5IT9b

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
MVLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 4
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9b00
5FLXb 3J80b 5IT9b 5LL6f 3JAMb 3J81b 3J7A4 5A2Qb
chains in the Genus database with same CATH superfamily
1YJW1 1YJN1 1M901 1Q861 3GTQI 3NH4A 1NUIA 4XX2A 3IF8A 2NVYI 3VTNA 2RIQA 4MD8A 1P9NA 1X3ZA 2JIRA 2OTJZ 4DQYB 1NP6A 4HGYA 5T67A 3G711 3HKZA 1NJI2 2PK7A 2OZKA 3F3PC 2HU9A 1TWGI 4A3MI 3VB9A 3CC41 3CCU1 1S7MA 1VQ61 2QA41 2VUMI 3CC4Z 4AYBA 4MH4A 3I561 3CCQZ 4NB9A 2VPZA 2OTLZ 2LFUA 3CCL1 3CC21 1K732 4A3KI 5D1OB 2GTIA 4A3GI 3BG1B 2QRCB 3S16I 1K9M1 5C3EI 2H85A 1VQOZ 1KQSY 2V8JA 1VQ71 3CCEZ 1YIJZ 2RPRA 2E2HI 1QVGY 3G4S1 1Z03A 4RVGA 1YIJ1 1RQFA 1YJ91 1Y1VI 2P3YA 1JWHC 3NDIA 1VQL1 1FDOA 3CC2Z 4X6AI 1RO0A 3HOZI 2M6NA 1VQLZ 4MONA 2DE5A 3T4NB 3LUSA 1VQ9Z 2EGTA 3CPWZ 1Z02A 3NDJA 4E2WA 5IT9f 1VQO1 2KI7B 1N8R1 4EWCA 4RV9A 2QA4Z 1S721 2V3VA 3VMGA 4NB8A 1VQNZ 2V45A 4A3EI 3I56Z 3CME1 3GCFA 5D1OA 3BG0B 2JA6I 2OOXB 1VQMZ 3HOXI 5A2Qb 2JNYA 5FLXb 3OW2Z 1R9TI 2W04A 1QF8A 3HOYI 4NBEA 2JMOA 1KD12 4NBAA 1YI21 2E9HA 1S72Z 1K9M2 3NFZA 1FDIA 3CCE1 2AYDA 4DK1A 3J81f 3FKII 2NVXI 1ZB8A 3CCR1 4A3BI 1JJ2Z 3I4NI 1X3WA 1TWFI 3P5JB 4E31A 2O53A 1VQM1 1USPB 2F4MA 1Q821 3K7AI 3CCMZ 3G71Z 1Y8CA 1KRLA 5CM2M 3S1NI 5IP7I 1USPA 1K8A2 2QREB 5IP9I 2QEX1 3J80f 1YI2Z 3CMA1 2B63I 4E2ZA 4HH4A 3CCSZ 2JS4A 3CCRZ 4CL1A 1YHQZ 4A3LI 3M4OI 2KPIA 2JIMA 3D2LA 2RHBA 3TE5B 4DGLA 2JR6A 3S1MI 3JAMb 3GTKI 4MD9A 1WZNA 2K3RA 5T6BA 1RO2A 2Q4ZA 4E2YA 2R6MA 4RVFA 3JAMf 1Q16A 3IX0A 1QXFA 2YADA 2QRDB 2PMZA 4A3II 1DL6A 1WJ2A 5C44I 3GTJI 1KQSZ 4BY7I 4NBHA 2W03A 3CCS1 3CD6Z 4S1TA 1SFOI 5T64A 3U50C 2AKLA 2VPXA 3IFUA 1I50I 3QWUA 1QYPA 1RO4A 1K8A1 3M3YI 2QR1B 1W2BY 1VQ7Z 2E2JI 2NVQI 1Z01A 1VQ4Z 3HOWI 1Q7Y2 2J6AA 1RNIA 3CCJ1 3CCUZ 3VMIA 4A93I 1YJ9Z 1Q822 3CMAZ 3FQMA 3HOUI 5FLXf 2JA7I 3OW2Y 1YHQ1 2E7ZA 4NBCA 4NH1C 2M48A 1AA6A 4NBGA 2IZ4A 2HF1A 1VQ91 5C4XI 3J7A4 2RT9A 1JJ2Y 4HGZA 4BY1I 1KD11 3CCJZ 1TFIA 3S2HI 2G2KA 2BJOA 5A2Qf 3S17I 2Q51A 1YJNZ 1ZB9A 2OTL1 4NBFA 2QKDA 4QTTA 4QTUA 1Q812 2V8IA 1YUKA 2P28A 3CD61 1QVGZ 3CXCY 3CPWY 3H3VJ 2OTJ1 3S2DI 4Y52I 3G6E1 2VUGA 2GTHA 3D9XA 1N8R2 1YITZ 2I3CA 3NH5A 5D1PA 3TDHB 4TNUA 4E2XA 2IZ3A 3KIFA 2V8KA 4BBRI 4E32A 2LEXA 4MXUA 4Y7NI 1VQP1 3PO3I 1W2BZ 3I55Z 1VQ8Z 3CCQ1 4A3FI 1VQPZ 1KC81 3GTGI 3KIHA 3CCVZ 3S1QI 3GTLI 3NH8A 4A3JI 4A3CI 1KC82 3S1RI 3J80b 2LIYA 1I3QI 3HOVI 2R92I 1X0TA 4E33A 1VQ41 1YIT1 2DE7A 3EERA 2JIQA 3CQZI 1VQKZ 3I07A 1TWAI 3F3FC 3GTMI 2Y0SA 1Y1VS 3G4SZ 4RVHA 3RZOI 1K731 3I551 1VQ81 4NBBA 2E2II 4NBDA 3MONA 2VPYA 1Q811 3GTMS 2YU9I 5LL6f 3CC7Z 2JUBA 1Y1WI 3PO3S 1QVFZ 2R7ZI 1WW9A 2IV2X 4NFRA 3S14I 2K5RA 1YUAA 3RZDI 1VQK1 1N2FA 2F4OA 1YJWZ 1LQLA 3CXCZ 1NJI1 5FLMI 4RS4A 1I6HI 2O4HA 1ML8A 1VQN1 1QVFY 2PM9A 4MD7A 3ESWA 4BXXI 3CCLZ 3CC71 2RBLA 3G6EZ 3GKQA 3CCV1 5C4JI 4RVDA 1VQ51 1Q862 1M902 2JIPA 3MZKB 1K83I 3MZLB 1SIWA 1Q7Y1 3EEDA 2QEXZ 4NOZA 4MRIA 3GTPI 1M1K1 4BBSI 1ZH1A 3PO2I 2QLVB 2NAPA 1WIIA 2VPWA 3I4MI 2GU2A 3FQQA 1WCMI 3D6WA 3H0GI 3CMEZ 2ZAEB 2JA5I 2R93I 5IT9b 3IR7A 1RLYA 3GTOI 2OOYB 4E30A 4A3DI 2JA8I 3J81b 3Q87A 1TWHI 1VQ5Z 2DE6A 1M1K2 1VLAA 3CCM1 2WB1A 2VF1A 1PFTA 2WAQA 5AN9F 2NVTI 2JIOA 1L1OC 1VQ6Z 1TWCI 3VMHA 3S15I
chains in the Genus database with same CATH topology
1YJW1 1YJN1 1M901 1Q861 3GTQI 3NH4A 1NUIA 4XX2A 3IF8A 2NVYI 3VTNA 2RIQA 4MD8A 1P9NA 1X3ZA 2OTJZ 4DQYB 1NP6A 4HGYA 5T67A 3G711 3HKZA 1NJI2 2PK7A 2OZKA 3F3PC 2HU9A 1TWGI 4A3MI 3VB9A 3CC41 3CCU1 1S7MA 1VQ61 2QA41 2VUMI 3CC4Z 4AYBA 4MH4A 3I561 3CCQZ 4NB9A 2OTLZ 2LFUA 3CCL1 3CC21 1K732 4A3KI 5D1OB 2GTIA 4A3GI 3BG1B 2QRCB 3S16I 1K9M1 5C3EI 2H85A 1VQOZ 1KQSY 2V8JA 1VQ71 3CCEZ 1YIJZ 2RPRA 2E2HI 1QVGY 3G4S1 1Z03A 4RVGA 1YIJ1 1RQFA 1YJ91 1Y1VI 2P3YA 1JWHC 3NDIA 1VQL1 3CC2Z 4X6AI 1RO0A 3HOZI 2M6NA 1VQLZ 4MONA 2DE5A 3T4NB 3LUSA 1VQ9Z 2EGTA 1Z02A 3NDJA 4E2WA 3CPWZ 5IT9f 1VQO1 2KI7B 1N8R1 4EWCA 4RV9A 2QA4Z 1S721 1VQNZ 3VMGA 4NB8A 4A3EI 3I56Z 3CME1 3GCFA 5D1OA 3BG0B 2JA6I 2OOXB 1VQMZ 3HOXI 5A2Qb 2JNYA 5FLXb 3OW2Z 1R9TI 2W04A 1QF8A 3HOYI 4NBEA 2JMOA 1KD12 4NBAA 1YI21 2E9HA 1S72Z 1K9M2 3NFZA 3CCE1 4DK1A 3J81f 3FKII 2NVXI 1ZB8A 3CCR1 4A3BI 1JJ2Z 3I4NI 1X3WA 1TWFI 3P5JB 4E31A 2O53A 1VQM1 1USPB 2F4MA 1Q821 3K7AI 3CCMZ 3G71Z 1KRLA 5CM2M 3S1NI 5IP7I 1USPA 1K8A2 2QREB 5IP9I 2QEX1 3J80f 1YI2Z 3CMA1 2B63I 4E2ZA 4HH4A 3CCSZ 2JS4A 3CCRZ 4CL1A 1YHQZ 4A3LI 3M4OI 2KPIA 2RHBA 3TE5B 4DGLA 2JR6A 3S1MI 3JAMb 3GTKI 4MD9A 2K3RA 5T6BA 1RO2A 2Q4ZA 4E2YA 2R6MA 4RVFA 3JAMf 3IX0A 2YADA 2QRDB 2PMZA 4A3II 1DL6A 5C44I 3GTJI 1KQSZ 4BY7I 4NBHA 2W03A 3CCS1 3CD6Z 4S1TA 1SFOI 5T64A 3U50C 2AKLA 3IFUA 1I50I 3QWUA 1QYPA 1RO4A 1K8A1 3M3YI 2QR1B 1W2BY 1VQ7Z 2E2JI 2NVQI 1Z01A 1VQ4Z 3HOWI 1Q7Y2 2J6AA 1RNIA 3CCJ1 3CCUZ 3VMIA 4A93I 1YJ9Z 1Q822 3CMAZ 3FQMA 3HOUI 5FLXf 2JA7I 3OW2Y 1YHQ1 4NBCA 4NH1C 2M48A 4NBGA 2IZ4A 2HF1A 1VQ91 5C4XI 3J7A4 2RT9A 1JJ2Y 4HGZA 4BY1I 1KD11 3CCJZ 1TFIA 3S2HI 2G2KA 2BJOA 5A2Qf 3S17I 2Q51A 1YJNZ 1ZB9A 2OTL1 4NBFA 2QKDA 4QTTA 4QTUA 1Q812 2V8IA 1YUKA 2P28A 3CD61 1QVGZ 3CXCY 3CPWY 3H3VJ 2OTJ1 3S2DI 4Y52I 3G6E1 2VUGA 2GTHA 3D9XA 1N8R2 1YITZ 2I3CA 3NH5A 5D1PA 3TDHB 4TNUA 4E2XA 2IZ3A 3KIFA 2V8KA 4BBRI 4E32A 4MXUA 4Y7NI 1VQP1 3PO3I 1W2BZ 3I55Z 1VQ8Z 3CCQ1 4A3FI 1VQPZ 1KC81 3GTGI 3KIHA 3CCVZ 3S1QI 3GTLI 3NH8A 4A3JI 4A3CI 1KC82 3S1RI 3J80b 2LIYA 1I3QI 3HOVI 2R92I 1X0TA 4E33A 1VQ41 1YIT1 2DE7A 3EERA 3CQZI 1VQKZ 3I07A 1TWAI 3F3FC 3GTMI 2Y0SA 1Y1VS 3G4SZ 4RVHA 3RZOI 1K731 3I551 1VQ81 4NBBA 2E2II 4NBDA 3MONA 1Q811 3GTMS 2YU9I 5LL6f 3CC7Z 2JUBA 1Y1WI 3PO3S 1QVFZ 2R7ZI 1WW9A 4NFRA 3S14I 2K5RA 1YUAA 3RZDI 1VQK1 1N2FA 2F4OA 1YJWZ 1LQLA 3CXCZ 1NJI1 5FLMI 4RS4A 1I6HI 2O4HA 1ML8A 1VQN1 1QVFY 2PM9A 4MD7A 3ESWA 4BXXI 3CCLZ 3CC71 2RBLA 3G6EZ 3GKQA 3CCV1 5C4JI 4RVDA 1VQ51 1Q862 1M902 3MZKB 1K83I 3MZLB 1Q7Y1 3EEDA 2QEXZ 4NOZA 4MRIA 3GTPI 1M1K1 4BBSI 1ZH1A 3PO2I 2QLVB 1WIIA 3I4MI 2GU2A 3FQQA 1WCMI 3D6WA 3H0GI 3CMEZ 2ZAEB 2JA5I 2R93I 5IT9b 1RLYA 3GTOI 2OOYB 4E30A 4A3DI 2JA8I 3J81b 3Q87A 1TWHI 1VQ5Z 2DE6A 1M1K2 1VLAA 3CCM1 2WB1A 2VF1A 1PFTA 2WAQA 5AN9F 2NVTI 1L1OC 1VQ6Z 1TWCI 3VMHA 3S15I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX b;  3J80 b;  5IT9 b;  5LL6 f;  3JAM b;  3J81 b;  3J7A 4;  5A2Q b; 
#chains in the Genus database with same CATH topology
 1YJW 1;  1YJN 1;  1M90 1;  1Q86 1;  3GTQ I;  3NH4 A;  1NUI A;  4XX2 A;  3IF8 A;  2NVY I;  3VTN A;  2RIQ A;  4MD8 A;  1P9N A;  1X3Z A;  2JIR A;  2OTJ Z;  4DQY B;  1NP6 A;  4HGY A;  5T67 A;  3G71 1;  3HKZ A;  1NJI 2;  2PK7 A;  2OZK A;  3F3P C;  2HU9 A;  1TWG I;  4A3M I;  3VB9 A;  3CC4 1;  3CCU 1;  1S7M A;  1VQ6 1;  2QA4 1;  2VUM I;  3CC4 Z;  4AYB A;  4MH4 A;  3I56 1;  3CCQ Z;  4NB9 A;  2VPZ A;  2OTL Z;  2LFU A;  3CCL 1;  3CC2 1;  1K73 2;  4A3K I;  5D1O B;  2GTI A;  4A3G I;  3BG1 B;  2QRC B;  3S16 I;  1K9M 1;  5C3E I;  2H85 A;  1VQO Z;  1KQS Y;  2V8J A;  1VQ7 1;  3CCE Z;  1YIJ Z;  2RPR A;  2E2H I;  1QVG Y;  3G4S 1;  1Z03 A;  4RVG A;  1YIJ 1;  1RQF A;  1YJ9 1;  1Y1V I;  2P3Y A;  1JWH C;  3NDI A;  1VQL 1;  1FDO A;  3CC2 Z;  4X6A I;  1RO0 A;  3HOZ I;  2M6N A;  1VQL Z;  4MON A;  2DE5 A;  3T4N B;  3LUS A;  1VQ9 Z;  2EGT A;  3CPW Z;  1Z02 A;  3NDJ A;  4E2W A;  5IT9 f;  1VQO 1;  2KI7 B;  1N8R 1;  4EWC A;  4RV9 A;  2QA4 Z;  1S72 1;  2V3V A;  3VMG A;  4NB8 A;  1VQN Z;  2V45 A;  4A3E I;  3I56 Z;  3CME 1;  3GCF A;  5D1O A;  3BG0 B;  2JA6 I;  2OOX B;  1VQM Z;  3HOX I;  5A2Q b;  2JNY A;  5FLX b;  3OW2 Z;  1R9T I;  2W04 A;  1QF8 A;  3HOY I;  4NBE A;  2JMO A;  1KD1 2;  4NBA A;  1YI2 1;  2E9H A;  1S72 Z;  1K9M 2;  3NFZ A;  1FDI A;  3CCE 1;  2AYD A;  4DK1 A;  3J81 f;  3FKI I;  2NVX I;  1ZB8 A;  3CCR 1;  4A3B I;  1JJ2 Z;  3I4N I;  1X3W A;  1TWF I;  3P5J B;  4E31 A;  2O53 A;  1VQM 1;  1USP B;  2F4M A;  1Q82 1;  3K7A I;  3CCM Z;  3G71 Z;  1Y8C A;  1KRL A;  5CM2 M;  3S1N I;  5IP7 I;  1USP A;  1K8A 2;  2QRE B;  5IP9 I;  2QEX 1;  3J80 f;  1YI2 Z;  3CMA 1;  2B63 I;  4E2Z A;  4HH4 A;  3CCS Z;  2JS4 A;  3CCR Z;  4CL1 A;  1YHQ Z;  4A3L I;  3M4O I;  2KPI A;  2JIM A;  3D2L A;  2RHB A;  3TE5 B;  4DGL A;  2JR6 A;  3S1M I;  3JAM b;  3GTK I;  4MD9 A;  1WZN A;  2K3R A;  5T6B A;  1RO2 A;  2Q4Z A;  4E2Y A;  2R6M A;  4RVF A;  3JAM f;  1Q16 A;  3IX0 A;  1QXF A;  2YAD A;  2QRD B;  2PMZ A;  4A3I I;  1DL6 A;  1WJ2 A;  5C44 I;  3GTJ I;  1KQS Z;  4BY7 I;  4NBH A;  2W03 A;  3CCS 1;  3CD6 Z;  4S1T A;  1SFO I;  5T64 A;  3U50 C;  2AKL A;  2VPX A;  3IFU A;  1I50 I;  3QWU A;  1QYP A;  1RO4 A;  1K8A 1;  3M3Y I;  2QR1 B;  1W2B Y;  1VQ7 Z;  2E2J I;  2NVQ I;  1Z01 A;  1VQ4 Z;  3HOW I;  1Q7Y 2;  2J6A A;  1RNI A;  3CCJ 1;  3CCU Z;  3VMI A;  4A93 I;  1YJ9 Z;  1Q82 2;  3CMA Z;  3FQM A;  3HOU I;  5FLX f;  2JA7 I;  3OW2 Y;  1YHQ 1;  2E7Z A;  4NBC A;  4NH1 C;  2M48 A;  1AA6 A;  4NBG A;  2IZ4 A;  2HF1 A;  1VQ9 1;  5C4X I;  3J7A 4;  2RT9 A;  1JJ2 Y;  4HGZ A;  4BY1 I;  1KD1 1;  3CCJ Z;  1TFI A;  3S2H I;  2G2K A;  2BJO A;  5A2Q f;  3S17 I;  2Q51 A;  1YJN Z;  1ZB9 A;  2OTL 1;  4NBF A;  2QKD A;  4QTT A;  4QTU A;  1Q81 2;  2V8I A;  1YUK A;  2P28 A;  3CD6 1;  1QVG Z;  3CXC Y;  3CPW Y;  3H3V J;  2OTJ 1;  3S2D I;  4Y52 I;  3G6E 1;  2VUG A;  2GTH A;  3D9X A;  1N8R 2;  1YIT Z;  2I3C A;  3NH5 A;  5D1P A;  3TDH B;  4TNU A;  4E2X A;  2IZ3 A;  3KIF A;  2V8K A;  4BBR I;  4E32 A;  2LEX A;  4MXU A;  4Y7N I;  1VQP 1;  3PO3 I;  1W2B Z;  3I55 Z;  1VQ8 Z;  3CCQ 1;  4A3F I;  1VQP Z;  1KC8 1;  3GTG I;  3KIH A;  3CCV Z;  3S1Q I;  3GTL I;  3NH8 A;  4A3J I;  4A3C I;  1KC8 2;  3S1R I;  3J80 b;  2LIY A;  1I3Q I;  3HOV I;  2R92 I;  1X0T A;  4E33 A;  1VQ4 1;  1YIT 1;  2DE7 A;  3EER A;  2JIQ A;  3CQZ I;  1VQK Z;  3I07 A;  1TWA I;  3F3F C;  3GTM I;  2Y0S A;  1Y1V S;  3G4S Z;  4RVH A;  3RZO I;  1K73 1;  3I55 1;  1VQ8 1;  4NBB A;  2E2I I;  4NBD A;  3MON A;  2VPY A;  1Q81 1;  3GTM S;  2YU9 I;  5LL6 f;  3CC7 Z;  2JUB A;  1Y1W I;  3PO3 S;  1QVF Z;  2R7Z I;  1WW9 A;  2IV2 X;  4NFR A;  3S14 I;  2K5R A;  1YUA A;  3RZD I;  1VQK 1;  1N2F A;  2F4O A;  1YJW Z;  1LQL A;  3CXC Z;  1NJI 1;  5FLM I;  4RS4 A;  1I6H I;  2O4H A;  1ML8 A;  1VQN 1;  1QVF Y;  2PM9 A;  4MD7 A;  3ESW A;  4BXX I;  3CCL Z;  3CC7 1;  2RBL A;  3G6E Z;  3GKQ A;  3CCV 1;  5C4J I;  4RVD A;  1VQ5 1;  1Q86 2;  1M90 2;  2JIP A;  3MZK B;  1K83 I;  3MZL B;  1SIW A;  1Q7Y 1;  3EED A;  2QEX Z;  4NOZ A;  4MRI A;  3GTP I;  1M1K 1;  4BBS I;  1ZH1 A;  3PO2 I;  2QLV B;  2NAP A;  1WII A;  2VPW A;  3I4M I;  2GU2 A;  3FQQ A;  1WCM I;  3D6W A;  3H0G I;  3CME Z;  2ZAE B;  2JA5 I;  2R93 I;  5IT9 b;  3IR7 A;  1RLY A;  3GTO I;  2OOY B;  4E30 A;  4A3D I;  2JA8 I;  3J81 b;  3Q87 A;  1TWH I;  1VQ5 Z;  2DE6 A;  1M1K 2;  1VLA A;  3CCM 1;  2WB1 A;  2VF1 A;  1PFT A;  2WAQ A;  5AN9 F;  2NVT I;  2JIO A;  1L1O C;  1VQ6 Z;  1TWC I;  3VMH A;  3S15 I; 
#chains in the Genus database with same CATH homology
 1YJW 1;  1YJN 1;  1M90 1;  1Q86 1;  3GTQ I;  3NH4 A;  1NUI A;  4XX2 A;  3IF8 A;  2NVY I;  3VTN A;  2RIQ A;  4MD8 A;  1P9N A;  1X3Z A;  2OTJ Z;  4DQY B;  1NP6 A;  4HGY A;  5T67 A;  3G71 1;  3HKZ A;  1NJI 2;  2PK7 A;  2OZK A;  3F3P C;  2HU9 A;  1TWG I;  4A3M I;  3VB9 A;  3CC4 1;  3CCU 1;  1S7M A;  1VQ6 1;  2QA4 1;  2VUM I;  3CC4 Z;  4AYB A;  4MH4 A;  3I56 1;  3CCQ Z;  4NB9 A;  2OTL Z;  2LFU A;  3CCL 1;  3CC2 1;  1K73 2;  4A3K I;  5D1O B;  2GTI A;  4A3G I;  3BG1 B;  2QRC B;  3S16 I;  1K9M 1;  5C3E I;  2H85 A;  1VQO Z;  1KQS Y;  2V8J A;  1VQ7 1;  3CCE Z;  1YIJ Z;  2RPR A;  2E2H I;  1QVG Y;  3G4S 1;  1Z03 A;  4RVG A;  1YIJ 1;  1RQF A;  1YJ9 1;  1Y1V I;  2P3Y A;  1JWH C;  3NDI A;  1VQL 1;  3CC2 Z;  4X6A I;  1RO0 A;  3HOZ I;  2M6N A;  1VQL Z;  4MON A;  2DE5 A;  3T4N B;  3LUS A;  1VQ9 Z;  2EGT A;  1Z02 A;  3NDJ A;  4E2W A;  3CPW Z;  5IT9 f;  1VQO 1;  2KI7 B;  1N8R 1;  4EWC A;  4RV9 A;  2QA4 Z;  1S72 1;  1VQN Z;  3VMG A;  4NB8 A;  4A3E I;  3I56 Z;  3CME 1;  3GCF A;  5D1O A;  3BG0 B;  2JA6 I;  2OOX B;  1VQM Z;  3HOX I;  5A2Q b;  2JNY A;  5FLX b;  3OW2 Z;  1R9T I;  2W04 A;  1QF8 A;  3HOY I;  4NBE A;  2JMO A;  1KD1 2;  4NBA A;  1YI2 1;  2E9H A;  1S72 Z;  1K9M 2;  3NFZ A;  3CCE 1;  4DK1 A;  3J81 f;  3FKI I;  2NVX I;  1ZB8 A;  3CCR 1;  4A3B I;  1JJ2 Z;  3I4N I;  1X3W A;  1TWF I;  3P5J B;  4E31 A;  2O53 A;  1VQM 1;  1USP B;  2F4M A;  1Q82 1;  3K7A I;  3CCM Z;  3G71 Z;  1KRL A;  5CM2 M;  3S1N I;  5IP7 I;  1USP A;  1K8A 2;  2QRE B;  5IP9 I;  2QEX 1;  3J80 f;  1YI2 Z;  3CMA 1;  2B63 I;  4E2Z A;  4HH4 A;  3CCS Z;  2JS4 A;  3CCR Z;  4CL1 A;  1YHQ Z;  4A3L I;  3M4O I;  2KPI A;  2RHB A;  3TE5 B;  4DGL A;  2JR6 A;  3S1M I;  3JAM b;  3GTK I;  4MD9 A;  2K3R A;  5T6B A;  1RO2 A;  2Q4Z A;  4E2Y A;  2R6M A;  4RVF A;  3JAM f;  3IX0 A;  2YAD A;  2QRD B;  2PMZ A;  4A3I I;  1DL6 A;  5C44 I;  3GTJ I;  1KQS Z;  4BY7 I;  4NBH A;  2W03 A;  3CCS 1;  3CD6 Z;  4S1T A;  1SFO I;  5T64 A;  3U50 C;  2AKL A;  3IFU A;  1I50 I;  3QWU A;  1QYP A;  1RO4 A;  1K8A 1;  3M3Y I;  2QR1 B;  1W2B Y;  1VQ7 Z;  2E2J I;  2NVQ I;  1Z01 A;  1VQ4 Z;  3HOW I;  1Q7Y 2;  2J6A A;  1RNI A;  3CCJ 1;  3CCU Z;  3VMI A;  4A93 I;  1YJ9 Z;  1Q82 2;  3CMA Z;  3FQM A;  3HOU I;  5FLX f;  2JA7 I;  3OW2 Y;  1YHQ 1;  4NBC A;  4NH1 C;  2M48 A;  4NBG A;  2IZ4 A;  2HF1 A;  1VQ9 1;  5C4X I;  3J7A 4;  2RT9 A;  1JJ2 Y;  4HGZ A;  4BY1 I;  1KD1 1;  3CCJ Z;  1TFI A;  3S2H I;  2G2K A;  2BJO A;  5A2Q f;  3S17 I;  2Q51 A;  1YJN Z;  1ZB9 A;  2OTL 1;  4NBF A;  2QKD A;  4QTT A;  4QTU A;  1Q81 2;  2V8I A;  1YUK A;  2P28 A;  3CD6 1;  1QVG Z;  3CXC Y;  3CPW Y;  3H3V J;  2OTJ 1;  3S2D I;  4Y52 I;  3G6E 1;  2VUG A;  2GTH A;  3D9X A;  1N8R 2;  1YIT Z;  2I3C A;  3NH5 A;  5D1P A;  3TDH B;  4TNU A;  4E2X A;  2IZ3 A;  3KIF A;  2V8K A;  4BBR I;  4E32 A;  4MXU A;  4Y7N I;  1VQP 1;  3PO3 I;  1W2B Z;  3I55 Z;  1VQ8 Z;  3CCQ 1;  4A3F I;  1VQP Z;  1KC8 1;  3GTG I;  3KIH A;  3CCV Z;  3S1Q I;  3GTL I;  3NH8 A;  4A3J I;  4A3C I;  1KC8 2;  3S1R I;  3J80 b;  2LIY A;  1I3Q I;  3HOV I;  2R92 I;  1X0T A;  4E33 A;  1VQ4 1;  1YIT 1;  2DE7 A;  3EER A;  3CQZ I;  1VQK Z;  3I07 A;  1TWA I;  3F3F C;  3GTM I;  2Y0S A;  1Y1V S;  3G4S Z;  4RVH A;  3RZO I;  1K73 1;  3I55 1;  1VQ8 1;  4NBB A;  2E2I I;  4NBD A;  3MON A;  1Q81 1;  3GTM S;  2YU9 I;  5LL6 f;  3CC7 Z;  2JUB A;  1Y1W I;  3PO3 S;  1QVF Z;  2R7Z I;  1WW9 A;  4NFR A;  3S14 I;  2K5R A;  1YUA A;  3RZD I;  1VQK 1;  1N2F A;  2F4O A;  1YJW Z;  1LQL A;  3CXC Z;  1NJI 1;  5FLM I;  4RS4 A;  1I6H I;  2O4H A;  1ML8 A;  1VQN 1;  1QVF Y;  2PM9 A;  4MD7 A;  3ESW A;  4BXX I;  3CCL Z;  3CC7 1;  2RBL A;  3G6E Z;  3GKQ A;  3CCV 1;  5C4J I;  4RVD A;  1VQ5 1;  1Q86 2;  1M90 2;  3MZK B;  1K83 I;  3MZL B;  1Q7Y 1;  3EED A;  2QEX Z;  4NOZ A;  4MRI A;  3GTP I;  1M1K 1;  4BBS I;  1ZH1 A;  3PO2 I;  2QLV B;  1WII A;  3I4M I;  2GU2 A;  3FQQ A;  1WCM I;  3D6W A;  3H0G I;  3CME Z;  2ZAE B;  2JA5 I;  2R93 I;  5IT9 b;  1RLY A;  3GTO I;  2OOY B;  4E30 A;  4A3D I;  2JA8 I;  3J81 b;  3Q87 A;  1TWH I;  1VQ5 Z;  2DE6 A;  1M1K 2;  1VLA A;  3CCM 1;  2WB1 A;  2VF1 A;  1PFT A;  2WAQ A;  5AN9 F;  2NVT I;  1L1O C;  1VQ6 Z;  1TWC I;  3VMH A;  3S15 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...