4B3ME

Crystal structure of the 30s ribosome in complex with compound 1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title 4'-O-Substitutions Determine Selectivity of Aminoglycoside Antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4b3mE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4b3mE02
4Z7YA 2A2CA 1KIJA 4GKJE 3T1HE 1T4OA 1S16A 1X49A 4LF9I 1FJGE 3ZZ0A 5BR8E 4WUDA 4DR4I 4K0KE 4DR5E 4JYAE 3P1XA 3ADLA 2V8PA 1IBKE 4LF7E 1GQEA 4JI0I 1I94I 1O0WA 4DR3E 3V2UC 2XEXA 3QT5A 1XNQI 2HFSA 4DV6I 1XMOE 2MDRA 3PYDA 1ZBTA 4DV0E 2V2VA 4DU7A 5A2QC 4B3MI 3J80Q 5LMNI 2LTSA 1MX0A 2V34A 2F4VE 2BM1A 1FKAE 4DPYA 4FW9A 4B3TE 2ZBKB 1Z5AA 4DV5I 1Z5CA 3J81Q 3ADGA 1X48A 2EFGA 4DV3E 1XHKA 4LFAE 3OTOE 4HYMA 2B7TA 4UTGA 1N32E 4USKA 4B3SE 1QU6A 2JVAA 5IT9Q 1HNWE 1DARA 2VQEE 4OX9E 1N34E 2DEIA 4DV2E 4JI6E 2UUBI 1OJ4A 4UT4A 1STUA 4RPFA 4JV5E 4DU8A 1XMQI 4JI2I 3WU6A 3PYEA 1MU5A 4X66I 1ZXMA 1B63A 2HK3A 3JAMQ 1IBMI 5IT9C 1ZM2A 2L3JA 4DPXA 1XNRE 5FLXQ 2LRSA 1A6FA 3ADJA 4FWDA 1DI2A 1RQ0A 2RS7A 1Z0VA 4DPUA 2BM0A 4LF4E 1D6TA 2VF3A 1HR0E 1PIEA 5LMUI 3ZZTA 4GKKE 2NA2A 1ZM9A 4DPTA 1YZ9A 5FLXC 4X65I 2L3CA 4DR2E 2R42A 4LF6I 4NXNI 1K47A 1N33I 4MYTA 4Z7CA 2UXDE 4JI4I 4WUCA 1N36E 2UXCI 2VQFE 4P7AA 1NHIA 3LLHA 4DV7E 2UU9I 4X64E 4LF8I 2DIXA 3J7AM 4DR7I 2HHHI 4FN5A 4LF9E 2R3VA 1HNXI 2J7KA 3B8HA 4I3HA 4JG4A 1PKPA 1T4LB 2LJPA 4EMDA 4LFCE 5A2QQ 1WHQA 4KHPI 2ZM6I 1J26A 4M1KA 3D4JA 1Z0BA 1WUUA 3K1JA 1X47A 4K0KI 4JI0E 1I94E 4JI1E 1YYOA 4WYQB 1YYWA 1IBKI 2ZITA 3C4TA 1H7SA 3PYFA 2E5LE 3H4LA 4DR3I 3QT6A 5LMNE 3J7Yp 4DR1I 4DV1I 2NUEA 3PYGA 2UUAE 3C4BA 4DKKA 1FNMA 1Z0GA 2N3GA 1KKHA 4X62E 4DR6I 2Q2EB 2IHR1 3B78A 4XTJA 2X7IA 2UUCE 4DXLA 1EA6A 2B7VA 4B3TI 1H72C 3B82A 4JI5I 4URLA 2NUGA 2LUPB 3WU4A 2DMYA 2UXBI 1HNZE 4HXZA 2HK2A 1Z0EA 3QT8A 3ZZUA 1H73A 4KQVA 2RSMA 4YHHI 4DV3I 2LUQA 1NZ0A 4PRVA 4DV4E 3OTOI 1ZXNA 1U2RA 1QZRA 2V2ZA 2UUBE 3T1YI 1N32I 3V5RA 4WFTA 1XMQE 2KHXA 1RREA 2LTRA 1T4NA 4JI7E 2V2QA 4PRXA 2VQEI 1N34I 4OX9I 1Z0WA 1IBME 1Z5BA 1Z59A 3Q1QA 4JI3I 5CFFE 2NPFA 3ZKBA 4B3RI 4DPWA 4X8WA 4NXME 2DB2A 1N0VC 3LTOA 4DUYI 3M6AA 1IBLI 4HY1A 5LMUE 1J5EE 1Z0TA 4AQYI 3GONA 4LFBI 1ELOA 4DUZE 4USMA 1ZM3A 4LF4I 4X65E 1HR0I 2OI2A 1KVKA 4YY3E 4LF6E 4GKKI 4JI8E 2L33A 4LF5I 4NXNE 1BKNA 1N33E 5GMDA 1B62A 2E1RA 4WUBA 4FWHA 2CPNA 3ZKDA 2UU9E 5IWAI 4DR2I 2CZ9A 1RC7A 1H74A 4LF8E 2L2MA 1FI4A 1UEKA 2HHHE 4GKJI 1HNXE 3T1HI 2LJHA 1MG7A 2VQFI 4DR4E 3CWVA 1FJGI 4X64I 5BR8I 1PVGA 3F0NA 1UHZA 4KHPE 3HULA 3VYXA 1NHJA 4HACA 1ZM4A 2ZM6E 2BV3A 4M30A 4DR5I 2EZ6A 1XNQE 4LFCI 4JYAI 2HKJA 2DEJA 3ZM7A 1RR9A 1S4EA 4DV6E 3VYYA 5LL6R 4LF7I 4B3ME 2RTXA 3WU5A 5L3JA 2JY9A 1XMOI 4ED4A 3J7AG 4JI1I 4DV0I 4DR1E 4DV1E 3LPSA 4P52A 2F4VI 3K17A 2E5LI 2L2NA 4DV5E 4DR6E 5GMEA 4MYUA 2UUAI 1Z0CA 2B3TB 2RS6A 1YYKA 4OOGC 3LNUA 1KTVA 4X62I 4M2ZA 1EI1A 4JI5E 2UUCI 3ADIA 2UXBE 3J80C 2NUFA 1FWLA 4FWGA 4LFAI 3HTXA 4YHHE 4HACB 1HNZI 2X36A 4B3SI 2L2KB 1HNWI 4JI2E 3T1YE 3QT7A 4DV2I 4X66E 1VISA 1WHNA 4JI6I 2N3HA 2HFUA 4DV4I 4JV5I 4R1FA 3J81C 4JI3E 4PU9A 2A2DA 4B3RE 4JI7I 1XNRI 2HKEA 4DUYE 1IBLE 1FWKA 4NXMI 4AQYE 3WU3A 1UILA 4LFBE 2LBSB 1EKZA 2YT4A 1NHHA 2AJ4A 4JI4E 2GS8A 4ZVIA 1J5EI 4LF5E 2UXCE 3JAMC 4DUZI 4DR7E 1N0UA 5IWAE 1H7UA 2UXDI 4YY3I 4JI8I 2WW4A 1N36I 4DV7I
chains in the Genus database with same CATH superfamily
4L8NA 4Z7YA 2A2CA 2EOEA 4GKJE 2VE7C 1KIJA 4LCHA 4BA1A 3T1HE 1T4OA 2EPMX 3L00A 4DMIA 4TUGA 1S16A 1X49A 2DMIA 2KONA 3BF2A 2L92A 5AE2A 2EN7A 1A1FA 4LF9I 1FJGE 1ZR9A 3ZZ0A 4O4KA 2C39A 5BR8E 5DRPA 3HQ1A 4ZYHA 5LLQA 1SR9A 2Z5EA 4WUDA 2JEAA 1YFHA 2G7HA 4LCFA 4BS9A 4OO1C 4DR4I 3MHHC 1RHYA 4FK5C 2EMBA 4K0KE 1R6MA 2EMIA 4ZYGA 2MDGA 2AE8A 4DR5E 1WXRA 3P1XA 4JYAE 3ADLA 2V8PA 3EPLA 2EOIA 1IBKE 2EOYA 2WP8B 2EPRA 4FW3A 4LF7E 1GQEA 4F54A 3M7NG 2CSHA 4JI0I 1I94I 1O0WA 4R2CA 5KL4A 5K36B 4F9BB 4DR3E 2JPAA 2GO4A 2XEXA 2RSIA 2HFSA 2EMCA 3THNA 1Y60A 1X6HA 2C37A 1T39A 4X9JA 1IQSA 2ODRD 4DV6I 1XMOE 3C6MA 2Q8UA 2BBGA 2MDRA 1KYQA 2ENHA 3PYDA 2JXPA 1ZBTA 5KL7A 4DV0E 2V2VA 2PO2B 5A2QC 4DU7A 4B3MI 3J80Q 4JYAI 2V89A 4MU4A 2LTSA 3EQ1A 1MX0A 2V34A 5LMNI 4IZJB 2EMLA 2KOUA 5C0XA 2F4VE 2BM1A 1FKAE 4DPYA 2Z5BB 1BB8A 2EPAA 4FW9A 2PO0B 2HJJA 2JE6A 4B3TE 2DSYA 2EPNA 2ZBKB 1Z5AA 2YTIA 2C38A 5C0XE 4DV5I 2M9AA 1T38A 2GLIA 1Z5CA 4IZKB 5KL6A 2YU8A 4IJDA 2YRKA 1TF6A 1KJKA 2NN6A 2PNZA 3GMEA 3PRYA 4I8OA 2F8BA 2LMZA 3J81Q 4O5GA 4ISAA 3ADGA 1X48A 2EFGA 4AIMA 1YPNA 1OYRA 2D9HA 4DV3E 1XHKA 2C39B 4LFAE 3PS2A 4NBQA 2CG9A 1A1LA 2M1SA 5K36F 2HC5A 3OTOE 4HYMA 3IWDA 1A1GA 3EPJA 2JEAB 2B7TA 4UTGA 1F2IG 1N32E 2EMHA 1LLMC 4B3SE 1QU6A 1PJSA 1WJPA 2NN6E 2JVAA 4USKA 5IT9Q 4BMJA 2H36X 3HXLA 1HNWE 4F9CB 1B69A 1DARA 4IFDC 2VQEE 4OX9E 1N34E 4TUIA 1X3CA 2DEIA 4DV2E 2EPKX 2I13A 4JI6E 2EM5A 2UUBI 1OJ4A 5JEAF 4UT4A 1STUA 4RPFA 4JV5E 4DU8A 1XMQI 2L8TA 4NZVA 4JI2I 3WU6A 1YSAC 3PYEA 3QG5C 1MU5A 4X66I 1ZXMA 2CVEA 1B63A 3CDJA 2HK3A 3JAMQ 1IBMI 2EMWA 2LT7A 5IT9C 1ZM2A 3HJCA 4MLQA 2YTGA 2EPUA 2L3JA 4DPXA 1XNRE 5FLXQ 2V85A 3M7ND 2LRSA 1A6FA 4R2SA 3ADJA 5DNXA 5C0XB 3RMPA 4GZNC 2BB8A 4FWDA 2R76A 1DI2A 1RQ0A 3CDIA 2RS7A 1Z0VA 4NHRA 4DPUA 2BM0A 4LF4E 1EH6A 4KZSA 1D6TA 2VF3A 5AE1A 2WBSA 1HR0E 1AAYA 4F2JC 1PIEA 2BA0G 5A69A 2ADRA 2EM8A 4GKKE 2JE6B 2NA2A 4J3DA 1X6EA 1ZM9A 2GPIA 1A1IA 2C38B 4DPTA 2PO1A 2YSPA 1YZ9A 2IERA 1P47A 5FLXC 4X65I 2L3CA 4DR2E 5A6JA 5A6BD 2R42A 4FW7A 4LF6I 2IESA 4Q35B 2PNZB 2EJ4A 2NN6B 4NXNI 1YUIA 2EM2A 1Z1BA 1K47A 1N33I 2EP3A 4FW6A 4MYTA 4Z7CA 4R2AA 2UXDE 4JI4I 4WUCA 1N36E 2UXCI 2VQFE 4P7AA 1NHIA 2EOJA 3LLHA 4DV7E 4OZEA 2EM9A 2UU9I 1E3PA 4X64E 2GQ0A 4MU0A 4LF8I 2DIXA 2EM6A 3J7AM 2HHHI 4DR7I 4FN5A 4LF9E 2R3VA 1HNXI 2Z5CA 2J7KA 3B8HA 2PNMA 4I3HA 4JG4A 1PKPA 1T4LB 2LJPA 3Q6NA 2EOOA 4EMDA 4OO1D 4LFCE 5A2QQ 4MQYA 1WHQA 1JK1A 4KHPI 2EPPA 4O43A 2O1WA 3LMLA 2ZM6I 1J26A 2EMAA 4M1KA 2RQLA 3D4JA 1Z0BA 4F6MA 3F6GA 2EN1A 4M9VC 2MC6A 3THOB 1WUUA 3K1JA 1X47A 4K0KI 4JI0E 2EQ3A 1I94E 4MU1A 1Y4UA 4JI1E 1YYOA 4WYQB 4FW4A 1GTKA 1BBGA 2E72A 3EPKA 1YYWA 4QNJA 2YPNA 2BR2A 1N3GA 1MGTA 1IBKI 5K36C 2LJUA 3AV0A 2DRPA 2ZITA 1PJTA 3QT5A 5EL9A 3C4TA 3C6KA 5IV8B 1H7SA 3PYFA 2EOSA 3JTZA 2JOXA 4ZYEA 4MU3A 4KWYA 2E5LE 3H4LA 4DR3I 4AM3A 3QT6A 2MC5A 5LMNE 4BA2A 4RHBB 3J7Yp 2B9DA 5DNLA 4DR1I 3P3GA 1QNTA 2NUEA 3K6QA 3PYGA 4DV1I 1Y4SA 2YTDA 4WSPA 4WX9A 2UUAE 2PO1B 2JEBA 2WBTA 3C4BA 4MDTA 5JEAC 5DROA 1VI7A 4MLVA 4DKKA 1FNMA 1Z0GA 2EL4A 3H09A 2N3GA 2BA0D 4BHCA 1KKHA 4X62E 4DR6I 2Q2EB 5JEAD 2IHR1 2CT1A 5ADZA 2MKNA 2CGEA 2EMZA 3B78A 4XTJA 2X7IA 4BA1B 2UUCE 4DXLA 1EA6A 1UDSA 3UK3C 2B7VA 2JP9A 4B3TI 2FGGA 5A6BA 1H72C 3B82A 2DGCA 2DLKA 2EMGA 4BC7A 5FWKA 4JI5I 3BIDA 4URLA 2NUGA 2LUPB 2Z5CB 5DRRA 3WU4A 3K85A 2DMYA 2UXBI 1HNZE 4HXZA 2HK2A 1Z0EA 2YU5A 1XXEA 3QT8A 3ZZUA 1H73A 3H1CA 2EPCA 1NEIA 4KQVA 4QNKA 4N3OA 2RSMA 4YHHI 3DD6A 4IFDD 4DV3I 1USVA 3HPZA 2J65A 5KL2A 2LUQA 1A1KA 1NZ0A 3ZZTA 4PRVA 2K7IA 4DV4E 2JYAA 3OTOI 1ZXNA 1U2RA 1QZRA 2V2ZA 2YTQA 2UUBE 3T1YI 1N32I 1L4SA 2FV4B 4OO1A 2M7QA 3KZYA 2LE2A 2C37B 1WRJA 4WFTA 4U3BA 3HKMA 3V5RA 1XMQE 1UBDC 4BHBA 2KHXA 1A1HA 2LTRA 1T4NA 4JI7E 1RREA 2V2QA 4PRXA 3U1YA 2VQEI 1N34I 4OX9I 1BBOA 5DNYA 1Z0WA 1IBME 1Z5BA 4N4RB 1Z59A 3GLLA 3Q6MA 4JI3I 2EPZA 1P42A 3Q1QA 2EN2A 2EOMA 5CFFE 2NPFA 2EWLA 3ZKBA 4F6NA 4B3RI 1UDNA 4OO1E 5IXMB 1IQOA 4DPWA 4X8WA 4IS9A 4WXCA 4BA2B 2PNLA 4NXME 2DB2A 2MKDA 4DR5I 1N0VC 3PS3A 2WZOA 3KWRA 3LTOA 4DUYI 3M6AA 1IBLI 5C0XC 2EPXA 2EOZA 3ECRA 3EPHA 4HY1A 5K36A 5LMUE 1ZBQA 4P7DA 1J5EE 1Z0TA 2YTFA 4WPYA 4AQYI 3GONA 4LFBI 1ELOA 5AASA 3FIGA 2LV2A 2J7JA 1UDOA 4DUZE 4USMA 1ZM3A 4LF4I 2V86A 4R2PA 2EPOA 4X65E 1HR0I 2OI2A 1KVKA 1TF3A 4YY3E 4LF6E 2EM3A 4JI8E 4FW5A 4GKKI 2L33A 4LF5I 4IZJA 5K36E 4NXNE 1YHCA 3B4TA 1BKNA 1N33E 5GMDA 2JR1A 1ZAAC 3NZKA 5JEAA 1B62A 2E1RA 2NN6C 4Q28A 4WUBA 2EN4A 1X5WA 4FWHA 2CPNA 2JOBA 2EMYA 2I9IA 2UU9E 2O3ZA 2GHFA 3ZKDA 5IWAI 4DR2I 2CZ9A 2EMFA 2EOHA 3L7ZA 2EMXA 1RC7A 1H74A 4LF8E 2L2MA 4LOMA 1FI4A 2WNRA 2EM4A 2HHHE 1UEKA 4GKJI 1HNXE 3P3CA 3PS1A 5AC5A 1YH8A 3T1HI 2LJHA 1MG7A 5KL3A 5C0XF 5JEAE 1USUA 2BA1D 2VQFI 3KRNA 4DR4E 3CWVA 1FJGI 4BCAA 4X64I 5BR8I 2EM0A 1PVGA 3F0NA 2V8QB 1UHZA 5AE3A 4LPFA 4OO1B 4KHPE 2EQ1A 5F3WA 2A25A 3HULA 4IFDA 3VYXA 1NHJA 4HACA 3BBGA 1ZM4A 2ZM6E 4GQUA 2YTOA 5LMUI 2O1VA 2BV3A 2RPCA 4M30A 2PRTA 3JU0A 2EOQA 2EL6A 3AUZA 3HPSA 1XNQE 2EZ6A 2DEJA 2HKJA 4LFCI 2WBUA 3ZM7A 1XNQI 1RR9A 2NN6F 1S4EA 4DV6E 5ELWA 5LL6R 3VYYA 3M85G 1UDQA 2HGHA 2DLQA 4LF7I 4IFDE 4R2DA 1OYPA 4AIDA 5K36D 2M4IA 4B3ME 3VK6A 5T6JA 1R6LA 2RTXA 4LTYA 3WU5A 5L3JA 2EN3A 1MEYC 2JY9A 2FTXB 2VESA 2ODRC 1XMOI 2YWQA 1Y6ZA 4ED4A 3J7AG 4JI1I 3IWBA 1YUJA 4DV0I 4DR1E 4DV1E 3LPSA 4P52A 3GCMA 1DGCA 4GEQB 4IZJD 4LU9A 1G2DC 3P3EA 1G2FC 4OKGA 4U3DA 1EH7A 2F4VI 1A1JA 2R1FA 3K17A 2E5LI 2L2NA 2YTPA 2VRDA 1HK7A 2O1TA 1JK2A 2EN8A 4DV5E 4DR6E 2YRMA 5GMEA 3OMLA 4MYUA 2UUAI 1X6FA 2EE8A 5JEAB 1Z0CA 4OO1F 2B3TB 2RS6A 1YYKA 5A6KA 2GO3A 2BA1G 4M0VA 3ZOQB 4OOGC 3L7ZB 1KTVA 3LNUA 4X62I 4M2ZA 1EI1A 2WNRB 4JI5E 4BBYA 3TQMA 1PDAA 4RH8A 2EQ0A 2UUCI 3U1KA 3ADIA 2V87A 2UXBE 2V88A 3J80C 2NUFA 4HTGA 4J8ZA 2O1UA 2LO3A 2YRHA 1FWLA 1RMDA 4FWGA 2EOFA 4LFAI 2ENCA 5AC4A 1GZ6A 3HTXA 4WSGA 4YHHE 3V2UC 5DRQA 4WXDA 3UHMA 4IFDB 2K4VA 2EN6A 3DJWA 4HACB 1HNZI 2X36A 3KZZA 4B3SI 2L2KB 2YZTA 4R2QA 1HNWI 4F9AB 2V83A 5KL5A 4JI2E 4R8OA 3T1YE 1Y5YA 2CTDA 2LCEA 3VHTB 1IMUA 3QT7A 4DV2I 4X66E 2BR2B 1VISA 1WHNA 2YSOA 4JI6I 2IOPA 2N3HA 3BGHA 3M99B 4R03A 2ELZA 2HFUA 2EORA 4LCGA 3MHSC 4ZYDA 4DV4I 1PJQA 4JV5I 4HEIA 3J81C 1TN9A 4R1FA 4P78A 5TSEA 4JI3E 2EPLX 2F1DA 4PU9A 2A2DA 2E1MA 3F6HA 2ENAA 4B3RE 2WP8A 5EKWA 4JI7I 3M85D 2JEBB 4R2RA 1EH8A 1XNRI 1UN6B 2HKEA 1NCSA 5C0XD 4DUYE 1IBLE 1AH5A 5A6AA 1FWKA 2WCC3 2EM7A 2LVHA 2NABA 3P76A 1OYSA 4IS1C 4BC9A 4NXMI 2YTNA 3IWCA 4AQYE 3WU3A 1UILA 4LFBE 2PO2A 3DF6A 2LBSB 2IOQA 2VF1A 4R2EA 1EKZA 2ELYA 1E3HA 1ZU1A 4IFDF 2YT4A 1NHHA 2YTJA 2AJ4A 4JI4E 2GS8A 4ZVIA 1J5EI 2JWOA 2Z5BA 4LF5E 2UXCE 2EMKA 3JAMC 1SFEA 2PO0A 2YTEA 2NN6D 4O24A 3MSWA 4L5NC 4DUZI 1DQ3A 2JT2A 4DR7E 1N0UA 5IWAE 1H7UA 2UXDI 4YY3I 4JI8I 2EOXA 2N8XA 2WW4A 1N36I 2L6MA 2EL5A 3P06A 4IZKA 4DV7I
chains in the Genus database with same CATH topology
4L8NA 4Z7YA 2A2CA 1KIJA 4GKJE 2VE7C 3T1HE 1T4OA 4DMIA 4TUGA 1S16A 1X49A 2KONA 5AE2A 2L92A 4LF9I 1FJGE 3ZZ0A 5BR8E 3HQ1A 4WUDA 1SR9A 2Z5EA 2G7HA 4BS9A 4DR4I 4K0KE 4DR5E 1WXRA 3P1XA 4JYAE 3ADLA 2V8PA 1IBKE 4LF7E 1GQEA 4F54A 4JI0I 1I94I 1O0WA 4F9BB 4DR3E 2XEXA 3QT5A 3V2UC 1XNQI 2HFSA 2ODRD 4DV6I 1XMOE 2MDRA 3PYDA 1ZBTA 4DV0E 2V2VA 5A2QC 4DU7A 4B3MI 3J80Q 2V89A 5LMNI 2LTSA 1MX0A 2V34A 4IZJB 2KOUA 2F4VE 2BM1A 1FKAE 4DPYA 2Z5BB 4FW9A 4B3TE 2DSYA 2ZBKB 1Z5AA 4DV5I 1Z5CA 4IZKB 3PRYA 4I8OA 2F8BA 2LMZA 3J81Q 3ADGA 1X48A 2EFGA 4DV3E 1XHKA 4LFAE 2CG9A 2M1SA 3OTOE 4HYMA 3IWDA 2B7TA 4UTGA 1N32E 4USKA 4B3SE 1QU6A 2JVAA 5IT9Q 4BMJA 2H36X 3HXLA 1HNWE 4F9CB 1DARA 2VQEE 4OX9E 1N34E 4TUIA 2DEIA 4DV2E 4JI6E 2UUBI 1OJ4A 4UT4A 1STUA 4RPFA 4JV5E 4DU8A 1XMQI 2L8TA 4JI2I 3WU6A 3PYEA 1MU5A 4X66I 1ZXMA 1B63A 2HK3A 3JAMQ 1IBMI 5IT9C 1ZM2A 3HJCA 2L3JA 4DPXA 1XNRE 5FLXQ 2V85A 2LRSA 1A6FA 3ADJA 3RMPA 4FWDA 1DI2A 1RQ0A 2RS7A 1Z0VA 4DPUA 2BM0A 4LF4E 4KZSA 1D6TA 2VF3A 5AE1A 1HR0E 1PIEA 5LMUI 3ZZTA 4GKKE 2NA2A 1ZM9A 4DPTA 1YZ9A 5FLXC 4X65I 2L3CA 4DR2E 2R42A 4LF6I 4NXNI 1K47A 1N33I 4MYTA 4Z7CA 2UXDE 4JI4I 4WUCA 1N36E 2UXCI 2VQFE 4P7AA 1NHIA 3LLHA 4DV7E 2UU9I 4X64E 2GQ0A 4LF8I 2DIXA 3J7AM 4DR7I 2HHHI 4FN5A 4LF9E 2R3VA 1HNXI 2Z5CA 2J7KA 3B8HA 2PNMA 4I3HA 4JG4A 1PKPA 1T4LB 2LJPA 3Q6NA 4EMDA 4LFCE 5A2QQ 1WHQA 4KHPI 2O1WA 3LMLA 2ZM6I 1J26A 4M1KA 3D4JA 1Z0BA 3F6GA 1WUUA 2MC6A 3K1JA 1X47A 4K0KI 4JI0E 1I94E 1Y4UA 4JI1E 1YYOA 4WYQB 1YYWA 1IBKI 3AV0A 2ZITA 3C4TA 1H7SA 3PYFA 3JTZA 2JOXA 2E5LE 3H4LA 4DR3I 3QT6A 2MC5A 5LMNE 3J7Yp 2B9DA 4DR1I 4DV1I 2NUEA 3K6QA 3PYGA 1Y4SA 4WSPA 2UUAE 3C4BA 4DKKA 1FNMA 1Z0GA 3H09A 2N3GA 1KKHA 4X62E 4DR6I 2Q2EB 2IHR1 5ADZA 2CGEA 3B78A 4XTJA 2X7IA 2UUCE 4DXLA 1EA6A 2B7VA 4B3TI 2FGGA 1H72C 3B82A 4BC7A 5FWKA 4JI5I 4URLA 2NUGA 2LUPB 2Z5CB 3WU4A 3K85A 2DMYA 2UXBI 1HNZE 4HXZA 2HK2A 1Z0EA 3QT8A 3ZZUA 1H73A 4KQVA 4N3OA 2RSMA 4YHHI 4DV3I 1USVA 3HPZA 2LUQA 1NZ0A 4PRVA 4DV4E 3OTOI 1ZXNA 1U2RA 1QZRA 2V2ZA 2UUBE 3T1YI 1N32I 2FV4B 2M7QA 2LE2A 3V5RA 4WFTA 1XMQE 2KHXA 1RREA 2LTRA 1T4NA 4JI7E 2V2QA 4PRXA 2VQEI 1N34I 4OX9I 1Z0WA 5DNYA 1IBME 1Z5BA 1Z59A 3Q1QA 3Q6MA 4JI3I 5CFFE 2NPFA 2EWLA 3ZKBA 4B3RI 4DPWA 4X8WA 2PNLA 4NXME 2DB2A 1N0VC 2WZOA 3KWRA 3LTOA 4DUYI 3M6AA 1IBLI 4HY1A 5LMUE 1ZBQA 4P7DA 1J5EE 1Z0TA 4WPYA 4AQYI 3GONA 4LFBI 1ELOA 5AASA 3FIGA 4DUZE 4USMA 1ZM3A 4LF4I 2V86A 4X65E 1HR0I 2OI2A 1KVKA 4YY3E 4LF6E 4GKKI 4JI8E 2L33A 4LF5I 4IZJA 4NXNE 1BKNA 1N33E 5GMDA 2JR1A 1B62A 2E1RA 4WUBA 4Q28A 4FWHA 2CPNA 2JOBA 3ZKDA 2UU9E 5IWAI 4DR2I 2CZ9A 1RC7A 1H74A 4LF8E 2L2MA 1FI4A 1UEKA 2HHHE 4GKJI 1HNXE 3T1HI 2LJHA 1MG7A 2VQFI 1USUA 4DR4E 3CWVA 1FJGI 4BCAA 4X64I 5BR8I 1PVGA 3F0NA 2V8QB 1UHZA 5AE3A 4KHPE 5F3WA 3HULA 3VYXA 1NHJA 4HACA 1ZM4A 2ZM6E 2O1VA 2BV3A 4M30A 4DR5I 3JU0A 1XNQE 2EZ6A 3AUZA 3HPSA 2HKJA 2DEJA 4LFCI 3ZM7A 4JYAI 1RR9A 1S4EA 4DV6E 5LL6R 3VYYA 4LF7I 2M4IA 4B3ME 3VK6A 5T6JA 2RTXA 4LTYA 3WU5A 5L3JA 2JY9A 2FTXB 2ODRC 1XMOI 1Y6ZA 4ED4A 3J7AG 4JI1I 3IWBA 4DV0I 4DR1E 4DV1E 3LPSA 4P52A 4GEQB 4IZJD 4LU9A 2F4VI 3K17A 2E5LI 2L2NA 1HK7A 2O1TA 4DV5E 4DR6E 5GMEA 3OMLA 4MYUA 2UUAI 1Z0CA 2B3TB 2RS6A 1YYKA 4M0VA 3ZOQB 4OOGC 3LNUA 1KTVA 4X62I 4M2ZA 1EI1A 4JI5E 4BBYA 2UUCI 3ADIA 2V87A 2UXBE 2V88A 3J80C 2NUFA 4J8ZA 2O1UA 1FWLA 4FWGA 4LFAI 1GZ6A 3HTXA 4YHHE 2K4VA 4HACB 3DJWA 1HNZI 2X36A 4B3SI 2L2KB 2YZTA 1HNWI 4F9AB 2V83A 4JI2E 4R8OA 3T1YE 3QT7A 4DV2I 4X66E 1VISA 1WHNA 4JI6I 2IOPA 2N3HA 4R03A 2HFUA 4DV4I 4JV5I 3J81C 4R1FA 4P78A 4JI3E 4PU9A 2A2DA 2E1MA 3F6HA 4B3RE 4JI7I 1XNRI 2HKEA 4DUYE 1IBLE 1FWKA 4BC9A 4NXMI 3IWCA 4AQYE 3WU3A 1UILA 4LFBE 3DF6A 2LBSB 2IOQA 2VF1A 1EKZA 2YT4A 1NHHA 2AJ4A 4JI4E 2GS8A 4ZVIA 1J5EI 2JWOA 2Z5BA 4LF5E 2UXCE 3JAMC 3MSWA 4L5NC 4DUZI 1DQ3A 4DR7E 1N0UA 5IWAE 1H7UA 2UXDI 4YY3I 4JI8I 2WW4A 1N36I 2L6MA 3P06A 4IZKA 4DV7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7Y A;  2A2C A;  1KIJ A;  4GKJ E;  3T1H E;  1T4O A;  1S16 A;  1X49 A;  4LF9 I;  1FJG E;  3ZZ0 A;  5BR8 E;  4WUD A;  4DR4 I;  4K0K E;  4DR5 E;  4JYA E;  3P1X A;  3ADL A;  2V8P A;  1IBK E;  4LF7 E;  1GQE A;  4JI0 I;  1I94 I;  1O0W A;  4DR3 E;  3V2U C;  2XEX A;  3QT5 A;  1XNQ I;  2HFS A;  4DV6 I;  1XMO E;  2MDR A;  3PYD A;  1ZBT A;  4DV0 E;  2V2V A;  4DU7 A;  5A2Q C;  4B3M I;  3J80 Q;  5LMN I;  2LTS A;  1MX0 A;  2V34 A;  2F4V E;  2BM1 A;  1FKA E;  4DPY A;  4FW9 A;  4B3T E;  2ZBK B;  1Z5A A;  4DV5 I;  1Z5C A;  3J81 Q;  3ADG A;  1X48 A;  2EFG A;  4DV3 E;  1XHK A;  4LFA E;  3OTO E;  4HYM A;  2B7T A;  4UTG A;  1N32 E;  4USK A;  4B3S E;  1QU6 A;  2JVA A;  5IT9 Q;  1HNW E;  1DAR A;  2VQE E;  4OX9 E;  1N34 E;  2DEI A;  4DV2 E;  4JI6 E;  2UUB I;  1OJ4 A;  4UT4 A;  1STU A;  4RPF A;  4JV5 E;  4DU8 A;  1XMQ I;  4JI2 I;  3WU6 A;  3PYE A;  1MU5 A;  4X66 I;  1ZXM A;  1B63 A;  2HK3 A;  3JAM Q;  1IBM I;  5IT9 C;  1ZM2 A;  2L3J A;  4DPX A;  1XNR E;  5FLX Q;  2LRS A;  1A6F A;  3ADJ A;  4FWD A;  1DI2 A;  1RQ0 A;  2RS7 A;  1Z0V A;  4DPU A;  2BM0 A;  4LF4 E;  1D6T A;  2VF3 A;  1HR0 E;  1PIE A;  5LMU I;  3ZZT A;  4GKK E;  2NA2 A;  1ZM9 A;  4DPT A;  1YZ9 A;  5FLX C;  4X65 I;  2L3C A;  4DR2 E;  2R42 A;  4LF6 I;  4NXN I;  1K47 A;  1N33 I;  4MYT A;  4Z7C A;  2UXD E;  4JI4 I;  4WUC A;  1N36 E;  2UXC I;  2VQF E;  4P7A A;  1NHI A;  3LLH A;  4DV7 E;  2UU9 I;  4X64 E;  4LF8 I;  2DIX A;  3J7A M;  4DR7 I;  2HHH I;  4FN5 A;  4LF9 E;  2R3V A;  1HNX I;  2J7K A;  3B8H A;  4I3H A;  4JG4 A;  1PKP A;  1T4L B;  2LJP A;  4EMD A;  4LFC E;  5A2Q Q;  1WHQ A;  4KHP I;  2ZM6 I;  1J26 A;  4M1K A;  3D4J A;  1Z0B A;  1WUU A;  3K1J A;  1X47 A;  4K0K I;  4JI0 E;  1I94 E;  4JI1 E;  1YYO A;  4WYQ B;  1YYW A;  1IBK I;  2ZIT A;  3C4T A;  1H7S A;  3PYF A;  2E5L E;  3H4L A;  4DR3 I;  3QT6 A;  5LMN E;  3J7Y p;  4DR1 I;  4DV1 I;  2NUE A;  3PYG A;  2UUA E;  3C4B A;  4DKK A;  1FNM A;  1Z0G A;  2N3G A;  1KKH A;  4X62 E;  4DR6 I;  2Q2E B;  2IHR 1;  3B78 A;  4XTJ A;  2X7I A;  2UUC E;  4DXL A;  1EA6 A;  2B7V A;  4B3T I;  1H72 C;  3B82 A;  4JI5 I;  4URL A;  2NUG A;  2LUP B;  3WU4 A;  2DMY A;  2UXB I;  1HNZ E;  4HXZ A;  2HK2 A;  1Z0E A;  3QT8 A;  3ZZU A;  1H73 A;  4KQV A;  2RSM A;  4YHH I;  4DV3 I;  2LUQ A;  1NZ0 A;  4PRV A;  4DV4 E;  3OTO I;  1ZXN A;  1U2R A;  1QZR A;  2V2Z A;  2UUB E;  3T1Y I;  1N32 I;  3V5R A;  4WFT A;  1XMQ E;  2KHX A;  1RRE A;  2LTR A;  1T4N A;  4JI7 E;  2V2Q A;  4PRX A;  2VQE I;  1N34 I;  4OX9 I;  1Z0W A;  1IBM E;  1Z5B A;  1Z59 A;  3Q1Q A;  4JI3 I;  5CFF E;  2NPF A;  3ZKB A;  4B3R I;  4DPW A;  4X8W A;  4NXM E;  2DB2 A;  1N0V C;  3LTO A;  4DUY I;  3M6A A;  1IBL I;  4HY1 A;  5LMU E;  1J5E E;  1Z0T A;  4AQY I;  3GON A;  4LFB I;  1ELO A;  4DUZ E;  4USM A;  1ZM3 A;  4LF4 I;  4X65 E;  1HR0 I;  2OI2 A;  1KVK A;  4YY3 E;  4LF6 E;  4GKK I;  4JI8 E;  2L33 A;  4LF5 I;  4NXN E;  1BKN A;  1N33 E;  5GMD A;  1B62 A;  2E1R A;  4WUB A;  4FWH A;  2CPN A;  3ZKD A;  2UU9 E;  5IWA I;  4DR2 I;  2CZ9 A;  1RC7 A;  1H74 A;  4LF8 E;  2L2M A;  1FI4 A;  1UEK A;  2HHH E;  4GKJ I;  1HNX E;  3T1H I;  2LJH A;  1MG7 A;  2VQF I;  4DR4 E;  3CWV A;  1FJG I;  4X64 I;  5BR8 I;  1PVG A;  3F0N A;  1UHZ A;  4KHP E;  3HUL A;  3VYX A;  1NHJ A;  4HAC A;  1ZM4 A;  2ZM6 E;  2BV3 A;  4M30 A;  4DR5 I;  2EZ6 A;  1XNQ E;  4LFC I;  4JYA I;  2HKJ A;  2DEJ A;  3ZM7 A;  1RR9 A;  1S4E A;  4DV6 E;  3VYY A;  5LL6 R;  4LF7 I;  4B3M E;  2RTX A;  3WU5 A;  5L3J A;  2JY9 A;  1XMO I;  4ED4 A;  3J7A G;  4JI1 I;  4DV0 I;  4DR1 E;  4DV1 E;  3LPS A;  4P52 A;  2F4V I;  3K17 A;  2E5L I;  2L2N A;  4DV5 E;  4DR6 E;  5GME A;  4MYU A;  2UUA I;  1Z0C A;  2B3T B;  2RS6 A;  1YYK A;  4OOG C;  3LNU A;  1KTV A;  4X62 I;  4M2Z A;  1EI1 A;  4JI5 E;  2UUC I;  3ADI A;  2UXB E;  3J80 C;  2NUF A;  1FWL A;  4FWG A;  4LFA I;  3HTX A;  4YHH E;  4HAC B;  1HNZ I;  2X36 A;  4B3S I;  2L2K B;  1HNW I;  4JI2 E;  3T1Y E;  3QT7 A;  4DV2 I;  4X66 E;  1VIS A;  1WHN A;  4JI6 I;  2N3H A;  2HFU A;  4DV4 I;  4JV5 I;  4R1F A;  3J81 C;  4JI3 E;  4PU9 A;  2A2D A;  4B3R E;  4JI7 I;  1XNR I;  2HKE A;  4DUY E;  1IBL E;  1FWK A;  4NXM I;  4AQY E;  3WU3 A;  1UIL A;  4LFB E;  2LBS B;  1EKZ A;  2YT4 A;  1NHH A;  2AJ4 A;  4JI4 E;  2GS8 A;  4ZVI A;  1J5E I;  4LF5 E;  2UXC E;  3JAM C;  4DUZ I;  4DR7 E;  1N0U A;  5IWA E;  1H7U A;  2UXD I;  4YY3 I;  4JI8 I;  2WW4 A;  1N36 I;  4DV7 I; 
#chains in the Genus database with same CATH topology
 4L8N A;  4Z7Y A;  2A2C A;  2EOE A;  4GKJ E;  2VE7 C;  1KIJ A;  4LCH A;  4BA1 A;  3T1H E;  1T4O A;  2EPM X;  3L00 A;  4DMI A;  4TUG A;  1S16 A;  1X49 A;  2DMI A;  2KON A;  3BF2 A;  2L92 A;  5AE2 A;  2EN7 A;  1A1F A;  4LF9 I;  1FJG E;  1ZR9 A;  3ZZ0 A;  4O4K A;  2C39 A;  5BR8 E;  5DRP A;  3HQ1 A;  4ZYH A;  5LLQ A;  1SR9 A;  2Z5E A;  4WUD A;  2JEA A;  1YFH A;  2G7H A;  4LCF A;  4BS9 A;  4OO1 C;  4DR4 I;  3MHH C;  1RHY A;  4FK5 C;  2EMB A;  4K0K E;  1R6M A;  2EMI A;  4ZYG A;  2MDG A;  2AE8 A;  4DR5 E;  1WXR A;  3P1X A;  4JYA E;  3ADL A;  2V8P A;  3EPL A;  2EOI A;  1IBK E;  2EOY A;  2WP8 B;  2EPR A;  4FW3 A;  4LF7 E;  1GQE A;  4F54 A;  3M7N G;  2CSH A;  4JI0 I;  1I94 I;  1O0W A;  4R2C A;  5KL4 A;  5K36 B;  4F9B B;  4DR3 E;  2JPA A;  2GO4 A;  2XEX A;  2RSI A;  2HFS A;  2EMC A;  3THN A;  1Y60 A;  1X6H A;  2C37 A;  1T39 A;  4X9J A;  1IQS A;  2ODR D;  4DV6 I;  1XMO E;  3C6M A;  2Q8U A;  2BBG A;  2MDR A;  1KYQ A;  2ENH A;  3PYD A;  2JXP A;  1ZBT A;  5KL7 A;  4DV0 E;  2V2V A;  2PO2 B;  5A2Q C;  4DU7 A;  4B3M I;  3J80 Q;  4JYA I;  2V89 A;  4MU4 A;  2LTS A;  3EQ1 A;  1MX0 A;  2V34 A;  5LMN I;  4IZJ B;  2EML A;  2KOU A;  5C0X A;  2F4V E;  2BM1 A;  1FKA E;  4DPY A;  2Z5B B;  1BB8 A;  2EPA A;  4FW9 A;  2PO0 B;  2HJJ A;  2JE6 A;  4B3T E;  2DSY A;  2EPN A;  2ZBK B;  1Z5A A;  2YTI A;  2C38 A;  5C0X E;  4DV5 I;  2M9A A;  1T38 A;  2GLI A;  1Z5C A;  4IZK B;  5KL6 A;  2YU8 A;  4IJD A;  2YRK A;  1TF6 A;  1KJK A;  2NN6 A;  2PNZ A;  3GME A;  3PRY A;  4I8O A;  2F8B A;  2LMZ A;  3J81 Q;  4O5G A;  4ISA A;  3ADG A;  1X48 A;  2EFG A;  4AIM A;  1YPN A;  1OYR A;  2D9H A;  4DV3 E;  1XHK A;  2C39 B;  4LFA E;  3PS2 A;  4NBQ A;  2CG9 A;  1A1L A;  2M1S A;  5K36 F;  2HC5 A;  3OTO E;  4HYM A;  3IWD A;  1A1G A;  3EPJ A;  2JEA B;  2B7T A;  4UTG A;  1F2I G;  1N32 E;  2EMH A;  1LLM C;  4B3S E;  1QU6 A;  1PJS A;  1WJP A;  2NN6 E;  2JVA A;  4USK A;  5IT9 Q;  4BMJ A;  2H36 X;  3HXL A;  1HNW E;  4F9C B;  1B69 A;  1DAR A;  4IFD C;  2VQE E;  4OX9 E;  1N34 E;  4TUI A;  1X3C A;  2DEI A;  4DV2 E;  2EPK X;  2I13 A;  4JI6 E;  2EM5 A;  2UUB I;  1OJ4 A;  5JEA F;  4UT4 A;  1STU A;  4RPF A;  4JV5 E;  4DU8 A;  1XMQ I;  2L8T A;  4NZV A;  4JI2 I;  3WU6 A;  1YSA C;  3PYE A;  3QG5 C;  1MU5 A;  4X66 I;  1ZXM A;  2CVE A;  1B63 A;  3CDJ A;  2HK3 A;  3JAM Q;  1IBM I;  2EMW A;  2LT7 A;  5IT9 C;  1ZM2 A;  3HJC A;  4MLQ A;  2YTG A;  2EPU A;  2L3J A;  4DPX A;  1XNR E;  5FLX Q;  2V85 A;  3M7N D;  2LRS A;  1A6F A;  4R2S A;  3ADJ A;  5DNX A;  5C0X B;  3RMP A;  4GZN C;  2BB8 A;  4FWD A;  2R76 A;  1DI2 A;  1RQ0 A;  3CDI A;  2RS7 A;  1Z0V A;  4NHR A;  4DPU A;  2BM0 A;  4LF4 E;  1EH6 A;  4KZS A;  1D6T A;  2VF3 A;  5AE1 A;  2WBS A;  1HR0 E;  1AAY A;  4F2J C;  1PIE A;  2BA0 G;  5A69 A;  2ADR A;  2EM8 A;  4GKK E;  2JE6 B;  2NA2 A;  4J3D A;  1X6E A;  1ZM9 A;  2GPI A;  1A1I A;  2C38 B;  4DPT A;  2PO1 A;  2YSP A;  1YZ9 A;  2IER A;  1P47 A;  5FLX C;  4X65 I;  2L3C A;  4DR2 E;  5A6J A;  5A6B D;  2R42 A;  4FW7 A;  4LF6 I;  2IES A;  4Q35 B;  2PNZ B;  2EJ4 A;  2NN6 B;  4NXN I;  1YUI A;  2EM2 A;  1Z1B A;  1K47 A;  1N33 I;  2EP3 A;  4FW6 A;  4MYT A;  4Z7C A;  4R2A A;  2UXD E;  4JI4 I;  4WUC A;  1N36 E;  2UXC I;  2VQF E;  4P7A A;  1NHI A;  2EOJ A;  3LLH A;  4DV7 E;  4OZE A;  2EM9 A;  2UU9 I;  1E3P A;  4X64 E;  2GQ0 A;  4MU0 A;  4LF8 I;  2DIX A;  2EM6 A;  3J7A M;  2HHH I;  4DR7 I;  4FN5 A;  4LF9 E;  2R3V A;  1HNX I;  2Z5C A;  2J7K A;  3B8H A;  2PNM A;  4I3H A;  4JG4 A;  1PKP A;  1T4L B;  2LJP A;  3Q6N A;  2EOO A;  4EMD A;  4OO1 D;  4LFC E;  5A2Q Q;  4MQY A;  1WHQ A;  1JK1 A;  4KHP I;  2EPP A;  4O43 A;  2O1W A;  3LML A;  2ZM6 I;  1J26 A;  2EMA A;  4M1K A;  2RQL A;  3D4J A;  1Z0B A;  4F6M A;  3F6G A;  2EN1 A;  4M9V C;  2MC6 A;  3THO B;  1WUU A;  3K1J A;  1X47 A;  4K0K I;  4JI0 E;  2EQ3 A;  1I94 E;  4MU1 A;  1Y4U A;  4JI1 E;  1YYO A;  4WYQ B;  4FW4 A;  1GTK A;  1BBG A;  2E72 A;  3EPK A;  1YYW A;  4QNJ A;  2YPN A;  2BR2 A;  1N3G A;  1MGT A;  1IBK I;  5K36 C;  2LJU A;  3AV0 A;  2DRP A;  2ZIT A;  1PJT A;  3QT5 A;  5EL9 A;  3C4T A;  3C6K A;  5IV8 B;  1H7S A;  3PYF A;  2EOS A;  3JTZ A;  2JOX A;  4ZYE A;  4MU3 A;  4KWY A;  2E5L E;  3H4L A;  4DR3 I;  4AM3 A;  3QT6 A;  2MC5 A;  5LMN E;  4BA2 A;  4RHB B;  3J7Y p;  2B9D A;  5DNL A;  4DR1 I;  3P3G A;  1QNT A;  2NUE A;  3K6Q A;  3PYG A;  4DV1 I;  1Y4S A;  2YTD A;  4WSP A;  4WX9 A;  2UUA E;  2PO1 B;  2JEB A;  2WBT A;  3C4B A;  4MDT A;  5JEA C;  5DRO A;  1VI7 A;  4MLV A;  4DKK A;  1FNM A;  1Z0G A;  2EL4 A;  3H09 A;  2N3G A;  2BA0 D;  4BHC A;  1KKH A;  4X62 E;  4DR6 I;  2Q2E B;  5JEA D;  2IHR 1;  2CT1 A;  5ADZ A;  2MKN A;  2CGE A;  2EMZ A;  3B78 A;  4XTJ A;  2X7I A;  4BA1 B;  2UUC E;  4DXL A;  1EA6 A;  1UDS A;  3UK3 C;  2B7V A;  2JP9 A;  4B3T I;  2FGG A;  5A6B A;  1H72 C;  3B82 A;  2DGC A;  2DLK A;  2EMG A;  4BC7 A;  5FWK A;  4JI5 I;  3BID A;  4URL A;  2NUG A;  2LUP B;  2Z5C B;  5DRR A;  3WU4 A;  3K85 A;  2DMY A;  2UXB I;  1HNZ E;  4HXZ A;  2HK2 A;  1Z0E A;  2YU5 A;  1XXE A;  3QT8 A;  3ZZU A;  1H73 A;  3H1C A;  2EPC A;  1NEI A;  4KQV A;  4QNK A;  4N3O A;  2RSM A;  4YHH I;  3DD6 A;  4IFD D;  4DV3 I;  1USV A;  3HPZ A;  2J65 A;  5KL2 A;  2LUQ A;  1A1K A;  1NZ0 A;  3ZZT A;  4PRV A;  2K7I A;  4DV4 E;  2JYA A;  3OTO I;  1ZXN A;  1U2R A;  1QZR A;  2V2Z A;  2YTQ A;  2UUB E;  3T1Y I;  1N32 I;  1L4S A;  2FV4 B;  4OO1 A;  2M7Q A;  3KZY A;  2LE2 A;  2C37 B;  1WRJ A;  4WFT A;  4U3B A;  3HKM A;  3V5R A;  1XMQ E;  1UBD C;  4BHB A;  2KHX A;  1A1H A;  2LTR A;  1T4N A;  4JI7 E;  1RRE A;  2V2Q A;  4PRX A;  3U1Y A;  2VQE I;  1N34 I;  4OX9 I;  1BBO A;  5DNY A;  1Z0W A;  1IBM E;  1Z5B A;  4N4R B;  1Z59 A;  3GLL A;  3Q6M A;  4JI3 I;  2EPZ A;  1P42 A;  3Q1Q A;  2EN2 A;  2EOM A;  5CFF E;  2NPF A;  2EWL A;  3ZKB A;  4F6N A;  4B3R I;  1UDN A;  4OO1 E;  5IXM B;  1IQO A;  4DPW A;  4X8W A;  4IS9 A;  4WXC A;  4BA2 B;  2PNL A;  4NXM E;  2DB2 A;  2MKD A;  4DR5 I;  1N0V C;  3PS3 A;  2WZO A;  3KWR A;  3LTO A;  4DUY I;  3M6A A;  1IBL I;  5C0X C;  2EPX A;  2EOZ A;  3ECR A;  3EPH A;  4HY1 A;  5K36 A;  5LMU E;  1ZBQ A;  4P7D A;  1J5E E;  1Z0T A;  2YTF A;  4WPY A;  4AQY I;  3GON A;  4LFB I;  1ELO A;  5AAS A;  3FIG A;  2LV2 A;  2J7J A;  1UDO A;  4DUZ E;  4USM A;  1ZM3 A;  4LF4 I;  2V86 A;  4R2P A;  2EPO A;  4X65 E;  1HR0 I;  2OI2 A;  1KVK A;  1TF3 A;  4YY3 E;  4LF6 E;  2EM3 A;  4JI8 E;  4FW5 A;  4GKK I;  2L33 A;  4LF5 I;  4IZJ A;  5K36 E;  4NXN E;  1YHC A;  3B4T A;  1BKN A;  1N33 E;  5GMD A;  2JR1 A;  1ZAA C;  3NZK A;  5JEA A;  1B62 A;  2E1R A;  2NN6 C;  4Q28 A;  4WUB A;  2EN4 A;  1X5W A;  4FWH A;  2CPN A;  2JOB A;  2EMY A;  2I9I A;  2UU9 E;  2O3Z A;  2GHF A;  3ZKD A;  5IWA I;  4DR2 I;  2CZ9 A;  2EMF A;  2EOH A;  3L7Z A;  2EMX A;  1RC7 A;  1H74 A;  4LF8 E;  2L2M A;  4LOM A;  1FI4 A;  2WNR A;  2EM4 A;  2HHH E;  1UEK A;  4GKJ I;  1HNX E;  3P3C A;  3PS1 A;  5AC5 A;  1YH8 A;  3T1H I;  2LJH A;  1MG7 A;  5KL3 A;  5C0X F;  5JEA E;  1USU A;  2BA1 D;  2VQF I;  3KRN A;  4DR4 E;  3CWV A;  1FJG I;  4BCA A;  4X64 I;  5BR8 I;  2EM0 A;  1PVG A;  3F0N A;  2V8Q B;  1UHZ A;  5AE3 A;  4LPF A;  4OO1 B;  4KHP E;  2EQ1 A;  5F3W A;  2A25 A;  3HUL A;  4IFD A;  3VYX A;  1NHJ A;  4HAC A;  3BBG A;  1ZM4 A;  2ZM6 E;  4GQU A;  2YTO A;  5LMU I;  2O1V A;  2BV3 A;  2RPC A;  4M30 A;  2PRT A;  3JU0 A;  2EOQ A;  2EL6 A;  3AUZ A;  3HPS A;  1XNQ E;  2EZ6 A;  2DEJ A;  2HKJ A;  4LFC I;  2WBU A;  3ZM7 A;  1XNQ I;  1RR9 A;  2NN6 F;  1S4E A;  4DV6 E;  5ELW A;  5LL6 R;  3VYY A;  3M85 G;  1UDQ A;  2HGH A;  2DLQ A;  4LF7 I;  4IFD E;  4R2D A;  1OYP A;  4AID A;  5K36 D;  2M4I A;  4B3M E;  3VK6 A;  5T6J A;  1R6L A;  2RTX A;  4LTY A;  3WU5 A;  5L3J A;  2EN3 A;  1MEY C;  2JY9 A;  2FTX B;  2VES A;  2ODR C;  1XMO I;  2YWQ A;  1Y6Z A;  4ED4 A;  3J7A G;  4JI1 I;  3IWB A;  1YUJ A;  4DV0 I;  4DR1 E;  4DV1 E;  3LPS A;  4P52 A;  3GCM A;  1DGC A;  4GEQ B;  4IZJ D;  4LU9 A;  1G2D C;  3P3E A;  1G2F C;  4OKG A;  4U3D A;  1EH7 A;  2F4V I;  1A1J A;  2R1F A;  3K17 A;  2E5L I;  2L2N A;  2YTP A;  2VRD A;  1HK7 A;  2O1T A;  1JK2 A;  2EN8 A;  4DV5 E;  4DR6 E;  2YRM A;  5GME A;  3OML A;  4MYU A;  2UUA I;  1X6F A;  2EE8 A;  5JEA B;  1Z0C A;  4OO1 F;  2B3T B;  2RS6 A;  1YYK A;  5A6K A;  2GO3 A;  2BA1 G;  4M0V A;  3ZOQ B;  4OOG C;  3L7Z B;  1KTV A;  3LNU A;  4X62 I;  4M2Z A;  1EI1 A;  2WNR B;  4JI5 E;  4BBY A;  3TQM A;  1PDA A;  4RH8 A;  2EQ0 A;  2UUC I;  3U1K A;  3ADI A;  2V87 A;  2UXB E;  2V88 A;  3J80 C;  2NUF A;  4HTG A;  4J8Z A;  2O1U A;  2LO3 A;  2YRH A;  1FWL A;  1RMD A;  4FWG A;  2EOF A;  4LFA I;  2ENC A;  5AC4 A;  1GZ6 A;  3HTX A;  4WSG A;  4YHH E;  3V2U C;  5DRQ A;  4WXD A;  3UHM A;  4IFD B;  2K4V A;  2EN6 A;  3DJW A;  4HAC B;  1HNZ I;  2X36 A;  3KZZ A;  4B3S I;  2L2K B;  2YZT A;  4R2Q A;  1HNW I;  4F9A B;  2V83 A;  5KL5 A;  4JI2 E;  4R8O A;  3T1Y E;  1Y5Y A;  2CTD A;  2LCE A;  3VHT B;  1IMU A;  3QT7 A;  4DV2 I;  4X66 E;  2BR2 B;  1VIS A;  1WHN A;  2YSO A;  4JI6 I;  2IOP A;  2N3H A;  3BGH A;  3M99 B;  4R03 A;  2ELZ A;  2HFU A;  2EOR A;  4LCG A;  3MHS C;  4ZYD A;  4DV4 I;  1PJQ A;  4JV5 I;  4HEI A;  3J81 C;  1TN9 A;  4R1F A;  4P78 A;  5TSE A;  4JI3 E;  2EPL X;  2F1D A;  4PU9 A;  2A2D A;  2E1M A;  3F6H A;  2ENA A;  4B3R E;  2WP8 A;  5EKW A;  4JI7 I;  3M85 D;  2JEB B;  4R2R A;  1EH8 A;  1XNR I;  1UN6 B;  2HKE A;  1NCS A;  5C0X D;  4DUY E;  1IBL E;  1AH5 A;  5A6A A;  1FWK A;  2WCC 3;  2EM7 A;  2LVH A;  2NAB A;  3P76 A;  1OYS A;  4IS1 C;  4BC9 A;  4NXM I;  2YTN A;  3IWC A;  4AQY E;  3WU3 A;  1UIL A;  4LFB E;  2PO2 A;  3DF6 A;  2LBS B;  2IOQ A;  2VF1 A;  4R2E A;  1EKZ A;  2ELY A;  1E3H A;  1ZU1 A;  4IFD F;  2YT4 A;  1NHH A;  2YTJ A;  2AJ4 A;  4JI4 E;  2GS8 A;  4ZVI A;  1J5E I;  2JWO A;  2Z5B A;  4LF5 E;  2UXC E;  2EMK A;  3JAM C;  1SFE A;  2PO0 A;  2YTE A;  2NN6 D;  4O24 A;  3MSW A;  4L5N C;  4DUZ I;  1DQ3 A;  2JT2 A;  4DR7 E;  1N0U A;  5IWA E;  1H7U A;  2UXD I;  4YY3 I;  4JI8 I;  2EOX A;  2N8X A;  2WW4 A;  1N36 I;  2L6M A;  2EL5 A;  3P06 A;  4IZK A;  4DV7 I; 
#chains in the Genus database with same CATH homology
 4L8N A;  4Z7Y A;  2A2C A;  1KIJ A;  4GKJ E;  2VE7 C;  3T1H E;  1T4O A;  4DMI A;  4TUG A;  1S16 A;  1X49 A;  2KON A;  5AE2 A;  2L92 A;  4LF9 I;  1FJG E;  3ZZ0 A;  5BR8 E;  3HQ1 A;  4WUD A;  1SR9 A;  2Z5E A;  2G7H A;  4BS9 A;  4DR4 I;  4K0K E;  4DR5 E;  1WXR A;  3P1X A;  4JYA E;  3ADL A;  2V8P A;  1IBK E;  4LF7 E;  1GQE A;  4F54 A;  4JI0 I;  1I94 I;  1O0W A;  4F9B B;  4DR3 E;  2XEX A;  3QT5 A;  3V2U C;  1XNQ I;  2HFS A;  2ODR D;  4DV6 I;  1XMO E;  2MDR A;  3PYD A;  1ZBT A;  4DV0 E;  2V2V A;  5A2Q C;  4DU7 A;  4B3M I;  3J80 Q;  2V89 A;  5LMN I;  2LTS A;  1MX0 A;  2V34 A;  4IZJ B;  2KOU A;  2F4V E;  2BM1 A;  1FKA E;  4DPY A;  2Z5B B;  4FW9 A;  4B3T E;  2DSY A;  2ZBK B;  1Z5A A;  4DV5 I;  1Z5C A;  4IZK B;  3PRY A;  4I8O A;  2F8B A;  2LMZ A;  3J81 Q;  3ADG A;  1X48 A;  2EFG A;  4DV3 E;  1XHK A;  4LFA E;  2CG9 A;  2M1S A;  3OTO E;  4HYM A;  3IWD A;  2B7T A;  4UTG A;  1N32 E;  4USK A;  4B3S E;  1QU6 A;  2JVA A;  5IT9 Q;  4BMJ A;  2H36 X;  3HXL A;  1HNW E;  4F9C B;  1DAR A;  2VQE E;  4OX9 E;  1N34 E;  4TUI A;  2DEI A;  4DV2 E;  4JI6 E;  2UUB I;  1OJ4 A;  4UT4 A;  1STU A;  4RPF A;  4JV5 E;  4DU8 A;  1XMQ I;  2L8T A;  4JI2 I;  3WU6 A;  3PYE A;  1MU5 A;  4X66 I;  1ZXM A;  1B63 A;  2HK3 A;  3JAM Q;  1IBM I;  5IT9 C;  1ZM2 A;  3HJC A;  2L3J A;  4DPX A;  1XNR E;  5FLX Q;  2V85 A;  2LRS A;  1A6F A;  3ADJ A;  3RMP A;  4FWD A;  1DI2 A;  1RQ0 A;  2RS7 A;  1Z0V A;  4DPU A;  2BM0 A;  4LF4 E;  4KZS A;  1D6T A;  2VF3 A;  5AE1 A;  1HR0 E;  1PIE A;  5LMU I;  3ZZT A;  4GKK E;  2NA2 A;  1ZM9 A;  4DPT A;  1YZ9 A;  5FLX C;  4X65 I;  2L3C A;  4DR2 E;  2R42 A;  4LF6 I;  4NXN I;  1K47 A;  1N33 I;  4MYT A;  4Z7C A;  2UXD E;  4JI4 I;  4WUC A;  1N36 E;  2UXC I;  2VQF E;  4P7A A;  1NHI A;  3LLH A;  4DV7 E;  2UU9 I;  4X64 E;  2GQ0 A;  4LF8 I;  2DIX A;  3J7A M;  4DR7 I;  2HHH I;  4FN5 A;  4LF9 E;  2R3V A;  1HNX I;  2Z5C A;  2J7K A;  3B8H A;  2PNM A;  4I3H A;  4JG4 A;  1PKP A;  1T4L B;  2LJP A;  3Q6N A;  4EMD A;  4LFC E;  5A2Q Q;  1WHQ A;  4KHP I;  2O1W A;  3LML A;  2ZM6 I;  1J26 A;  4M1K A;  3D4J A;  1Z0B A;  3F6G A;  1WUU A;  2MC6 A;  3K1J A;  1X47 A;  4K0K I;  4JI0 E;  1I94 E;  1Y4U A;  4JI1 E;  1YYO A;  4WYQ B;  1YYW A;  1IBK I;  3AV0 A;  2ZIT A;  3C4T A;  1H7S A;  3PYF A;  3JTZ A;  2JOX A;  2E5L E;  3H4L A;  4DR3 I;  3QT6 A;  2MC5 A;  5LMN E;  3J7Y p;  2B9D A;  4DR1 I;  4DV1 I;  2NUE A;  3K6Q A;  3PYG A;  1Y4S A;  4WSP A;  2UUA E;  3C4B A;  4DKK A;  1FNM A;  1Z0G A;  3H09 A;  2N3G A;  1KKH A;  4X62 E;  4DR6 I;  2Q2E B;  2IHR 1;  5ADZ A;  2CGE A;  3B78 A;  4XTJ A;  2X7I A;  2UUC E;  4DXL A;  1EA6 A;  2B7V A;  4B3T I;  2FGG A;  1H72 C;  3B82 A;  4BC7 A;  5FWK A;  4JI5 I;  4URL A;  2NUG A;  2LUP B;  2Z5C B;  3WU4 A;  3K85 A;  2DMY A;  2UXB I;  1HNZ E;  4HXZ A;  2HK2 A;  1Z0E A;  3QT8 A;  3ZZU A;  1H73 A;  4KQV A;  4N3O A;  2RSM A;  4YHH I;  4DV3 I;  1USV A;  3HPZ A;  2LUQ A;  1NZ0 A;  4PRV A;  4DV4 E;  3OTO I;  1ZXN A;  1U2R A;  1QZR A;  2V2Z A;  2UUB E;  3T1Y I;  1N32 I;  2FV4 B;  2M7Q A;  2LE2 A;  3V5R A;  4WFT A;  1XMQ E;  2KHX A;  1RRE A;  2LTR A;  1T4N A;  4JI7 E;  2V2Q A;  4PRX A;  2VQE I;  1N34 I;  4OX9 I;  1Z0W A;  5DNY A;  1IBM E;  1Z5B A;  1Z59 A;  3Q1Q A;  3Q6M A;  4JI3 I;  5CFF E;  2NPF A;  2EWL A;  3ZKB A;  4B3R I;  4DPW A;  4X8W A;  2PNL A;  4NXM E;  2DB2 A;  1N0V C;  2WZO A;  3KWR A;  3LTO A;  4DUY I;  3M6A A;  1IBL I;  4HY1 A;  5LMU E;  1ZBQ A;  4P7D A;  1J5E E;  1Z0T A;  4WPY A;  4AQY I;  3GON A;  4LFB I;  1ELO A;  5AAS A;  3FIG A;  4DUZ E;  4USM A;  1ZM3 A;  4LF4 I;  2V86 A;  4X65 E;  1HR0 I;  2OI2 A;  1KVK A;  4YY3 E;  4LF6 E;  4GKK I;  4JI8 E;  2L33 A;  4LF5 I;  4IZJ A;  4NXN E;  1BKN A;  1N33 E;  5GMD A;  2JR1 A;  1B62 A;  2E1R A;  4WUB A;  4Q28 A;  4FWH A;  2CPN A;  2JOB A;  3ZKD A;  2UU9 E;  5IWA I;  4DR2 I;  2CZ9 A;  1RC7 A;  1H74 A;  4LF8 E;  2L2M A;  1FI4 A;  1UEK A;  2HHH E;  4GKJ I;  1HNX E;  3T1H I;  2LJH A;  1MG7 A;  2VQF I;  1USU A;  4DR4 E;  3CWV A;  1FJG I;  4BCA A;  4X64 I;  5BR8 I;  1PVG A;  3F0N A;  2V8Q B;  1UHZ A;  5AE3 A;  4KHP E;  5F3W A;  3HUL A;  3VYX A;  1NHJ A;  4HAC A;  1ZM4 A;  2ZM6 E;  2O1V A;  2BV3 A;  4M30 A;  4DR5 I;  3JU0 A;  1XNQ E;  2EZ6 A;  3AUZ A;  3HPS A;  2HKJ A;  2DEJ A;  4LFC I;  3ZM7 A;  4JYA I;  1RR9 A;  1S4E A;  4DV6 E;  5LL6 R;  3VYY A;  4LF7 I;  2M4I A;  4B3M E;  3VK6 A;  5T6J A;  2RTX A;  4LTY A;  3WU5 A;  5L3J A;  2JY9 A;  2FTX B;  2ODR C;  1XMO I;  1Y6Z A;  4ED4 A;  3J7A G;  4JI1 I;  3IWB A;  4DV0 I;  4DR1 E;  4DV1 E;  3LPS A;  4P52 A;  4GEQ B;  4IZJ D;  4LU9 A;  2F4V I;  3K17 A;  2E5L I;  2L2N A;  1HK7 A;  2O1T A;  4DV5 E;  4DR6 E;  5GME A;  3OML A;  4MYU A;  2UUA I;  1Z0C A;  2B3T B;  2RS6 A;  1YYK A;  4M0V A;  3ZOQ B;  4OOG C;  3LNU A;  1KTV A;  4X62 I;  4M2Z A;  1EI1 A;  4JI5 E;  4BBY A;  2UUC I;  3ADI A;  2V87 A;  2UXB E;  2V88 A;  3J80 C;  2NUF A;  4J8Z A;  2O1U A;  1FWL A;  4FWG A;  4LFA I;  1GZ6 A;  3HTX A;  4YHH E;  2K4V A;  4HAC B;  3DJW A;  1HNZ I;  2X36 A;  4B3S I;  2L2K B;  2YZT A;  1HNW I;  4F9A B;  2V83 A;  4JI2 E;  4R8O A;  3T1Y E;  3QT7 A;  4DV2 I;  4X66 E;  1VIS A;  1WHN A;  4JI6 I;  2IOP A;  2N3H A;  4R03 A;  2HFU A;  4DV4 I;  4JV5 I;  3J81 C;  4R1F A;  4P78 A;  4JI3 E;  4PU9 A;  2A2D A;  2E1M A;  3F6H A;  4B3R E;  4JI7 I;  1XNR I;  2HKE A;  4DUY E;  1IBL E;  1FWK A;  4BC9 A;  4NXM I;  3IWC A;  4AQY E;  3WU3 A;  1UIL A;  4LFB E;  3DF6 A;  2LBS B;  2IOQ A;  2VF1 A;  1EKZ A;  2YT4 A;  1NHH A;  2AJ4 A;  4JI4 E;  2GS8 A;  4ZVI A;  1J5E I;  2JWO A;  2Z5B A;  4LF5 E;  2UXC E;  3JAM C;  3MSW A;  4L5N C;  4DUZ I;  1DQ3 A;  4DR7 E;  1N0U A;  5IWA E;  1H7U A;  2UXD I;  4YY3 I;  4JI8 I;  2WW4 A;  1N36 I;  2L6M A;  3P06 A;  4IZK A;  4DV7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...