1DL6A

Solution structure of human tfiib n-terminal domain
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
58
structure length
58
Chain Sequence
ASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords TRANSCRIPTION FACTOR II B (TFIIB)
publication title Structure of a (Cys3His) zinc ribbon, a ubiquitous motif in archaeal and eucaryal transcription.
pubmed rcsb
source organism Homo sapiens
total genus 2
structure length 58
sequence length 58
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08271 TF_Zn_Ribbon TFIIB zinc-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1dl6A00
5C44I 2E2JI 2NVYI 2NVXI 2F4MA 5IP7I 4X6AI 1VLAA 1QYPA 4BY1I 4A3DI 4NBHA 5C4JI 1RLYA 1WW9A 4A3GI 2DE5A 3GCFA 1I3QI 4MH4A 3GTKI 1WCMI 1X3WA 4NB8A 5C3EI 3GTLI 5FLMI 1USPA 4NBDA 3FKII 3S16I 5IP9I 4A3JI 2B63I 3RZOI 3GTJI 3S2HI 4BY7I 1ZB8A 2RBLA 4NBGA 2PK7A 3RZDI 3S1NI 2E2HI 3GTQI 2VUMI 1TWFI 4A3BI 5C4XI 4Y52I 1TWAI 3Q87A 1PFTA 1Y1VS 1RO4A 3HOXI 1I6HI 3HOWI 2JS4A 1I50I 2JA7I 3GKQA 3D6WA 1R9TI 2NVQI 4A93I 4A3FI 2K5RA 4A3MI 1TWGI 3HOYI 4BBSI 3S1QI 3S17I 3I4NI 3M4OI 2KPIA 3GTPI 2JR6A 4NBBA 1Y1VI 4A3KI 2JA5I 1K83I 1YUAA 3HOVI 1TWCI 4NBFA 1L1OC 3I07A 3VMHA 3CQZI 2R92I 3PO2I 3LUSA 3PO3S 1NUIA 1LQLA 2JNYA 4NBEA 4A3II 4QTUA 3S2DI 1DL6A 1USPB 2HF1A 2DE6A 4NB9A 4BBRI 2JA8I 2DE7A 3GTMS 3VMIA 4BXXI 4A3CI 2YU9I 4XX2A 3EERA 3HOZI 3S1RI 1TFIA 1ZB9A 3S1MI 3PO3I 3I4MI 3S14I 4QTTA 3VB9A 2AKLA 2JA6I 3HOUI 3H0GI 2R7ZI 2R93I 1SFOI 4A3LI 1X3ZA 1TWHI 2F4OA 1Y1WI 2BJOA 2J6AA 3GTOI 4NBCA 3VMGA 3GTGI 2NVTI 4Y7NI 3M3YI 3U50C 3GTMI 1N2FA 1ML8A 3H3VJ 3ESWA 5CM2M 3S15I 4NOZA 2E2II 4NBAA 3K7AI 4A3EI 2P3YA
chains in the Genus database with same CATH superfamily
2EGTA 5C44I 5IP7I 3CCL1 1VLAA 3JAMf 1W2BY 3KIHA 5C4JI 5D1OB 2DE5A 1JJ2Y 4MH4A 2W04A 1S72Z 3GTKI 1P9NA 4NB8A 1N8R2 4DGLA 5C3EI 3F3FC 5IT9b 5FLMI 1RO2A 3FKII 3NDIA 5IP9I 2B63I 3CCQ1 3GTJI 1ZB8A 2OOYB 1RQFA 4MXUA 2RBLA 4NBGA 1Q7Y1 1TWAI 4RS4A 1Y8CA 2M48A 2JS4A 3CD61 4DQYB 3NFZA 4MONA 2P28A 4MD9A 1Q861 4DK1A 2NVQI 4A3FI 3HOYI 3CMAZ 4E30A 3M4OI 2KPIA 2ZAEB 3GTPI 2JR6A 3CC2Z 1VQ41 1K83I 3HOVI 2E7ZA 3CPWY 3LUSA 2HU9A 2V45A 1NUIA 5D1OA 2V8IA 3I561 1Q822 2Q4ZA 4QTUA 2RT9A 3CCRZ 1DL6A 1USPB 1KC82 2OTLZ 2JA8I 2GU2A 3GTMS 3VMIA 3CCJ1 3J7A4 3HOZI 2LEXA 2QR1B 1Z01A 3S1MI 3CXCZ 2GTHA 2AKLA 3F3PC 3HOUI 3CCS1 1KD12 2YADA 2R93I 1SFOI 3NH4A 2F4OA 1Y1WI 3CCU1 3OW2Z 1YJ9Z 4NBCA 3GTMI 5T6BA 1ML8A 2OOXB 3CCMZ 1NJI2 1Z02A 3S15I 3KIFA 2NAPA 2WB1A 1RNIA 3NDJA 1YHQZ 4MRIA 3CC7Z 2E2JI 3MONA 2NVYI 4RVFA 2NVXI 1VQ7Z 1QYPA 2QA41 5LL6f 1RLYA 3GCFA 4E2XA 1X3WA 1USPA 2V8JA 1Q862 4RVDA 1YJNZ 5IT9f 3S2HI 3I551 2OTJZ 2PK7A 2VF1A 2H85A 3GTQI 3IF8A 4HGZA 2VUMI 4RV9A 1TWFI 2R6MA 5C4XI 4Y52I 3Q87A 1PFTA 4E32A 1YIJZ 1KD11 3HOWI 1VQP1 1VQ5Z 2JA7I 5D1PA 4HH4A 4A93I 2JIRA 2JMOA 3IFUA 4A3MI 1SIWA 2RIQA 3CPWZ 1NJI1 3S1QI 3J80b 2PM9A 1K732 1VQN1 2E9HA 4NBFA 2W03A 3MZLB 1YIT1 2R92I 3PO2I 3PO3S 2LIYA 2JNYA 3CCQZ 1K9M2 1M1K1 4NBEA 2JIPA 2QEX1 3MZKB 4NB9A 2QRCB 3NH8A 2DE7A 3T4NB 1QVFY 4BXXI 1QXFA 1WIIA 3CCV1 3S1RI 1TFIA 1ZB9A 3QWUA 3PO3I 1VQKZ 3S14I 4QTTA 5T64A 3VB9A 4EWCA 5AN9F 1VQOZ 1FDIA 3H0GI 1VQM1 1VQ61 1TWHI 3GTGI 3EEDA 4Y7NI 2RPRA 5A2Qb 1RO0A 2V3VA 3FQMA 1Q16A 2QREB 4NOZA 1S7MA 3G4SZ 2PMZA 2P3YA 1YI2Z 1K731 2M6NA 2JIMA 2JIQA 4A3DI 2VPXA 1K9M1 1VQL1 1WW9A 2O4HA 2JUBA 3CCJZ 1I3QI 1WCMI 4HGYA 3G6EZ 3GTLI 4NBDA 3S16I 3G71Z 4RVHA 4A3JI 3RZOI 4BY7I 3CMEZ 3CC4Z 2K3RA 1W2BZ 1YUKA 3CCSZ 1VQ8Z 1JJ2Z 3CCUZ 3CCM1 1K8A2 3J81b 3FQQA 1YJW1 1I6HI 3TDHB 2O53A 1M1K2 1KRLA 3GKQA 3CC71 1R9TI 1VQ71 2K5RA 2VPYA 2OZKA 5FLXb 4BBSI 1KQSY 1VQ91 3S17I 3I4NI 1ZH1A 2GTIA 1YJN1 4E31A 4RVGA 1YUAA 2QLVB 2OTJ1 3CCE1 2AYDA 3J80f 1L1OC 3I07A 3VMHA 3IX0A 1LQLA 1QVFZ 3I55Z 1YIJ1 2WAQA 3TE5B 2Q51A 1VQ51 1QF8A 2RHBA 4A3CI 1S721 3OW2Y 3HKZA 2VPWA 3CCLZ 2IV2X 2YU9I 3BG0B 1VQPZ 3I4MI 1Z03A 1K8A1 2JA6I 2R7ZI 2BJOA 2J6AA 1QVGY 3U50C 3H3VJ 1VQNZ 5CM2M 1YITZ 5A2Qf 3P5JB 4E2YA 3K7AI 4A3EI 3CD6Z 3JAMb 2QEXZ 2KI7B 3CMA1 2JIOA 2F4MA 4X6AI 4BY1I 4NBHA 1VQK1 4A3GI 1Q812 4E2ZA 3CC21 3CCVZ 2QRDB 1VQO1 4S1TA 4MD8A 4AYBA 1VQ4Z 5T67A 3BG1B 3CCR1 1VQMZ 3RZDI 3S1NI 2LFUA 2E2HI 1VQ6Z 3I56Z 2OTL1 4A3BI 1Y1VS 1RO4A 3HOXI 4MD7A 1KQSZ 2QKDA 3G4S1 1I50I 3J81f 1YI21 1N8R1 3D6WA 4CL1A 2VUGA 3D2LA 1TWGI 2V8KA 1WZNA 1M902 1YJ91 3G6E1 1VQLZ 5FLXf 4NBBA 1Y1VI 3G711 4A3KI 1NP6A 2JA5I 4NH1C 3CME1 3CC41 1TWCI 2I3CA 3CQZI 4NFRA 1WJ2A 1VQ81 1Q811 2IZ4A 3IR7A 4A3II 4TNUA 1YHQ1 3S2DI 2Y0SA 2HF1A 2DE6A 4BBRI 1YJWZ 1AA6A 4XX2A 3EERA 2QA4Z 1Q7Y2 1QVGZ 4E33A 1X0TA 1Q821 4A3LI 1X3ZA 1JWHC 1VQ9Z 3GTOI 3VMGA 2NVTI 3D9XA 1KC81 3CXCY 3M3YI 1N2FA 3VTNA 1FDOA 2IZ3A 2G2KA 3ESWA 3NH5A 3CCEZ 1M901 2VPZA 2E2II 4NBAA 4E2WA
chains in the Genus database with same CATH topology
2EGTA 5C44I 5IP7I 3CCL1 1VLAA 3JAMf 1W2BY 3KIHA 5C4JI 5D1OB 2DE5A 1JJ2Y 4MH4A 2W04A 1S72Z 3GTKI 1P9NA 4NB8A 1N8R2 4DGLA 5C3EI 3F3FC 5IT9b 5FLMI 1RO2A 3FKII 3NDIA 5IP9I 2B63I 3CCQ1 3GTJI 1ZB8A 2OOYB 1RQFA 4MXUA 2RBLA 4NBGA 1Q7Y1 1TWAI 4RS4A 2M48A 2JS4A 3CD61 4DQYB 3NFZA 4MONA 2P28A 4MD9A 1Q861 4DK1A 2NVQI 4A3FI 3HOYI 3CMAZ 4E30A 3M4OI 2KPIA 2ZAEB 3GTPI 2JR6A 3CC2Z 1VQ41 1K83I 3HOVI 3CPWY 3LUSA 2HU9A 1NUIA 5D1OA 2V8IA 3I561 1Q822 2Q4ZA 4QTUA 2RT9A 3CCRZ 1DL6A 1USPB 1KC82 2OTLZ 2JA8I 2GU2A 3GTMS 3VMIA 3CCJ1 3J7A4 3HOZI 2QR1B 1Z01A 3S1MI 3CXCZ 2GTHA 2AKLA 3F3PC 3HOUI 3CCS1 1KD12 2YADA 2R93I 1SFOI 3NH4A 2F4OA 1Y1WI 3CCU1 3OW2Z 1YJ9Z 4NBCA 3GTMI 5T6BA 1ML8A 2OOXB 3CCMZ 1NJI2 1Z02A 3S15I 3KIFA 2WB1A 1RNIA 3NDJA 1YHQZ 4MRIA 3CC7Z 2E2JI 3MONA 2NVYI 4RVFA 2NVXI 1VQ7Z 1QYPA 2QA41 5LL6f 1RLYA 3GCFA 4E2XA 1X3WA 1USPA 2V8JA 1Q862 4RVDA 1YJNZ 5IT9f 3S2HI 3I551 2OTJZ 2PK7A 2VF1A 2H85A 3GTQI 3IF8A 4HGZA 2VUMI 4RV9A 1TWFI 2R6MA 5C4XI 4Y52I 3Q87A 1PFTA 4E32A 1YIJZ 1KD11 3HOWI 1VQP1 1VQ5Z 2JA7I 5D1PA 4HH4A 4A93I 2JMOA 3IFUA 4A3MI 2RIQA 3CPWZ 1NJI1 3S1QI 3J80b 2PM9A 1K732 1VQN1 2E9HA 3MZLB 2W03A 4NBFA 1YIT1 2R92I 3PO2I 3PO3S 2LIYA 2JNYA 3CCQZ 1K9M2 1M1K1 4NBEA 2QEX1 3MZKB 4NB9A 2QRCB 3NH8A 2DE7A 3T4NB 1QVFY 4BXXI 1WIIA 3CCV1 3S1RI 1TFIA 1ZB9A 3QWUA 3PO3I 1VQKZ 3S14I 4QTTA 5T64A 3VB9A 4EWCA 5AN9F 1VQOZ 3H0GI 1VQM1 1VQ61 1TWHI 3GTGI 3EEDA 4Y7NI 2RPRA 5A2Qb 1RO0A 3FQMA 2QREB 4NOZA 1S7MA 3G4SZ 2PMZA 2P3YA 1YI2Z 1K731 2M6NA 4A3DI 1K9M1 1VQL1 1WW9A 2O4HA 2JUBA 3CCJZ 1I3QI 1WCMI 4HGYA 3G6EZ 3GTLI 4NBDA 3S16I 3G71Z 4RVHA 4A3JI 3RZOI 4BY7I 3CMEZ 3CC4Z 2K3RA 1W2BZ 1YUKA 3CCSZ 1VQ8Z 1JJ2Z 3CCUZ 3CCM1 1K8A2 3J81b 3FQQA 1YJW1 1I6HI 3TDHB 2O53A 1M1K2 1KRLA 3GKQA 3CC71 1R9TI 1VQ71 2K5RA 2OZKA 5FLXb 4BBSI 1KQSY 1VQ91 3S17I 3I4NI 1ZH1A 2GTIA 1YJN1 4E31A 4RVGA 1YUAA 2QLVB 2OTJ1 3CCE1 3J80f 1L1OC 3I07A 3VMHA 3IX0A 1LQLA 1QVFZ 3I55Z 1YIJ1 2WAQA 3TE5B 2Q51A 1VQ51 1QF8A 2RHBA 4A3CI 1S721 3OW2Y 3HKZA 3CCLZ 2YU9I 3BG0B 1VQPZ 3I4MI 1Z03A 1K8A1 2JA6I 2R7ZI 2BJOA 2J6AA 1QVGY 3U50C 3H3VJ 1VQNZ 5CM2M 1YITZ 5A2Qf 3P5JB 4E2YA 3K7AI 4A3EI 3CD6Z 3JAMb 2QEXZ 2KI7B 3CMA1 2F4MA 4X6AI 4BY1I 4NBHA 1VQK1 4A3GI 1Q812 4E2ZA 3CC21 3CCVZ 2QRDB 1VQO1 4S1TA 4MD8A 4AYBA 1VQ4Z 5T67A 3BG1B 3CCR1 1VQMZ 3RZDI 3S1NI 2LFUA 2E2HI 1VQ6Z 3I56Z 2OTL1 4A3BI 1Y1VS 1RO4A 3HOXI 4MD7A 1KQSZ 2QKDA 3G4S1 1I50I 3J81f 1YI21 1N8R1 3D6WA 4CL1A 2VUGA 1TWGI 2V8KA 1M902 1YJ91 3G6E1 1VQLZ 5FLXf 4NBBA 1Y1VI 3G711 4A3KI 1NP6A 2JA5I 4NH1C 3CME1 3CC41 1TWCI 2I3CA 3CQZI 4NFRA 1VQ81 1Q811 2IZ4A 4A3II 4TNUA 1YHQ1 3S2DI 2Y0SA 2HF1A 2DE6A 4BBRI 1YJWZ 4XX2A 3EERA 2QA4Z 1Q7Y2 1QVGZ 4E33A 1X0TA 1Q821 4A3LI 1X3ZA 1JWHC 1VQ9Z 3GTOI 3VMGA 2NVTI 3D9XA 1KC81 3CXCY 3M3YI 1N2FA 3VTNA 2IZ3A 2G2KA 3ESWA 3NH5A 3CCEZ 1M901 2E2II 4NBAA 4E2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 I;  2E2J I;  2NVY I;  2NVX I;  2F4M A;  5IP7 I;  4X6A I;  1VLA A;  1QYP A;  4BY1 I;  4A3D I;  4NBH A;  5C4J I;  1RLY A;  1WW9 A;  4A3G I;  2DE5 A;  3GCF A;  1I3Q I;  4MH4 A;  3GTK I;  1WCM I;  1X3W A;  4NB8 A;  5C3E I;  3GTL I;  5FLM I;  1USP A;  4NBD A;  3FKI I;  3S16 I;  5IP9 I;  4A3J I;  2B63 I;  3RZO I;  3GTJ I;  3S2H I;  4BY7 I;  1ZB8 A;  2RBL A;  4NBG A;  2PK7 A;  3RZD I;  3S1N I;  2E2H I;  3GTQ I;  2VUM I;  1TWF I;  4A3B I;  5C4X I;  4Y52 I;  1TWA I;  3Q87 A;  1PFT A;  1Y1V S;  1RO4 A;  3HOX I;  1I6H I;  3HOW I;  2JS4 A;  1I50 I;  2JA7 I;  3GKQ A;  3D6W A;  1R9T I;  2NVQ I;  4A93 I;  4A3F I;  2K5R A;  4A3M I;  1TWG I;  3HOY I;  4BBS I;  3S1Q I;  3S17 I;  3I4N I;  3M4O I;  2KPI A;  3GTP I;  2JR6 A;  4NBB A;  1Y1V I;  4A3K I;  2JA5 I;  1K83 I;  1YUA A;  3HOV I;  1TWC I;  4NBF A;  1L1O C;  3I07 A;  3VMH A;  3CQZ I;  2R92 I;  3PO2 I;  3LUS A;  3PO3 S;  1NUI A;  1LQL A;  2JNY A;  4NBE A;  4A3I I;  4QTU A;  3S2D I;  1DL6 A;  1USP B;  2HF1 A;  2DE6 A;  4NB9 A;  4BBR I;  2JA8 I;  2DE7 A;  3GTM S;  3VMI A;  4BXX I;  4A3C I;  2YU9 I;  4XX2 A;  3EER A;  3HOZ I;  3S1R I;  1TFI A;  1ZB9 A;  3S1M I;  3PO3 I;  3I4M I;  3S14 I;  4QTT A;  3VB9 A;  2AKL A;  2JA6 I;  3HOU I;  3H0G I;  2R7Z I;  2R93 I;  1SFO I;  4A3L I;  1X3Z A;  1TWH I;  2F4O A;  1Y1W I;  2BJO A;  2J6A A;  3GTO I;  4NBC A;  3VMG A;  3GTG I;  2NVT I;  4Y7N I;  3M3Y I;  3U50 C;  3GTM I;  1N2F A;  1ML8 A;  3H3V J;  3ESW A;  5CM2 M;  3S15 I;  4NOZ A;  2E2I I;  4NBA A;  3K7A I;  4A3E I;  2P3Y A; 
#chains in the Genus database with same CATH topology
 2EGT A;  5C44 I;  5IP7 I;  3CCL 1;  1VLA A;  3JAM f;  1W2B Y;  3KIH A;  5C4J I;  5D1O B;  2DE5 A;  1JJ2 Y;  4MH4 A;  2W04 A;  1S72 Z;  3GTK I;  1P9N A;  4NB8 A;  1N8R 2;  4DGL A;  5C3E I;  3F3F C;  5IT9 b;  5FLM I;  1RO2 A;  3FKI I;  3NDI A;  5IP9 I;  2B63 I;  3CCQ 1;  3GTJ I;  1ZB8 A;  2OOY B;  1RQF A;  4MXU A;  2RBL A;  4NBG A;  1Q7Y 1;  1TWA I;  4RS4 A;  1Y8C A;  2M48 A;  2JS4 A;  3CD6 1;  4DQY B;  3NFZ A;  4MON A;  2P28 A;  4MD9 A;  1Q86 1;  4DK1 A;  2NVQ I;  4A3F I;  3HOY I;  3CMA Z;  4E30 A;  3M4O I;  2KPI A;  2ZAE B;  3GTP I;  2JR6 A;  3CC2 Z;  1VQ4 1;  1K83 I;  3HOV I;  2E7Z A;  3CPW Y;  3LUS A;  2HU9 A;  2V45 A;  1NUI A;  5D1O A;  2V8I A;  3I56 1;  1Q82 2;  2Q4Z A;  4QTU A;  2RT9 A;  3CCR Z;  1DL6 A;  1USP B;  1KC8 2;  2OTL Z;  2JA8 I;  2GU2 A;  3GTM S;  3VMI A;  3CCJ 1;  3J7A 4;  3HOZ I;  2LEX A;  2QR1 B;  1Z01 A;  3S1M I;  3CXC Z;  2GTH A;  2AKL A;  3F3P C;  3HOU I;  3CCS 1;  1KD1 2;  2YAD A;  2R93 I;  1SFO I;  3NH4 A;  2F4O A;  1Y1W I;  3CCU 1;  3OW2 Z;  1YJ9 Z;  4NBC A;  3GTM I;  5T6B A;  1ML8 A;  2OOX B;  3CCM Z;  1NJI 2;  1Z02 A;  3S15 I;  3KIF A;  2NAP A;  2WB1 A;  1RNI A;  3NDJ A;  1YHQ Z;  4MRI A;  3CC7 Z;  2E2J I;  3MON A;  2NVY I;  4RVF A;  2NVX I;  1VQ7 Z;  1QYP A;  2QA4 1;  5LL6 f;  1RLY A;  3GCF A;  4E2X A;  1X3W A;  1USP A;  2V8J A;  1Q86 2;  4RVD A;  1YJN Z;  5IT9 f;  3S2H I;  3I55 1;  2OTJ Z;  2PK7 A;  2VF1 A;  2H85 A;  3GTQ I;  3IF8 A;  4HGZ A;  2VUM I;  4RV9 A;  1TWF I;  2R6M A;  5C4X I;  4Y52 I;  3Q87 A;  1PFT A;  4E32 A;  1YIJ Z;  1KD1 1;  3HOW I;  1VQP 1;  1VQ5 Z;  2JA7 I;  5D1P A;  4HH4 A;  4A93 I;  2JIR A;  2JMO A;  3IFU A;  4A3M I;  1SIW A;  2RIQ A;  3CPW Z;  1NJI 1;  3S1Q I;  3J80 b;  2PM9 A;  1K73 2;  1VQN 1;  2E9H A;  4NBF A;  2W03 A;  3MZL B;  1YIT 1;  2R92 I;  3PO2 I;  3PO3 S;  2LIY A;  2JNY A;  3CCQ Z;  1K9M 2;  1M1K 1;  4NBE A;  2JIP A;  2QEX 1;  3MZK B;  4NB9 A;  2QRC B;  3NH8 A;  2DE7 A;  3T4N B;  1QVF Y;  4BXX I;  1QXF A;  1WII A;  3CCV 1;  3S1R I;  1TFI A;  1ZB9 A;  3QWU A;  3PO3 I;  1VQK Z;  3S14 I;  4QTT A;  5T64 A;  3VB9 A;  4EWC A;  5AN9 F;  1VQO Z;  1FDI A;  3H0G I;  1VQM 1;  1VQ6 1;  1TWH I;  3GTG I;  3EED A;  4Y7N I;  2RPR A;  5A2Q b;  1RO0 A;  2V3V A;  3FQM A;  1Q16 A;  2QRE B;  4NOZ A;  1S7M A;  3G4S Z;  2PMZ A;  2P3Y A;  1YI2 Z;  1K73 1;  2M6N A;  2JIM A;  2JIQ A;  4A3D I;  2VPX A;  1K9M 1;  1VQL 1;  1WW9 A;  2O4H A;  2JUB A;  3CCJ Z;  1I3Q I;  1WCM I;  4HGY A;  3G6E Z;  3GTL I;  4NBD A;  3S16 I;  3G71 Z;  4RVH A;  4A3J I;  3RZO I;  4BY7 I;  3CME Z;  3CC4 Z;  2K3R A;  1W2B Z;  1YUK A;  3CCS Z;  1VQ8 Z;  1JJ2 Z;  3CCU Z;  3CCM 1;  1K8A 2;  3J81 b;  3FQQ A;  1YJW 1;  1I6H I;  3TDH B;  2O53 A;  1M1K 2;  1KRL A;  3GKQ A;  3CC7 1;  1R9T I;  1VQ7 1;  2K5R A;  2VPY A;  2OZK A;  5FLX b;  4BBS I;  1KQS Y;  1VQ9 1;  3S17 I;  3I4N I;  1ZH1 A;  2GTI A;  1YJN 1;  4E31 A;  4RVG A;  1YUA A;  2QLV B;  2OTJ 1;  3CCE 1;  2AYD A;  3J80 f;  1L1O C;  3I07 A;  3VMH A;  3IX0 A;  1LQL A;  1QVF Z;  3I55 Z;  1YIJ 1;  2WAQ A;  3TE5 B;  2Q51 A;  1VQ5 1;  1QF8 A;  2RHB A;  4A3C I;  1S72 1;  3OW2 Y;  3HKZ A;  2VPW A;  3CCL Z;  2IV2 X;  2YU9 I;  3BG0 B;  1VQP Z;  3I4M I;  1Z03 A;  1K8A 1;  2JA6 I;  2R7Z I;  2BJO A;  2J6A A;  1QVG Y;  3U50 C;  3H3V J;  1VQN Z;  5CM2 M;  1YIT Z;  5A2Q f;  3P5J B;  4E2Y A;  3K7A I;  4A3E I;  3CD6 Z;  3JAM b;  2QEX Z;  2KI7 B;  3CMA 1;  2JIO A;  2F4M A;  4X6A I;  4BY1 I;  4NBH A;  1VQK 1;  4A3G I;  1Q81 2;  4E2Z A;  3CC2 1;  3CCV Z;  2QRD B;  1VQO 1;  4S1T A;  4MD8 A;  4AYB A;  1VQ4 Z;  5T67 A;  3BG1 B;  3CCR 1;  1VQM Z;  3RZD I;  3S1N I;  2LFU A;  2E2H I;  1VQ6 Z;  3I56 Z;  2OTL 1;  4A3B I;  1Y1V S;  1RO4 A;  3HOX I;  4MD7 A;  1KQS Z;  2QKD A;  3G4S 1;  1I50 I;  3J81 f;  1YI2 1;  1N8R 1;  3D6W A;  4CL1 A;  2VUG A;  3D2L A;  1TWG I;  2V8K A;  1WZN A;  1M90 2;  1YJ9 1;  3G6E 1;  1VQL Z;  5FLX f;  4NBB A;  1Y1V I;  3G71 1;  4A3K I;  1NP6 A;  2JA5 I;  4NH1 C;  3CME 1;  3CC4 1;  1TWC I;  2I3C A;  3CQZ I;  4NFR A;  1WJ2 A;  1VQ8 1;  1Q81 1;  2IZ4 A;  3IR7 A;  4A3I I;  4TNU A;  1YHQ 1;  3S2D I;  2Y0S A;  2HF1 A;  2DE6 A;  4BBR I;  1YJW Z;  1AA6 A;  4XX2 A;  3EER A;  2QA4 Z;  1Q7Y 2;  1QVG Z;  4E33 A;  1X0T A;  1Q82 1;  4A3L I;  1X3Z A;  1JWH C;  1VQ9 Z;  3GTO I;  3VMG A;  2NVT I;  3D9X A;  1KC8 1;  3CXC Y;  3M3Y I;  1N2F A;  3VTN A;  1FDO A;  2IZ3 A;  2G2K A;  3ESW A;  3NH5 A;  3CCE Z;  1M90 1;  2VPZ A;  2E2I I;  4NBA A;  4E2W A; 
#chains in the Genus database with same CATH homology
 2EGT A;  5C44 I;  5IP7 I;  3CCL 1;  1VLA A;  3JAM f;  1W2B Y;  3KIH A;  5C4J I;  5D1O B;  2DE5 A;  1JJ2 Y;  4MH4 A;  2W04 A;  1S72 Z;  3GTK I;  1P9N A;  4NB8 A;  1N8R 2;  4DGL A;  5C3E I;  3F3F C;  5IT9 b;  5FLM I;  1RO2 A;  3FKI I;  3NDI A;  5IP9 I;  2B63 I;  3CCQ 1;  3GTJ I;  1ZB8 A;  2OOY B;  1RQF A;  4MXU A;  2RBL A;  4NBG A;  1Q7Y 1;  1TWA I;  4RS4 A;  2M48 A;  2JS4 A;  3CD6 1;  4DQY B;  3NFZ A;  4MON A;  2P28 A;  4MD9 A;  1Q86 1;  4DK1 A;  2NVQ I;  4A3F I;  3HOY I;  3CMA Z;  4E30 A;  3M4O I;  2KPI A;  2ZAE B;  3GTP I;  2JR6 A;  3CC2 Z;  1VQ4 1;  1K83 I;  3HOV I;  3CPW Y;  3LUS A;  2HU9 A;  1NUI A;  5D1O A;  2V8I A;  3I56 1;  1Q82 2;  2Q4Z A;  4QTU A;  2RT9 A;  3CCR Z;  1DL6 A;  1USP B;  1KC8 2;  2OTL Z;  2JA8 I;  2GU2 A;  3GTM S;  3VMI A;  3CCJ 1;  3J7A 4;  3HOZ I;  2QR1 B;  1Z01 A;  3S1M I;  3CXC Z;  2GTH A;  2AKL A;  3F3P C;  3HOU I;  3CCS 1;  1KD1 2;  2YAD A;  2R93 I;  1SFO I;  3NH4 A;  2F4O A;  1Y1W I;  3CCU 1;  3OW2 Z;  1YJ9 Z;  4NBC A;  3GTM I;  5T6B A;  1ML8 A;  2OOX B;  3CCM Z;  1NJI 2;  1Z02 A;  3S15 I;  3KIF A;  2WB1 A;  1RNI A;  3NDJ A;  1YHQ Z;  4MRI A;  3CC7 Z;  2E2J I;  3MON A;  2NVY I;  4RVF A;  2NVX I;  1VQ7 Z;  1QYP A;  2QA4 1;  5LL6 f;  1RLY A;  3GCF A;  4E2X A;  1X3W A;  1USP A;  2V8J A;  1Q86 2;  4RVD A;  1YJN Z;  5IT9 f;  3S2H I;  3I55 1;  2OTJ Z;  2PK7 A;  2VF1 A;  2H85 A;  3GTQ I;  3IF8 A;  4HGZ A;  2VUM I;  4RV9 A;  1TWF I;  2R6M A;  5C4X I;  4Y52 I;  3Q87 A;  1PFT A;  4E32 A;  1YIJ Z;  1KD1 1;  3HOW I;  1VQP 1;  1VQ5 Z;  2JA7 I;  5D1P A;  4HH4 A;  4A93 I;  2JMO A;  3IFU A;  4A3M I;  2RIQ A;  3CPW Z;  1NJI 1;  3S1Q I;  3J80 b;  2PM9 A;  1K73 2;  1VQN 1;  2E9H A;  3MZL B;  2W03 A;  4NBF A;  1YIT 1;  2R92 I;  3PO2 I;  3PO3 S;  2LIY A;  2JNY A;  3CCQ Z;  1K9M 2;  1M1K 1;  4NBE A;  2QEX 1;  3MZK B;  4NB9 A;  2QRC B;  3NH8 A;  2DE7 A;  3T4N B;  1QVF Y;  4BXX I;  1WII A;  3CCV 1;  3S1R I;  1TFI A;  1ZB9 A;  3QWU A;  3PO3 I;  1VQK Z;  3S14 I;  4QTT A;  5T64 A;  3VB9 A;  4EWC A;  5AN9 F;  1VQO Z;  3H0G I;  1VQM 1;  1VQ6 1;  1TWH I;  3GTG I;  3EED A;  4Y7N I;  2RPR A;  5A2Q b;  1RO0 A;  3FQM A;  2QRE B;  4NOZ A;  1S7M A;  3G4S Z;  2PMZ A;  2P3Y A;  1YI2 Z;  1K73 1;  2M6N A;  4A3D I;  1K9M 1;  1VQL 1;  1WW9 A;  2O4H A;  2JUB A;  3CCJ Z;  1I3Q I;  1WCM I;  4HGY A;  3G6E Z;  3GTL I;  4NBD A;  3S16 I;  3G71 Z;  4RVH A;  4A3J I;  3RZO I;  4BY7 I;  3CME Z;  3CC4 Z;  2K3R A;  1W2B Z;  1YUK A;  3CCS Z;  1VQ8 Z;  1JJ2 Z;  3CCU Z;  3CCM 1;  1K8A 2;  3J81 b;  3FQQ A;  1YJW 1;  1I6H I;  3TDH B;  2O53 A;  1M1K 2;  1KRL A;  3GKQ A;  3CC7 1;  1R9T I;  1VQ7 1;  2K5R A;  2OZK A;  5FLX b;  4BBS I;  1KQS Y;  1VQ9 1;  3S17 I;  3I4N I;  1ZH1 A;  2GTI A;  1YJN 1;  4E31 A;  4RVG A;  1YUA A;  2QLV B;  2OTJ 1;  3CCE 1;  3J80 f;  1L1O C;  3I07 A;  3VMH A;  3IX0 A;  1LQL A;  1QVF Z;  3I55 Z;  1YIJ 1;  2WAQ A;  3TE5 B;  2Q51 A;  1VQ5 1;  1QF8 A;  2RHB A;  4A3C I;  1S72 1;  3OW2 Y;  3HKZ A;  3CCL Z;  2YU9 I;  3BG0 B;  1VQP Z;  3I4M I;  1Z03 A;  1K8A 1;  2JA6 I;  2R7Z I;  2BJO A;  2J6A A;  1QVG Y;  3U50 C;  3H3V J;  1VQN Z;  5CM2 M;  1YIT Z;  5A2Q f;  3P5J B;  4E2Y A;  3K7A I;  4A3E I;  3CD6 Z;  3JAM b;  2QEX Z;  2KI7 B;  3CMA 1;  2F4M A;  4X6A I;  4BY1 I;  4NBH A;  1VQK 1;  4A3G I;  1Q81 2;  4E2Z A;  3CC2 1;  3CCV Z;  2QRD B;  1VQO 1;  4S1T A;  4MD8 A;  4AYB A;  1VQ4 Z;  5T67 A;  3BG1 B;  3CCR 1;  1VQM Z;  3RZD I;  3S1N I;  2LFU A;  2E2H I;  1VQ6 Z;  3I56 Z;  2OTL 1;  4A3B I;  1Y1V S;  1RO4 A;  3HOX I;  4MD7 A;  1KQS Z;  2QKD A;  3G4S 1;  1I50 I;  3J81 f;  1YI2 1;  1N8R 1;  3D6W A;  4CL1 A;  2VUG A;  1TWG I;  2V8K A;  1M90 2;  1YJ9 1;  3G6E 1;  1VQL Z;  5FLX f;  4NBB A;  1Y1V I;  3G71 1;  4A3K I;  1NP6 A;  2JA5 I;  4NH1 C;  3CME 1;  3CC4 1;  1TWC I;  2I3C A;  3CQZ I;  4NFR A;  1VQ8 1;  1Q81 1;  2IZ4 A;  4A3I I;  4TNU A;  1YHQ 1;  3S2D I;  2Y0S A;  2HF1 A;  2DE6 A;  4BBR I;  1YJW Z;  4XX2 A;  3EER A;  2QA4 Z;  1Q7Y 2;  1QVG Z;  4E33 A;  1X0T A;  1Q82 1;  4A3L I;  1X3Z A;  1JWH C;  1VQ9 Z;  3GTO I;  3VMG A;  2NVT I;  3D9X A;  1KC8 1;  3CXC Y;  3M3Y I;  1N2F A;  3VTN A;  2IZ3 A;  2G2K A;  3ESW A;  3NH5 A;  3CCE Z;  1M90 1;  2E2I I;  4NBA A;  4E2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...