1FJG E;  4DUZ E;  1N32 E;  1DAR A;  2OI2 A;  1XNR E;  4X65 I;  1Z0G A;  4LFA I;  2BM1 A;  1Z59 A;  5GMD A; 
#chains in the Genus database with same CATH topology
 4TUI A;  1ELO A;  2EL5 A;  4JI4 I;  4B3T E;  2M7Q A;  5AE2 A;  2EOO A;  4JI1 E;  2I9I A;  1N36 I;  1SR9 A;  3THO B;  5FWK A;  4MU1 A;  1Z1B A;  5F3W A;  2CZ9 A;  2JWO A;  2R76 A;  4LFC E;  3J7Y p;  4R2A A;  2EOI A;  2JOB A;  5C0X B;  1IBL E;  4JYA E;  2M4I A;  1Y4U A;  2Z5B A;  2L2K B;  3V2U C;  1X49 A;  1Y5Y A;  3LTO A;  2RQL A;  2H36 X;  2C38 B;  4B3S E;  1UHZ A;  1ZAA C;  4X62 E;  4ZYD A;  2LMZ A;  4LF9 E;  1NHJ A;  5DRP A;  4YY3 I;  2IOQ A;  1HR0 E;  3PS2 A;  4DPU A;  2V87 A;  2Z5C A;  4LF5 E;  1BBG A;  2E1M A;  3VYX A;  4IFD A;  2NN6 A;  3MSW A;  5JEA D;  2EQ0 A;  1ZM4 A;  3ADL A;  1RMD A;  1WUU A;  2ODR C;  4OO1 B;  3T1H E;  3CDJ A;  1OYS A;  4FW3 A;  1A1J A;  2JEA A;  1HNW E;  2VES A;  3L7Z B;  4TUG A;  4NXM E;  2M1S A;  2J7J A;  2F4V I;  3KZZ A;  4DV6 I;  3HQ1 A;  1R6L A;  3GME A;  4LF4 E;  4IZJ B;  4KHP I;  1N34 I;  1IBM I;  4FW4 A;  2V88 A;  4IZK A;  3MHS C;  1EKZ A;  2C37 B;  3PS1 A;  4MU0 A;  1N3G A;  4N3O A;  4ZYE A;  4OOG C;  2PO1 B;  4DKK A;  4DV0 E;  3C4T A;  3AUZ A;  3J80 C;  2HK2 A;  2V83 A;  4BCA A;  2N3H A;  4DR6 I;  2YRM A;  4IFD C;  4P52 A;  2NN6 C;  2HFS A;  4GEQ B;  1A1L A;  4DXL A;  4B3M I;  4DR3 E;  1YYO A;  4JV5 I;  2EM9 A;  1GTK A;  1QZR A;  2UXD E;  2JY9 A;  2AJ4 A;  4HAC A;  3ZM7 A;  1EH7 A;  2Q8U A;  3PS3 A;  1BKN A;  1PVG A;  5DRO A;  3Q6N A;  2YPN A;  2EOH A;  2VQE E;  1KVK A;  1X47 A;  4F54 A;  2DB2 A;  1A1H A;  2WW4 A;  4WUB A;  2LBS B;  2JYA A;  2RTX A;  4USK A;  4JI3 I;  3P06 A;  1WJP A;  2MDR A;  1A1G A;  4FWD A;  3J81 C;  4DR2 E;  2V2Q A;  4NBQ A;  1Z0C A;  5A2Q Q;  4JI8 I;  5K36 D;  4OO1 A;  4AM3 A;  2EMC A;  1OYR A;  2UUA I;  2HC5 A;  1DI2 A;  4ED4 A;  2RSI A;  4FWG A;  3WU4 A;  1ZM2 A;  2EOE A;  4UT4 A;  1YSA C;  1H7S A;  5JEA F;  2DSY A;  2YTN A;  2YTP A;  3FIG A;  2NUG A;  5LMU I;  1XNQ E;  2EN7 A;  4WPY A;  1NCS A;  2NA2 A;  3WU6 A;  1NEI A;  2BBG A;  4O24 A;  1YYW A;  1Z0W A;  5C0X F;  1ZR9 A;  2YTG A;  4F2J C;  2YTJ A;  1A1I A;  2BA1 G;  2PNZ A;  2DEJ A;  2CVE A;  3M6A A;  2EN6 A;  2PO2 A;  4I8O A;  4BA1 B;  1ZM3 A;  2LE2 A;  4M1K A;  2JVA A;  4Z7Y A;  4OX9 I;  2EOR A;  2LJU A;  3MHH C;  1VI7 A;  3F6H A;  4JI6 I;  4F6N A;  2EMW A;  2DEI A;  4R03 A;  4F9A B;  5A6B D;  1N36 E;  4O5G A;  1PKP A;  2EOM A;  5KL4 A;  2EQ3 A;  2XEX A;  2UU9 I;  2EN8 A;  2DMI A;  3GCM A;  1L4S A;  2EZ6 A;  5KL2 A;  1PJS A;  4UTG A;  3WU5 A;  2JT2 A;  3DD6 A;  2WCC 3;  1BBO A;  1Z5B A;  3KWR A;  2BB8 A;  3J7A M;  4RH8 A;  1P47 A;  4DPX A;  4DR4 E;  4K0K I;  4NXN I;  2EMB A;  4Q28 A;  5LMN I;  1X6F A;  1KTV A;  2BA0 G;  2YU8 A;  2ENA A;  2CSH A;  2A2D A;  4KQV A;  4PRV A;  4ZYG A;  5KL3 A;  2YRK A;  4R2P A;  4YY3 E;  1T4N A;  1TF3 A;  2A25 A;  3PYG A;  1ZU1 A;  5AC4 A;  1NHI A;  2O3Z A;  5K36 F;  2EM8 A;  2IES A;  1E3P A;  3IWC A;  4LF6 I;  1HNZ I;  4QNK A;  2L2M A;  4JI0 I;  4R2C A;  4GKJ E;  2JEB B;  2PNM A;  2DMY A;  1G2D C;  1T4O A;  1E3H A;  4LCF A;  2RSM A;  2EM5 A;  2GHF A;  2K7I A;  2DLQ A;  2RS7 A;  2YTE A;  3QT6 A;  4DV5 I;  3HKM A;  2L2N A;  4KHP E;  1T38 A;  4IFD E;  1X3C A;  2Q2E B;  4P7A A;  2EM2 A;  1RQ0 A;  1N34 E;  1ZBQ A;  2EPL X;  2NN6 E;  1KKH A;  2EPX A;  4JI7 I;  4U3B A;  4IS9 A;  3VK6 A;  2ZBK B;  5TSE A;  3KRN A;  4LF8 I;  5CFF E;  1S16 A;  5JEA B;  2EMA A;  4XTJ A;  2JPA A;  3B4T A;  1Y60 A;  2EOS A;  2YZT A;  3P1X A;  3M7N G;  3J7A G;  2PNL A;  3B78 A;  2ODR D;  2C39 B;  1N0U A;  2EMK A;  3M7N D;  2RPC A;  4MLQ A;  1H73 A;  1R6M A;  4I3H A;  1BB8 A;  4P78 A;  4B3M E;  1UDO A;  3L00 A;  4JV5 E;  1JK1 A;  3HUL A;  2E5L I;  3F0N A;  1YFH A;  4RPF A;  2WP8 A;  2MDG A;  3ECR A;  4WX9 A;  2I13 A;  1GQE A;  1A6F A;  1X48 A;  2YTQ A;  5A2Q C;  2PRT A;  4DR1 I;  2O1U A;  2B7T A;  2KON A;  5IT9 C;  1Z0T A;  1P42 A;  4B3R I;  4URL A;  2BV3 A;  2KHX A;  2V85 A;  4IFD D;  2MKD A;  3B8H A;  4DU7 A;  2NN6 D;  2HKJ A;  2GLI A;  2G7H A;  4JI8 E;  2V8P A;  4DPW A;  1XMO I;  5A6A A;  3QG5 C;  4M2Z A;  2M9A A;  2RS6 A;  2UXC E;  1UEK A;  4LOM A;  2UXB I;  2WBT A;  5AC5 A;  2JE6 A;  3EQ1 A;  2MC5 A;  2A2C A;  3U1Y A;  1O0W A;  4EMD A;  4L5N C;  3PYF A;  1XMQ I;  3ZZ0 A;  1SFE A;  2EN4 A;  1WRJ A;  2LCE A;  1NZ0 A;  2HHH E;  3K85 A;  4OO1 E;  2V89 A;  2B9D A;  1F2I G;  2VQF I;  1WHQ A;  4X66 I;  1Z0V A;  2V8Q B;  3GON A;  4BHB A;  4Z7C A;  1NHH A;  5K36 B;  2DLK A;  5AE1 A;  2LV2 A;  1G2F C;  2EPZ A;  2EM4 A;  4DV4 E;  2UUB I;  4AQY E;  1LLM C;  5C0X A;  2YTF A;  2L92 A;  3HPZ A;  2LUP B;  4OX9 E;  1T39 A;  1OYP A;  4JI6 E;  2HFU A;  4JI2 I;  2JR1 A;  1USV A;  2N3G A;  2BM0 A;  2Z5E A;  2IHR 1;  4HY1 A;  2C38 A;  1DQ3 A;  3P3G A;  2EL4 A;  3HXL A;  1ZXM A;  2UU9 E;  4B3T I;  5KL7 A;  1HK7 A;  3T1Y E;  3K17 A;  4O43 A;  2HKE A;  1AAY A;  1HNX E;  4WSP A;  2R42 A;  3TQM A;  5KL5 A;  2D9H A;  2WNR B;  2ELZ A;  4F9B B;  4NXN E;  5FLX Q;  5LMN E;  3L7Z A;  4FWH A;  1J5E I;  4R2D A;  3OML A;  4JYA I;  4N4R B;  2VF1 A;  5T6J A;  3JAM C;  1IQO A;  5C0X C;  4HEI A;  4IZJ A;  3OTO I;  2HJJ A;  2L3J A;  4IFD F;  2DIX A;  1TF6 A;  4NZV A;  1U2R A;  2C37 A;  2V34 A;  4LF6 E;  4J8Z A;  4FN5 A;  1HNZ E;  2L3C A;  1XHK A;  4LF9 I;  5LLQ A;  1MX0 A;  2PO1 A;  3THN A;  1H72 C;  1STU A;  4LF5 I;  2BR2 B;  5BR8 I;  2BA1 D;  1Z5C A;  4X65 E;  4LFA E;  1XXE A;  5K36 A;  4DV5 E;  3VHT B;  1UDS A;  1UIL A;  3T1H I;  4WYQ B;  3K6Q A;  2EML A;  4JI7 E;  2E72 A;  3BBG A;  3ZZU A;  1IBK I;  4OO1 C;  4JI4 E;  2B7V A;  2L6M A;  3H4L A;  3PYD A;  3UK3 C;  3ZKD A;  4LF8 E;  2IOP A;  1A1K A;  4GQU A;  4DUY I;  2LO3 A;  4DR5 I;  3F6G A;  4X9J A;  1MEY C;  1FNM A;  1MGT A;  5A69 A;  5EL9 A;  2LT7 A;  4L8N A;  4F6M A;  2LTR A;  3LPS A;  4BC7 A;  3BGH A;  2ELY A;  1YUJ A;  1Z0E A;  2HK3 A;  4BA2 B;  2EMY A;  2EPU A;  1PJT A;  3EPL A;  4LPF A;  2EM7 A;  4KZS A;  4M9V C;  2YSP A;  4X8W A;  4P7D A;  5A6K A;  3P3E A;  4FW6 A;  4LCG A;  4MYT A;  4OKG A;  2BA0 D;  3J80 Q;  2GQ0 A;  2UUC I;  4HXZ A;  2UXD I;  1YHC A;  3Q6M A;  3M99 B;  2EN2 A;  3C4B A;  2VRD A;  2V2V A;  2VQE I;  1N33 I;  4MLV A;  2EN3 A;  4LFB I;  1MG7 A;  2R3V A;  5GME A;  2LUQ A;  1I94 I;  3IWB A;  3U1K A;  3HJC A;  1GZ6 A;  2F4V E;  2Z5B B;  1QNT A;  1KYQ A;  2EQ1 A;  3HPS A;  3JU0 A;  4DV6 E;  1Y6Z A;  1RHY A;  4BA1 A;  1IBM E;  3C6K A;  5AE3 A;  1XMQ E;  4LU9 A;  2L33 A;  4LCH A;  2EM0 A;  5AAS A;  3J81 Q;  3V5R A;  2VQF E;  5IXM B;  2DGC A;  2FV4 B;  2L8T A;  1Z0B A;  2Z5C B;  3LNU A;  4IFD B;  4MYU A;  3DF6 A;  2NN6 B;  1IMU A;  1J26 A;  4DPY A;  4WXC A;  4DR6 E;  1H74 A;  1S4E A;  2EMX A;  2KOU A;  2UUB E;  5DNY A;  4ZVI A;  2JEA B;  1USU A;  4PU9 A;  4YHH I;  3QT5 A;  4DV7 I;  4WUD A;  4JI5 I;  2EN1 A;  2FTX B;  4ISA A;  2LRS A;  5IWA I;  5A6J A;  4JI2 E;  2F1D A;  4IZK B;  4BBY A;  2GS8 A;  2HGH A;  3JTZ A;  4HYM A;  1K47 A;  2NPF A;  4GKK I;  4DU8 A;  1ZM9 A;  5C0X E;  2E1R A;  5FLX C;  2YSO A;  2J65 A;  2YRH A;  4DV2 I;  4JI3 E;  1N0V C;  2EPN A;  5KL6 A;  2O1V A;  2EM6 A;  5GMD A;  4MU4 A;  4WSG A;  1YYK A;  3QT8 A;  3H1C A;  2UUA E;  2JEB A;  4X64 I;  2VE7 C;  2ZM6 I;  1WXR A;  1B62 A;  4DV3 I;  1J5E E;  4LF7 I;  3H09 A;  3WU3 A;  4FW5 A;  4HAC B;  1UBD C;  4DR4 I;  3OTO E;  5LMU E;  4DR7 I;  4R2Q A;  1D6T A;  4USM A;  3EPH A;  1X6E A;  2JP9 A;  2V86 A;  2DRP A;  2EOJ A;  2WZO A;  5ELW A;  2FGG A;  4WUC A;  4OZE A;  5DNL A;  4DV1 I;  2EP3 A;  4FW7 A;  2LJH A;  5JEA A;  5BR8 E;  2EMI A;  5LL6 R;  2VF3 A;  2X7I A;  2K4V A;  2YT4 A;  3HTX A;  2C39 A;  1B69 A;  4GKJ I;  3C6M A;  3CDI A;  3NZK A;  1FJG I;  1B63 A;  4DUZ I;  2NUF A;  4IJD A;  3QT7 A;  1N32 I;  1XNR I;  1IBK E;  1PIE A;  3ZOQ B;  2GO4 A;  5C0X D;  5DRQ A;  2B3T B;  2YU5 A;  4BHC A;  4DUY E;  4DR5 E;  5K36 E;  3EPJ A;  2EL6 A;  1RRE A;  2EPA A;  1KIJ A;  3RMP A;  5L3J A;  3LLH A;  1EI1 A;  3PRY A;  4JI1 I;  2EWL A;  4KWY A;  2PNZ B;  2EOZ A;  1UDN A;  2PO2 B;  5JEA C;  4K0K E;  4LFC I;  2EMZ A;  4GZN C;  4R8O A;  3M85 G;  1IBL I;  4OO1 D;  1RC7 A;  3Q1Q A;  2EOX A;  3P76 A;  2O1W A;  2LTS A;  3M85 D;  1VIS A;  2UUC E;  1YH8 A;  2IER A;  2NN6 F;  4B3S I;  4IZJ D;  4M30 A;  2WBS A;  2YTD A;  4X62 I;  1N33 E;  2AE8 A;  4AIM A;  3EPK A;  2NAB A;  4JI0 E;  1HR0 I;  4LFB E;  5ADZ A;  1MU5 A;  1EA6 A;  3ZZT A;  1I94 E;  4FK5 C;  1FWL A;  1RR9 A;  2WBU A;  1YZ9 A;  1OJ4 A;  2EJ4 A;  4LTY A;  2MKN A;  1H7U A;  2ZIT A;  2GPI A;  3B82 A;  3D4J A;  4MDT A;  2LVH A;  1QU6 A;  4NHR A;  2EPM X;  1UN6 B;  1HNW I;  5IT9 Q;  4O4K A;  5IV8 B;  5DNX A;  4NXM I;  2UXC I;  2N8X A;  3IWD A;  2LJP A;  1PJQ A;  2X36 A;  1YPN A;  4WFT A;  1FWK A;  1Y4S A;  4R2R A;  1IQS A;  2J7K A;  3P3C A;  3ADG A;  4LF4 I;  1FI4 A;  4MU3 A;  2JOX A;  2EPK X;  3DJW A;  2HHH I;  4R2S A;  1WHN A;  2EM3 A;  2V2Z A;  2EMF A;  4PRX A;  2PO0 B;  1T4L B;  4DV0 I;  2YTO A;  3ADI A;  3CWV A;  1EH6 A;  4YHH E;  4DPT A;  4DV7 E;  2E5L E;  1A1F A;  1X5W A;  4BC9 A;  4JI5 E;  1ZXN A;  2GO3 A;  2WNR A;  4DV4 I;  5IWA E;  4HTG A;  2CPN A;  2CG9 A;  5K36 C;  4M0V A;  2ENH A;  4DR3 I;  2YWQ A;  4AQY I;  4AID A;  2ADR A;  2NUE A;  4GKK E;  2EPO A;  4DR1 E;  1YUI A;  5A6B A;  3K1J A;  4DV2 E;  2CT1 A;  4F9C B;  4B3R E;  1Z5A A;  4JG4 A;  2R1F A;  2EFG A;  4OO1 F;  1PDA A;  2EOY A;  1XMO E;  1EH8 A;  1X6H A;  2ZM6 E;  2EMH A;  4ZYH A;  4X64 E;  1DGC A;  1TN9 A;  3ZKB A;  2EOQ A;  3T1Y I;  2BR2 A;  4BS9 A;  4DV3 E;  2UXB E;  3GLL A;  3ADJ A;  4QNJ A;  3UHM A;  4DR2 I;  4LF7 E;  1HNX I;  4WXD A;  2EE8 A;  4IS1 C;  2WP8 B;  4DMI A;  2CGE A;  3BID A;  3VYY A;  4DR7 E;  4FW9 A;  1KJK A;  1JK2 A;  5DRR A;  1FKA E;  2CTD A;  2F8B A;  4BMJ A;  4R1F A;  1ZBT A;  2YTI A;  4U3D A;  4X66 E;  4DV1 E;  2EMG A;  1XNQ I;  3KZY A;  2O1T A;  4MQY A;  2EPC A;  4R2E A;  3PYE A;  5EKW A;  2ENC A;  3JAM Q;  2PO0 A;  1FJG E;  2JXP A;  4DUZ E;  2EPR A;  1N32 E;  2EPP A;  1DAR A;  3AV0 A;  1XNR E;  2JE6 B;  2OI2 A;  2EOF A;  1Z0G A;  4X65 I;  4LFA I;  4BA2 A;  2BM1 A;  2MC6 A;  1Z59 A;  4RHB B;  5JEA E;  3LML A;  4Q35 B;  1AH5 A;  4J3D A;  1UDQ A;  3BF2 A; 
#chains in the Genus database with same CATH homology
 4TUI A;  1ELO A;  4JI4 I;  4B3T E;  2M7Q A;  5AE2 A;  4JI1 E;  1N36 I;  1SR9 A;  5FWK A;  5F3W A;  2CZ9 A;  2JWO A;  4LFC E;  3J7Y p;  2JOB A;  1IBL E;  4JYA E;  2M4I A;  1Y4U A;  2Z5B A;  2L2K B;  3V2U C;  1X49 A;  3LTO A;  2H36 X;  4B3S E;  1UHZ A;  4X62 E;  2LMZ A;  4LF9 E;  1NHJ A;  4YY3 I;  2IOQ A;  1HR0 E;  4DPU A;  2V87 A;  2Z5C A;  4LF5 E;  2E1M A;  3VYX A;  3MSW A;  1ZM4 A;  3ADL A;  1WUU A;  2ODR C;  3T1H E;  1HNW E;  4TUG A;  4NXM E;  2M1S A;  2F4V I;  4DV6 I;  3HQ1 A;  4IZJ B;  4KHP I;  4LF4 E;  1N34 I;  1IBM I;  2V88 A;  4IZK A;  4N3O A;  1EKZ A;  4OOG C;  4DKK A;  4DV0 E;  3C4T A;  3AUZ A;  3J80 C;  2HK2 A;  2V83 A;  4BCA A;  2N3H A;  4DR6 I;  4P52 A;  2HFS A;  4GEQ B;  4DXL A;  4B3M I;  4DR3 E;  1YYO A;  4JV5 I;  1QZR A;  2UXD E;  2JY9 A;  2AJ4 A;  4HAC A;  3ZM7 A;  1BKN A;  1PVG A;  3Q6N A;  2VQE E;  1KVK A;  1X47 A;  4F54 A;  2DB2 A;  4WUB A;  2WW4 A;  2LBS B;  2RTX A;  4USK A;  4JI3 I;  3P06 A;  2MDR A;  4FWD A;  3J81 C;  4DR2 E;  2V2Q A;  1Z0C A;  5A2Q Q;  4JI8 I;  2UUA I;  1DI2 A;  4ED4 A;  4FWG A;  3WU4 A;  1ZM2 A;  4UT4 A;  1H7S A;  2DSY A;  3FIG A;  5LMU I;  2NUG A;  1XNQ E;  4WPY A;  2NA2 A;  3WU6 A;  1YYW A;  1Z0W A;  2DEJ A;  3M6A A;  4I8O A;  1ZM3 A;  2LE2 A;  4M1K A;  2JVA A;  4Z7Y A;  4OX9 I;  4JI6 I;  3F6H A;  2DEI A;  4R03 A;  4F9A B;  1N36 E;  1PKP A;  2XEX A;  2UU9 I;  2EZ6 A;  4UTG A;  3WU5 A;  3ZZU A;  1Z5B A;  3KWR A;  3J7A M;  4DPX A;  4DR4 E;  4K0K I;  4NXN I;  4Q28 A;  5LMN I;  1KTV A;  4KQV A;  2A2D A;  4PRV A;  4YY3 E;  1T4N A;  3PYG A;  1NHI A;  3IWC A;  4LF6 I;  1HNZ I;  2L2M A;  4JI0 I;  4GKJ E;  2PNM A;  2DMY A;  1T4O A;  2RSM A;  2RS7 A;  3QT6 A;  4DV5 I;  2L2N A;  4KHP E;  2Q2E B;  4P7A A;  1RQ0 A;  1N34 E;  1ZBQ A;  4JI7 I;  1KKH A;  3VK6 A;  2ZBK B;  4LF8 I;  5CFF E;  1S16 A;  4XTJ A;  2YZT A;  3P1X A;  3J7A G;  2PNL A;  3B78 A;  2ODR D;  1N0U A;  1H73 A;  4I3H A;  4P78 A;  4B3M E;  4JV5 E;  3HUL A;  2E5L I;  3F0N A;  4RPF A;  1GQE A;  1A6F A;  1X48 A;  5A2Q C;  4DR1 I;  2O1U A;  2B7T A;  2KON A;  5IT9 C;  1Z0T A;  4B3R I;  4URL A;  2BV3 A;  2KHX A;  2V85 A;  3B8H A;  4DU7 A;  2HKJ A;  2G7H A;  4JI8 E;  2V8P A;  4DPW A;  1XMO I;  4M2Z A;  1UEK A;  2RS6 A;  2UXC E;  2UXB I;  2MC5 A;  2A2C A;  1O0W A;  4EMD A;  4L5N C;  3PYF A;  1XMQ I;  3ZZ0 A;  1NZ0 A;  2HHH E;  3K85 A;  2V89 A;  2B9D A;  2VQF I;  1WHQ A;  4X66 I;  1Z0V A;  2V8Q B;  3GON A;  4Z7C A;  1NHH A;  5AE1 A;  4DV4 E;  2UUB I;  4AQY E;  2L92 A;  3HPZ A;  2LUP B;  4OX9 E;  2HFU A;  4JI6 E;  4JI2 I;  2JR1 A;  1USV A;  2N3G A;  2BM0 A;  2Z5E A;  2IHR 1;  4HY1 A;  1DQ3 A;  3HXL A;  1ZXM A;  2UU9 E;  4B3T I;  1HK7 A;  3T1Y E;  3K17 A;  2HKE A;  2R42 A;  1HNX E;  4WSP A;  4F9B B;  4NXN E;  5FLX Q;  5LMN E;  1J5E I;  4FWH A;  3OML A;  4JYA I;  5T6J A;  2VF1 A;  3JAM C;  4IZJ A;  3OTO I;  2L3J A;  2DIX A;  1U2R A;  2V34 A;  4LF6 E;  4J8Z A;  4FN5 A;  1HNZ E;  2L3C A;  1XHK A;  4LF9 I;  1MX0 A;  1H72 C;  1STU A;  4LF5 I;  5BR8 I;  1Z5C A;  4X65 E;  4LFA E;  4DV5 E;  1UIL A;  3T1H I;  4WYQ B;  3K6Q A;  4JI7 E;  1IBK I;  4JI4 E;  2B7V A;  2L6M A;  3H4L A;  3PYD A;  3ZKD A;  4LF8 E;  2IOP A;  4DUY I;  4DR5 I;  3F6G A;  1FNM A;  4L8N A;  2LTR A;  3LPS A;  4BC7 A;  1Z0E A;  2HK3 A;  4KZS A;  4X8W A;  4MYT A;  4P7D A;  3J80 Q;  2GQ0 A;  2UUC I;  4HXZ A;  2UXD I;  3Q6M A;  3C4B A;  2V2V A;  1N33 I;  2VQE I;  4LFB I;  1MG7 A;  2R3V A;  5GME A;  2LUQ A;  1I94 I;  3IWB A;  3HJC A;  1GZ6 A;  2F4V E;  2Z5B B;  3HPS A;  3JU0 A;  4DV6 E;  1Y6Z A;  1IBM E;  5AE3 A;  1XMQ E;  4LU9 A;  2L33 A;  5AAS A;  3J81 Q;  3V5R A;  2VQF E;  2FV4 B;  2L8T A;  1Z0B A;  2Z5C B;  3LNU A;  4MYU A;  3DF6 A;  1J26 A;  4DPY A;  4DR6 E;  1H74 A;  1S4E A;  2KOU A;  2UUB E;  5DNY A;  4ZVI A;  1USU A;  4PU9 A;  4YHH I;  3QT5 A;  4DV7 I;  4WUD A;  4JI5 I;  2FTX B;  2LRS A;  5IWA I;  4JI2 E;  4IZK B;  4BBY A;  2GS8 A;  3JTZ A;  4HYM A;  1K47 A;  2NPF A;  4GKK I;  4DU8 A;  1ZM9 A;  2E1R A;  5FLX C;  4DV2 I;  4JI3 E;  1N0V C;  2O1V A;  1YYK A;  3QT8 A;  2ZM6 I;  2UUA E;  4X64 I;  2VE7 C;  1WXR A;  1B62 A;  4DV3 I;  1J5E E;  4LF7 I;  3H09 A;  3WU3 A;  4HAC B;  4DR4 I;  3OTO E;  5LMU E;  4DR7 I;  1D6T A;  4USM A;  2V86 A;  2WZO A;  2FGG A;  4WUC A;  4DV1 I;  2LJH A;  5BR8 E;  2VF3 A;  5LL6 R;  2X7I A;  3HTX A;  2K4V A;  2YT4 A;  4GKJ I;  1FJG I;  1B63 A;  4DUZ I;  2NUF A;  3QT7 A;  1N32 I;  1XNR I;  1IBK E;  1PIE A;  3ZOQ B;  2B3T B;  4DUY E;  4DR5 E;  1RRE A;  1KIJ A;  3RMP A;  5L3J A;  3LLH A;  1EI1 A;  3PRY A;  4JI1 I;  2EWL A;  4K0K E;  4LFC I;  4R8O A;  1IBL I;  1RC7 A;  3Q1Q A;  2O1W A;  2LTS A;  1VIS A;  2UUC E;  4B3S I;  4IZJ D;  4M30 A;  4X62 I;  1N33 E;  4JI0 E;  1HR0 I;  4LFB E;  5ADZ A;  1MU5 A;  1EA6 A;  3ZZT A;  1I94 E;  1RR9 A;  1FWL A;  1YZ9 A;  1OJ4 A;  1H7U A;  4LTY A;  2ZIT A;  3B82 A;  3D4J A;  1QU6 A;  1HNW I;  5IT9 Q;  4NXM I;  2UXC I;  3IWD A;  2LJP A;  2X36 A;  4WFT A;  1FWK A;  1Y4S A;  2J7K A;  4LF4 I;  3ADG A;  1FI4 A;  2JOX A;  3DJW A;  2HHH I;  1WHN A;  2V2Z A;  4PRX A;  1T4L B;  4DV0 I;  3ADI A;  3CWV A;  4YHH E;  4DPT A;  4DV7 E;  2E5L E;  4BC9 A;  4JI5 E;  1ZXN A;  4DV4 I;  5IWA E;  2CPN A;  2CG9 A;  4M0V A;  4DR3 I;  4AQY I;  2NUE A;  4GKK E;  4DR1 E;  3K1J A;  4DV2 E;  4F9C B;  4B3R E;  1Z5A A;  4JG4 A;  2EFG A;  1XMO E;  2ZM6 E;  4X64 E;  3T1Y I;  3ZKB A;  4BS9 A;  4DV3 E;  2UXB E;  3ADJ A;  4DR2 I;  4LF7 E;  1HNX I;  4DMI A;  2CGE A;  3VYY A;  4DR7 E;  4FW9 A;  1FKA E;  2F8B A;  4BMJ A;  4R1F A;  1ZBT A;  4X66 E;  4DV1 E;  1XNQ I;  2O1T A;  3PYE A;  3JAM Q;  1FJG E;  4DUZ E;  1N32 E;  1DAR A;  2OI2 A;  3AV0 A;  1XNR E;  4X65 I;  1Z0G A;  4LFA I;  2BM1 A;  2MC6 A;  1Z59 A;  3LML A;  5GMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...