5IT9b

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
MVLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 4
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9b00
5IT9b 3J80b 3J7A4 3JAMb 5A2Qb 5FLXb 5LL6f 3J81b
chains in the Genus database with same CATH superfamily
1ZB9A 1NP6A 3MONA 4A93I 1RQFA 3LUSA 1Q821 2IV2X 2JR6A 3GTMS 3BG0B 4NBFA 4E33A 3CMAZ 5AN9F 3IX0A 3CMEZ 4BY7I 5LL6f 3ESWA 4DGLA 1NJI2 5T64A 5IT9f 2LIYA 3CC7Z 2QEX1 3CCL1 1N2FA 3EERA 4MXUA 2QRDB 2IZ3A 1X3WA 1YI21 3HOZI 2RHBA 3S1QI 1RO4A 4HGYA 5IT9b 1YJ91 3PO2I 3CCEZ 5C4XI 3CCV1 1VQ71 1Q7Y1 1VQK1 2VPXA 2QRCB 2VUMI 3OW2Z 5T6BA 2E2JI 3GKQA 1WIIA 2OTL1 1N8R2 1Y1VS 2OOYB 2I3CA 2JA7I 1S7MA 4RVHA 3RZDI 1Q862 2W04A 4NBEA 4MH4A 3CXCY 3J7A4 1ML8A 3S1RI 3J81f 2QREB 1USPA 3NDJA 3CCVZ 3GTPI 1VQ7Z 1PFTA 2IZ4A 2P28A 2AYDA 1YJW1 2JUBA 1RNIA 3I55Z 1YUKA 3I4MI 1QVFZ 1JWHC 3CC21 4XX2A 3TDHB 3NH5A 4NBHA 2BJOA 1VQP1 2O4HA 4A3EI 3IR7A 2O53A 1K9M1 1P9NA 4A3KI 1K731 1KD12 1Z03A 3QWUA 1ZB8A 1R9TI 4MRIA 1N8R1 2EGTA 4E2WA 4A3II 3CCR1 3HOXI 3K7AI 3BG1B 1Q812 2DE6A 3J80b 4E2YA 4NFRA 1TWFI 1I50I 1VQMZ 3D2LA 2PK7A 1FDOA 3HOUI 2W03A 3IF8A 5D1OA 3U50C 1QVGZ 1QXFA 3S1MI 2YADA 2JIQA 3GTGI 3CD6Z 2JIPA 5A2Qb 1KQSZ 1Q16A 3T4NB 3NH8A 1VQ4Z 2AKLA 2M6NA 3GCFA 4E2ZA 1YIJZ 3VMGA 1K83I 4A3FI 2P3YA 4S1TA 5IP7I 3CC4Z 4MD9A 1TWAI 3CCJZ 3S2DI 1VQ8Z 2YU9I 1YI2Z 3OW2Y 2QKDA 2LEXA 3CD61 2OOXB 3CCS1 1WJ2A 5CM2M 2J6AA 4QTUA 1JJ2Y 4BBRI 2M48A 1VQ5Z 4A3CI 3NFZA 2VUGA 1USPB 3J80f 1QVGY 2JA5I 1TFIA 1M901 2NVYI 2R7ZI 4A3LI 1VQ91 3CCSZ 3FQMA 4DQYB 1K732 3GTMI 1TWHI 3CXCZ 1VQO1 2R6MA 4E30A 3JAMf 1QVFY 3FKII 1YIT1 2V8JA 5FLMI 1VLAA 3MZLB 3CC2Z 1VQ61 2JIRA 3IFUA 3HKZA 1VQKZ 1M1K1 3GTQI 3CCUZ 1Q811 3VMHA 2H85A 2JA8I 2PM9A 2E9HA 2G2KA 3S2HI 1X0TA 1VQLZ 2PMZA 2LFUA 3G6EZ 1AA6A 1KC82 1Y1WI 3H3VJ 3MZKB 2OTJ1 2QA4Z 4A3JI 2RPRA 4NBDA 1YJWZ 2JA6I 4NBAA 3CCQ1 2KI7B 3RZOI 1W2BY 1VQPZ 2RBLA 4A3GI 2V8IA 3P5JB 3G711 3I07A 3F3PC 4NB8A 2QA41 5D1OB 1SIWA 3FQQA 4NH1C 4RVDA 1YHQ1 4A3MI 4RVFA 2GU2A 1YJNZ 2F4MA 1VQNZ 2RT9A 3Q87A 5C3EI 4AYBA 2E2HI 1S72Z 3I4NI 1VQ41 1ZH1A 1SFOI 2DE5A 3HOWI 1KQSY 1M902 4MD8A 3CCRZ 1YHQZ 4RS4A 4E32A 1X3ZA 3VTNA 3CC41 4X6AI 1I3QI 3CCJ1 1VQN1 4DK1A 1Z01A 1NJI1 4BXXI 3CC71 3CCLZ 1NUIA 2R92I 2VF1A 2NVXI 4MONA 4HH4A 1W2BZ 2VPWA 3G4S1 3F3FC 3CCE1 2GTHA 3S17I 4E2XA 3GTKI 1YIJ1 3GTLI 2F4OA 3CMA1 1FDIA 3CME1 1K9M2 2B63I 1VQOZ 2KPIA 2GTIA 2V8KA 4TNUA 2V45A 3TE5B 4CL1A 3CCMZ 3D9XA 4NBBA 2QEXZ 5T67A 1VQ6Z 4BBSI 1Y8CA 3M3YI 1Y1VI 2NVTI 4RVGA 3CCU1 3I551 1K8A2 3KIFA 4NBGA 2QLVB 2Y0SA 1YUAA 1VQ9Z 1TWCI 4NOZA 1RO0A 1QYPA 3EEDA 4NB9A 3G6E1 3J81b 1WZNA 1Q822 1Z02A 3HOYI 1YITZ 2R93I 2JIMA 5A2Qf 1Q861 1LQLA 2JMOA 3VB9A 1JJ2Z 5D1PA 1M1K2 3I56Z 3CPWY 2JS4A 2HF1A 2VPZA 1YJ9Z 3G71Z 2WAQA 1RLYA 3PO3I 1TWGI 2Q4ZA 4A3BI 3S1NI 4Y7NI 5C44I 2OTLZ 3HOVI 3S14I 3JAMb 2V3VA 3VMIA 3I561 2RIQA 3NH4A 4MD7A 2OTJZ 3CPWZ 1K8A1 2JNYA 1KD11 2HU9A 1DL6A 4BY1I 2VPYA 1WW9A 2K5RA 1Q7Y2 3H0GI 3GTOI 2K3RA 3CQZI 1WCMI 3NDIA 1I6HI 1VQL1 2Q51A 1KRLA 1VQM1 1VQ81 4NBCA 1YJN1 2NVQI 4A3DI 1L1OC 3CCQZ 4QTTA 3D6WA 3G4SZ 4RV9A 1VQ51 5C4JI 5IP9I 2JIOA 2E7ZA 2OZKA 3S16I 4HGZA 2DE7A 5FLXf 3CCM1 2ZAEB 3KIHA 2QR1B 1RO2A 3M4OI 5FLXb 2E2II 4Y52I 3PO3S 1KC81 4EWCA 2WB1A 3GTJI 1QF8A 4E31A 2NAPA 3S15I 1S721
chains in the Genus database with same CATH topology
1ZB9A 1NP6A 3MONA 4A93I 1RQFA 3LUSA 1Q821 2JR6A 3GTMS 3BG0B 4NBFA 4E33A 3CMAZ 5AN9F 3IX0A 3CMEZ 4BY7I 5LL6f 3ESWA 4DGLA 1NJI2 5T64A 5IT9f 2LIYA 3CC7Z 2QEX1 3CCL1 1N2FA 3EERA 4MXUA 2QRDB 2IZ3A 1X3WA 1YI21 3HOZI 2RHBA 3S1QI 1RO4A 4HGYA 5IT9b 1YJ91 3PO2I 3CCEZ 5C4XI 3CCV1 1VQ71 1Q7Y1 1VQK1 2QRCB 2VUMI 3OW2Z 5T6BA 2E2JI 3GKQA 1WIIA 2OTL1 1N8R2 1Y1VS 2OOYB 2I3CA 2JA7I 1S7MA 4RVHA 3RZDI 1Q862 2W04A 4NBEA 4MH4A 3CXCY 3J7A4 1ML8A 3S1RI 3J81f 2QREB 1USPA 3NDJA 3CCVZ 3GTPI 1VQ7Z 1PFTA 2IZ4A 2P28A 1YJW1 2JUBA 1RNIA 3I55Z 1YUKA 3I4MI 1QVFZ 1JWHC 3CC21 4XX2A 3TDHB 3NH5A 4NBHA 2BJOA 1VQP1 2O4HA 4A3EI 2O53A 1K9M1 1P9NA 4A3KI 1K731 1KD12 1Z03A 3QWUA 1ZB8A 1R9TI 4MRIA 1N8R1 2EGTA 4E2WA 4A3II 3CCR1 3HOXI 3K7AI 1Q812 3BG1B 2DE6A 3J80b 4E2YA 4NFRA 1TWFI 1I50I 1VQMZ 2PK7A 3HOUI 2W03A 3IF8A 5D1OA 3U50C 1QVGZ 3S1MI 2YADA 3GTGI 3CD6Z 5A2Qb 1KQSZ 3T4NB 3NH8A 1VQ4Z 2AKLA 2M6NA 3GCFA 4E2ZA 1YIJZ 3VMGA 1K83I 4A3FI 2P3YA 4S1TA 5IP7I 3CC4Z 4MD9A 1TWAI 3CCJZ 3S2DI 1VQ8Z 2YU9I 1YI2Z 3OW2Y 2QKDA 3CD61 2OOXB 3CCS1 5CM2M 2J6AA 4QTUA 1JJ2Y 4BBRI 2M48A 1VQ5Z 4A3CI 3NFZA 2VUGA 1USPB 3J80f 1QVGY 2JA5I 1TFIA 1M901 2NVYI 2R7ZI 4A3LI 1VQ91 3CCSZ 3FQMA 4DQYB 1K732 3GTMI 1TWHI 3CXCZ 1VQO1 2R6MA 4E30A 3JAMf 1QVFY 3FKII 1YIT1 2V8JA 5FLMI 1VLAA 3MZLB 3CC2Z 1VQ61 3IFUA 3HKZA 1VQKZ 1M1K1 3GTQI 3CCUZ 1Q811 3VMHA 2H85A 2JA8I 2PM9A 2E9HA 2G2KA 3S2HI 1X0TA 1VQLZ 2PMZA 2LFUA 3G6EZ 1KC82 1Y1WI 3H3VJ 3MZKB 2OTJ1 2QA4Z 4A3JI 2RPRA 4NBDA 1YJWZ 2JA6I 4NBAA 3CCQ1 2KI7B 3RZOI 1W2BY 1VQPZ 2RBLA 4A3GI 2V8IA 3P5JB 3G711 3I07A 3F3PC 4NB8A 2QA41 5D1OB 3FQQA 4NH1C 1YHQ1 4RVDA 4A3MI 4RVFA 2GU2A 1YJNZ 2F4MA 1VQNZ 2RT9A 3Q87A 5C3EI 4AYBA 2E2HI 1S72Z 3I4NI 1VQ41 1ZH1A 1SFOI 2DE5A 3HOWI 1KQSY 1M902 4MD8A 3CCRZ 4RS4A 4E32A 1YHQZ 1X3ZA 3VTNA 3CC41 4X6AI 1I3QI 3CCJ1 1VQN1 4DK1A 1Z01A 1NJI1 4BXXI 3CC71 3CCLZ 1NUIA 2R92I 2VF1A 2NVXI 4MONA 4HH4A 1W2BZ 3G4S1 3F3FC 3CCE1 2GTHA 3S17I 4E2XA 3GTKI 1YIJ1 3GTLI 2F4OA 3CMA1 3CME1 1K9M2 2B63I 1VQOZ 2KPIA 2GTIA 2V8KA 4TNUA 3TE5B 4CL1A 3CCMZ 3D9XA 4NBBA 2QEXZ 5T67A 1VQ6Z 4BBSI 3M3YI 1Y1VI 2NVTI 4RVGA 3CCU1 3I551 1K8A2 3KIFA 4NBGA 2QLVB 2Y0SA 1YUAA 1VQ9Z 1TWCI 4NOZA 1RO0A 1QYPA 3EEDA 4NB9A 3G6E1 3J81b 1Q822 1Z02A 3HOYI 1YITZ 2R93I 5A2Qf 1Q861 1LQLA 2JMOA 3VB9A 1JJ2Z 5D1PA 1M1K2 3I56Z 3CPWY 2JS4A 2HF1A 1YJ9Z 3G71Z 2WAQA 1RLYA 3PO3I 1TWGI 2Q4ZA 4A3BI 3S1NI 4Y7NI 5C44I 2OTLZ 3HOVI 3S14I 3JAMb 3VMIA 3I561 2RIQA 3NH4A 4MD7A 2OTJZ 3CPWZ 1K8A1 2JNYA 1KD11 2HU9A 1DL6A 4BY1I 1WW9A 2K5RA 1Q7Y2 3H0GI 3GTOI 2K3RA 3CQZI 1WCMI 3NDIA 1I6HI 1VQL1 2Q51A 1KRLA 1VQM1 1VQ81 4NBCA 1YJN1 2NVQI 4A3DI 1L1OC 3CCQZ 4QTTA 3D6WA 3G4SZ 4RV9A 1VQ51 5C4JI 5IP9I 2OZKA 3S16I 4HGZA 2DE7A 5FLXf 3CCM1 2ZAEB 3KIHA 2QR1B 1RO2A 3M4OI 5FLXb 2E2II 4Y52I 3PO3S 1KC81 4EWCA 2WB1A 3GTJI 1QF8A 4E31A 3S15I 1S721
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 b;  3J80 b;  3J7A 4;  3JAM b;  5A2Q b;  5FLX b;  5LL6 f;  3J81 b; 
#chains in the Genus database with same CATH topology
 1ZB9 A;  1NP6 A;  3MON A;  4A93 I;  1RQF A;  3LUS A;  1Q82 1;  2IV2 X;  2JR6 A;  3GTM S;  3BG0 B;  4NBF A;  4E33 A;  3CMA Z;  5AN9 F;  3IX0 A;  3CME Z;  4BY7 I;  5LL6 f;  3ESW A;  4DGL A;  1NJI 2;  5T64 A;  5IT9 f;  2LIY A;  3CC7 Z;  2QEX 1;  3CCL 1;  1N2F A;  3EER A;  4MXU A;  2QRD B;  2IZ3 A;  1X3W A;  1YI2 1;  3HOZ I;  2RHB A;  3S1Q I;  1RO4 A;  4HGY A;  5IT9 b;  1YJ9 1;  3PO2 I;  3CCE Z;  5C4X I;  3CCV 1;  1VQ7 1;  1Q7Y 1;  1VQK 1;  2VPX A;  2QRC B;  2VUM I;  3OW2 Z;  5T6B A;  2E2J I;  3GKQ A;  1WII A;  2OTL 1;  1N8R 2;  1Y1V S;  2OOY B;  2I3C A;  2JA7 I;  1S7M A;  4RVH A;  3RZD I;  1Q86 2;  2W04 A;  4NBE A;  4MH4 A;  3CXC Y;  3J7A 4;  1ML8 A;  3S1R I;  3J81 f;  2QRE B;  1USP A;  3NDJ A;  3CCV Z;  3GTP I;  1VQ7 Z;  1PFT A;  2IZ4 A;  2P28 A;  2AYD A;  1YJW 1;  2JUB A;  1RNI A;  3I55 Z;  1YUK A;  3I4M I;  1QVF Z;  1JWH C;  3CC2 1;  4XX2 A;  3TDH B;  3NH5 A;  4NBH A;  2BJO A;  1VQP 1;  2O4H A;  4A3E I;  3IR7 A;  2O53 A;  1K9M 1;  1P9N A;  4A3K I;  1K73 1;  1KD1 2;  1Z03 A;  3QWU A;  1ZB8 A;  1R9T I;  4MRI A;  1N8R 1;  2EGT A;  4E2W A;  4A3I I;  3CCR 1;  3HOX I;  3K7A I;  3BG1 B;  1Q81 2;  2DE6 A;  3J80 b;  4E2Y A;  4NFR A;  1TWF I;  1I50 I;  1VQM Z;  3D2L A;  2PK7 A;  1FDO A;  3HOU I;  2W03 A;  3IF8 A;  5D1O A;  3U50 C;  1QVG Z;  1QXF A;  3S1M I;  2YAD A;  2JIQ A;  3GTG I;  3CD6 Z;  2JIP A;  5A2Q b;  1KQS Z;  1Q16 A;  3T4N B;  3NH8 A;  1VQ4 Z;  2AKL A;  2M6N A;  3GCF A;  4E2Z A;  1YIJ Z;  3VMG A;  1K83 I;  4A3F I;  2P3Y A;  4S1T A;  5IP7 I;  3CC4 Z;  4MD9 A;  1TWA I;  3CCJ Z;  3S2D I;  1VQ8 Z;  2YU9 I;  1YI2 Z;  3OW2 Y;  2QKD A;  2LEX A;  3CD6 1;  2OOX B;  3CCS 1;  1WJ2 A;  5CM2 M;  2J6A A;  4QTU A;  1JJ2 Y;  4BBR I;  2M48 A;  1VQ5 Z;  4A3C I;  3NFZ A;  2VUG A;  1USP B;  3J80 f;  1QVG Y;  2JA5 I;  1TFI A;  1M90 1;  2NVY I;  2R7Z I;  4A3L I;  1VQ9 1;  3CCS Z;  3FQM A;  4DQY B;  1K73 2;  3GTM I;  1TWH I;  3CXC Z;  1VQO 1;  2R6M A;  4E30 A;  3JAM f;  1QVF Y;  3FKI I;  1YIT 1;  2V8J A;  5FLM I;  1VLA A;  3MZL B;  3CC2 Z;  1VQ6 1;  2JIR A;  3IFU A;  3HKZ A;  1VQK Z;  1M1K 1;  3GTQ I;  3CCU Z;  1Q81 1;  3VMH A;  2H85 A;  2JA8 I;  2PM9 A;  2E9H A;  2G2K A;  3S2H I;  1X0T A;  1VQL Z;  2PMZ A;  2LFU A;  3G6E Z;  1AA6 A;  1KC8 2;  1Y1W I;  3H3V J;  3MZK B;  2OTJ 1;  2QA4 Z;  4A3J I;  2RPR A;  4NBD A;  1YJW Z;  2JA6 I;  4NBA A;  3CCQ 1;  2KI7 B;  3RZO I;  1W2B Y;  1VQP Z;  2RBL A;  4A3G I;  2V8I A;  3P5J B;  3G71 1;  3I07 A;  3F3P C;  4NB8 A;  2QA4 1;  5D1O B;  1SIW A;  3FQQ A;  4NH1 C;  4RVD A;  1YHQ 1;  4A3M I;  4RVF A;  2GU2 A;  1YJN Z;  2F4M A;  1VQN Z;  2RT9 A;  3Q87 A;  5C3E I;  4AYB A;  2E2H I;  1S72 Z;  3I4N I;  1VQ4 1;  1ZH1 A;  1SFO I;  2DE5 A;  3HOW I;  1KQS Y;  1M90 2;  4MD8 A;  3CCR Z;  1YHQ Z;  4RS4 A;  4E32 A;  1X3Z A;  3VTN A;  3CC4 1;  4X6A I;  1I3Q I;  3CCJ 1;  1VQN 1;  4DK1 A;  1Z01 A;  1NJI 1;  4BXX I;  3CC7 1;  3CCL Z;  1NUI A;  2R92 I;  2VF1 A;  2NVX I;  4MON A;  4HH4 A;  1W2B Z;  2VPW A;  3G4S 1;  3F3F C;  3CCE 1;  2GTH A;  3S17 I;  4E2X A;  3GTK I;  1YIJ 1;  3GTL I;  2F4O A;  3CMA 1;  1FDI A;  3CME 1;  1K9M 2;  2B63 I;  1VQO Z;  2KPI A;  2GTI A;  2V8K A;  4TNU A;  2V45 A;  3TE5 B;  4CL1 A;  3CCM Z;  3D9X A;  4NBB A;  2QEX Z;  5T67 A;  1VQ6 Z;  4BBS I;  1Y8C A;  3M3Y I;  1Y1V I;  2NVT I;  4RVG A;  3CCU 1;  3I55 1;  1K8A 2;  3KIF A;  4NBG A;  2QLV B;  2Y0S A;  1YUA A;  1VQ9 Z;  1TWC I;  4NOZ A;  1RO0 A;  1QYP A;  3EED A;  4NB9 A;  3G6E 1;  3J81 b;  1WZN A;  1Q82 2;  1Z02 A;  3HOY I;  1YIT Z;  2R93 I;  2JIM A;  5A2Q f;  1Q86 1;  1LQL A;  2JMO A;  3VB9 A;  1JJ2 Z;  5D1P A;  1M1K 2;  3I56 Z;  3CPW Y;  2JS4 A;  2HF1 A;  2VPZ A;  1YJ9 Z;  3G71 Z;  2WAQ A;  1RLY A;  3PO3 I;  1TWG I;  2Q4Z A;  4A3B I;  3S1N I;  4Y7N I;  5C44 I;  2OTL Z;  3HOV I;  3S14 I;  3JAM b;  2V3V A;  3VMI A;  3I56 1;  2RIQ A;  3NH4 A;  4MD7 A;  2OTJ Z;  3CPW Z;  1K8A 1;  2JNY A;  1KD1 1;  2HU9 A;  1DL6 A;  4BY1 I;  2VPY A;  1WW9 A;  2K5R A;  1Q7Y 2;  3H0G I;  3GTO I;  2K3R A;  3CQZ I;  1WCM I;  3NDI A;  1I6H I;  1VQL 1;  2Q51 A;  1KRL A;  1VQM 1;  1VQ8 1;  4NBC A;  1YJN 1;  2NVQ I;  4A3D I;  1L1O C;  3CCQ Z;  4QTT A;  3D6W A;  3G4S Z;  4RV9 A;  1VQ5 1;  5C4J I;  5IP9 I;  2JIO A;  2E7Z A;  2OZK A;  3S16 I;  4HGZ A;  2DE7 A;  5FLX f;  3CCM 1;  2ZAE B;  3KIH A;  2QR1 B;  1RO2 A;  3M4O I;  5FLX b;  2E2I I;  4Y52 I;  3PO3 S;  1KC8 1;  4EWC A;  2WB1 A;  3GTJ I;  1QF8 A;  4E31 A;  2NAP A;  3S15 I;  1S72 1; 
#chains in the Genus database with same CATH homology
 1ZB9 A;  1NP6 A;  3MON A;  4A93 I;  1RQF A;  3LUS A;  1Q82 1;  2JR6 A;  3GTM S;  3BG0 B;  4NBF A;  4E33 A;  3CMA Z;  5AN9 F;  3IX0 A;  3CME Z;  4BY7 I;  5LL6 f;  3ESW A;  4DGL A;  1NJI 2;  5T64 A;  5IT9 f;  2LIY A;  3CC7 Z;  2QEX 1;  3CCL 1;  1N2F A;  3EER A;  4MXU A;  2QRD B;  2IZ3 A;  1X3W A;  1YI2 1;  3HOZ I;  2RHB A;  3S1Q I;  1RO4 A;  4HGY A;  5IT9 b;  1YJ9 1;  3PO2 I;  3CCE Z;  5C4X I;  3CCV 1;  1VQ7 1;  1Q7Y 1;  1VQK 1;  2QRC B;  2VUM I;  3OW2 Z;  5T6B A;  2E2J I;  3GKQ A;  1WII A;  2OTL 1;  1N8R 2;  1Y1V S;  2OOY B;  2I3C A;  2JA7 I;  1S7M A;  4RVH A;  3RZD I;  1Q86 2;  2W04 A;  4NBE A;  4MH4 A;  3CXC Y;  3J7A 4;  1ML8 A;  3S1R I;  3J81 f;  2QRE B;  1USP A;  3NDJ A;  3CCV Z;  3GTP I;  1VQ7 Z;  1PFT A;  2IZ4 A;  2P28 A;  1YJW 1;  2JUB A;  1RNI A;  3I55 Z;  1YUK A;  3I4M I;  1QVF Z;  1JWH C;  3CC2 1;  4XX2 A;  3TDH B;  3NH5 A;  4NBH A;  2BJO A;  1VQP 1;  2O4H A;  4A3E I;  2O53 A;  1K9M 1;  1P9N A;  4A3K I;  1K73 1;  1KD1 2;  1Z03 A;  3QWU A;  1ZB8 A;  1R9T I;  4MRI A;  1N8R 1;  2EGT A;  4E2W A;  4A3I I;  3CCR 1;  3HOX I;  3K7A I;  1Q81 2;  3BG1 B;  2DE6 A;  3J80 b;  4E2Y A;  4NFR A;  1TWF I;  1I50 I;  1VQM Z;  2PK7 A;  3HOU I;  2W03 A;  3IF8 A;  5D1O A;  3U50 C;  1QVG Z;  3S1M I;  2YAD A;  3GTG I;  3CD6 Z;  5A2Q b;  1KQS Z;  3T4N B;  3NH8 A;  1VQ4 Z;  2AKL A;  2M6N A;  3GCF A;  4E2Z A;  1YIJ Z;  3VMG A;  1K83 I;  4A3F I;  2P3Y A;  4S1T A;  5IP7 I;  3CC4 Z;  4MD9 A;  1TWA I;  3CCJ Z;  3S2D I;  1VQ8 Z;  2YU9 I;  1YI2 Z;  3OW2 Y;  2QKD A;  3CD6 1;  2OOX B;  3CCS 1;  5CM2 M;  2J6A A;  4QTU A;  1JJ2 Y;  4BBR I;  2M48 A;  1VQ5 Z;  4A3C I;  3NFZ A;  2VUG A;  1USP B;  3J80 f;  1QVG Y;  2JA5 I;  1TFI A;  1M90 1;  2NVY I;  2R7Z I;  4A3L I;  1VQ9 1;  3CCS Z;  3FQM A;  4DQY B;  1K73 2;  3GTM I;  1TWH I;  3CXC Z;  1VQO 1;  2R6M A;  4E30 A;  3JAM f;  1QVF Y;  3FKI I;  1YIT 1;  2V8J A;  5FLM I;  1VLA A;  3MZL B;  3CC2 Z;  1VQ6 1;  3IFU A;  3HKZ A;  1VQK Z;  1M1K 1;  3GTQ I;  3CCU Z;  1Q81 1;  3VMH A;  2H85 A;  2JA8 I;  2PM9 A;  2E9H A;  2G2K A;  3S2H I;  1X0T A;  1VQL Z;  2PMZ A;  2LFU A;  3G6E Z;  1KC8 2;  1Y1W I;  3H3V J;  3MZK B;  2OTJ 1;  2QA4 Z;  4A3J I;  2RPR A;  4NBD A;  1YJW Z;  2JA6 I;  4NBA A;  3CCQ 1;  2KI7 B;  3RZO I;  1W2B Y;  1VQP Z;  2RBL A;  4A3G I;  2V8I A;  3P5J B;  3G71 1;  3I07 A;  3F3P C;  4NB8 A;  2QA4 1;  5D1O B;  3FQQ A;  4NH1 C;  1YHQ 1;  4RVD A;  4A3M I;  4RVF A;  2GU2 A;  1YJN Z;  2F4M A;  1VQN Z;  2RT9 A;  3Q87 A;  5C3E I;  4AYB A;  2E2H I;  1S72 Z;  3I4N I;  1VQ4 1;  1ZH1 A;  1SFO I;  2DE5 A;  3HOW I;  1KQS Y;  1M90 2;  4MD8 A;  3CCR Z;  4RS4 A;  4E32 A;  1YHQ Z;  1X3Z A;  3VTN A;  3CC4 1;  4X6A I;  1I3Q I;  3CCJ 1;  1VQN 1;  4DK1 A;  1Z01 A;  1NJI 1;  4BXX I;  3CC7 1;  3CCL Z;  1NUI A;  2R92 I;  2VF1 A;  2NVX I;  4MON A;  4HH4 A;  1W2B Z;  3G4S 1;  3F3F C;  3CCE 1;  2GTH A;  3S17 I;  4E2X A;  3GTK I;  1YIJ 1;  3GTL I;  2F4O A;  3CMA 1;  3CME 1;  1K9M 2;  2B63 I;  1VQO Z;  2KPI A;  2GTI A;  2V8K A;  4TNU A;  3TE5 B;  4CL1 A;  3CCM Z;  3D9X A;  4NBB A;  2QEX Z;  5T67 A;  1VQ6 Z;  4BBS I;  3M3Y I;  1Y1V I;  2NVT I;  4RVG A;  3CCU 1;  3I55 1;  1K8A 2;  3KIF A;  4NBG A;  2QLV B;  2Y0S A;  1YUA A;  1VQ9 Z;  1TWC I;  4NOZ A;  1RO0 A;  1QYP A;  3EED A;  4NB9 A;  3G6E 1;  3J81 b;  1Q82 2;  1Z02 A;  3HOY I;  1YIT Z;  2R93 I;  5A2Q f;  1Q86 1;  1LQL A;  2JMO A;  3VB9 A;  1JJ2 Z;  5D1P A;  1M1K 2;  3I56 Z;  3CPW Y;  2JS4 A;  2HF1 A;  1YJ9 Z;  3G71 Z;  2WAQ A;  1RLY A;  3PO3 I;  1TWG I;  2Q4Z A;  4A3B I;  3S1N I;  4Y7N I;  5C44 I;  2OTL Z;  3HOV I;  3S14 I;  3JAM b;  3VMI A;  3I56 1;  2RIQ A;  3NH4 A;  4MD7 A;  2OTJ Z;  3CPW Z;  1K8A 1;  2JNY A;  1KD1 1;  2HU9 A;  1DL6 A;  4BY1 I;  1WW9 A;  2K5R A;  1Q7Y 2;  3H0G I;  3GTO I;  2K3R A;  3CQZ I;  1WCM I;  3NDI A;  1I6H I;  1VQL 1;  2Q51 A;  1KRL A;  1VQM 1;  1VQ8 1;  4NBC A;  1YJN 1;  2NVQ I;  4A3D I;  1L1O C;  3CCQ Z;  4QTT A;  3D6W A;  3G4S Z;  4RV9 A;  1VQ5 1;  5C4J I;  5IP9 I;  2OZK A;  3S16 I;  4HGZ A;  2DE7 A;  5FLX f;  3CCM 1;  2ZAE B;  3KIH A;  2QR1 B;  1RO2 A;  3M4O I;  5FLX b;  2E2I I;  4Y52 I;  3PO3 S;  1KC8 1;  4EWC A;  2WB1 A;  3GTJ I;  1QF8 A;  4E31 A;  3S15 I;  1S72 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...