5IT9b

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
MVLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 4
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9b00
3J80b 3JAMb 5FLXb 5A2Qb 5IT9b 3J81b 3J7A4 5LL6f
chains in the Genus database with same CATH superfamily
4NBCA 1Y1VS 3G4S1 2PK7A 1I50I 4X6AI 4DK1A 3U50C 1VQOZ 3G4SZ 2G2KA 3G71Z 2YU9I 4RVFA 3J80b 1R9TI 2OTJZ 2R92I 1KRLA 4NB9A 1ZH1A 1VQK1 1M901 2WB1A 3NFZA 3GTKI 2QRDB 1NJI2 4RV9A 1M902 1NUIA 3CCR1 3GCFA 3CMAZ 2JMOA 2VUGA 1VLAA 1YITZ 2VPWA 2AYDA 1TWAI 1YHQ1 3CCRZ 1Q7Y1 3I4NI 1YIJ1 3OW2Z 1SFOI 3P5JB 1Q7Y2 1KD11 4MXUA 1VQP1 3MZKB 3J80f 1YHQZ 1KD12 4A3CI 1YIJZ 2JIOA 1Y1WI 4NB8A 2LFUA 2R6MA 1KC81 4NOZA 2JIQA 2JS4A 4HGZA 1KC82 2HU9A 5IP9I 1VQMZ 2PMZA 4E33A 5A2Qb 2W03A 2OTL1 2P3YA 5D1PA 3F3FC 2QREB 1WW9A 2KPIA 3H0GI 3CQZI 3CCEZ 3CCMZ 2OTLZ 4Y7NI 4MD7A 1USPB 4RVGA 2B63I 1RO4A 3GTGI 2JA6I 3NH5A 5CM2M 2RIQA 3GTLI 2QLVB 3CXCY 5A2Qf 1VQ51 3F3PC 4MONA 2AKLA 5C3EI 1Z01A 1VQ9Z 2IZ3A 3BG1B 4DGLA 1Q16A 1L1OC 1YI2Z 2V8IA 3CC71 1TWCI 2QRCB 1WZNA 1X3WA 3QWUA 2OOXB 2JA7I 3EERA 3CD61 4XX2A 3CC7Z 4NBEA 1K83I 1Q821 5D1OA 1AA6A 3ESWA 1K731 2E9HA 1RLYA 4NBFA 3CCQ1 1Q822 1K732 1Z03A 4BY1I 5FLXb 4E2ZA 1VQNZ 2Q51A 3CCU1 3CCSZ 4A3KI 3NDIA 1YJNZ 4A3FI 2DE6A 2QA4Z 3HOYI 4E30A 1Y1VI 3VTNA 2YADA 3CCUZ 1JJ2Z 2KI7B 1PFTA 3I56Z 1S7MA 2F4MA 3HOVI 3D2LA 1VQ6Z 4E2XA 1NP6A 2NVXI 3TE5B 4EWCA 1K8A1 3OW2Y 5FLXf 1K8A2 1KQSZ 1Z02A 3D6WA 1YJW1 1NJI1 1P9NA 2RBLA 3KIHA 2V8KA 1YJWZ 2M48A 1QXFA 1VQKZ 2JA5I 2JR6A 3GTOI 4DQYB 5C44I 2DE5A 1TWHI 3EEDA 4MD8A 2JIRA 2OZKA 1W2BZ 3CC41 4HGYA 2M6NA 1VQPZ 4NBBA 1WJ2A 3CC4Z 4A3JI 3VMHA 2JUBA 2HF1A 1RO2A 5C4JI 3PO3S 3CCJ1 2JNYA 3TDHB 4A3II 3IFUA 3M4OI 1WIIA 3Q87A 3I4MI 2P28A 4RVHA 2GU2A 3S1NI 5T67A 1FDIA 1QVGZ 1ZB9A 3FQQA 3CCL1 2GTHA 1Q811 3VB9A 2NVYI 3JAMb 4RS4A 1TFIA 2K3RA 4HH4A 1Q812 3CCLZ 1QVFZ 2V45A 2R7ZI 3S1RI 3GKQA 2V3VA 3LUSA 5FLMI 5T64A 1Y8CA 3IR7A 4Y52I 4RVDA 2IV2X 2IZ4A 1I3QI 5AN9F 3I551 3HOUI 4BY7I 1N8R2 3S1MI 1FDOA 1VQ5Z 3NH4A 3S14I 3CCV1 3J81b 3RZDI 3CME1 2QKDA 4A3MI 1ZB8A 3K7AI 3G6E1 3CCVZ 4MD9A 3CMEZ 1YJ91 1JJ2Y 3CD6Z 2E2HI 3G6EZ 2O4HA 5T6BA 3CCQZ 1VQL1 1KQSY 2J6AA 1LQLA 2EGTA 2VF1A 3J81f 2JIPA 1ML8A 2O53A 3S2DI 2I3CA 3GTMS 2VPYA 2NAPA 2GTIA 1VQ81 1I6HI 2RPRA 2H85A 3GTPI 1S721 1TWFI 1M1K1 1M1K2 1VQ41 1VQ71 3KIFA 1S72Z 2PM9A 1X3ZA 2NVQI 1W2BY 2E7ZA 1VQ7Z 1USPA 4CL1A 1VQO1 3FQMA 3HKZA 4E32A 3HOXI 3G711 2DE7A 2OTJ1 3S16I 1Q861 2Q4ZA 3HOZI 3D9XA 3CPWZ 3NDJA 1Q862 4TNUA 3CMA1 1QVGY 2E2JI 1YIT1 3NH8A 3BG0B 1YUKA 4A93I 3PO3I 1QVFY 4BBSI 2ZAEB 1N2FA 2LEXA 4NH1C 5D1OB 2Y0SA 2QEX1 3CCJZ 2WAQA 4S1TA 5IT9b 4NFRA 3IF8A 2QEXZ 4NBDA 2RHBA 1VQM1 2VUMI 5C4XI 4NBGA 4E31A 1YUAA 4A3BI 3GTQI 3S2HI 1X0TA 4MRIA 5IP7I 3CCE1 3MZLB 1RO0A 3CCM1 3RZOI 1QYPA 3J7A4 4A3DI 1N8R1 5IT9f 3MONA 3H3VJ 4NBAA 3JAMf 3I55Z 4NBHA 4A3EI 4A3LI 2E2II 3S17I 3GTJI 3VMGA 3HOWI 4AYBA 3S15I 2F4OA 2VPZA 1VQ91 3PO2I 2R93I 3FKII 2OOYB 2NVTI 1RQFA 2QR1B 1YI21 1DL6A 2V8JA 1SIWA 1QF8A 1YJ9Z 2BJOA 3VMIA 2W04A 2LIYA 4E2WA 1VQLZ 3CC21 4BXXI 3GTMI 3CXCZ 2VPXA 4E2YA 4QTTA 1K9M1 1VQN1 3I07A 3CC2Z 4BBRI 1K9M2 1TWGI 3CCS1 1VQ8Z 1WCMI 1YJN1 2QA41 4A3GI 3S1QI 3IX0A 1JWHC 5LL6f 3CPWY 2RT9A 2K5RA 2JIMA 4QTUA 3I561 3T4NB 1VQ4Z 3M3YI 2JA8I 4MH4A 1RNIA 1VQ61
chains in the Genus database with same CATH topology
4NBCA 1Y1VS 3G4S1 2PK7A 1I50I 4X6AI 4DK1A 3U50C 1VQOZ 3G4SZ 2G2KA 3G71Z 2YU9I 4RVFA 3J80b 1R9TI 2OTJZ 2R92I 1KRLA 4NB9A 1ZH1A 1VQK1 1M901 2WB1A 3NFZA 3GTKI 2QRDB 1NJI2 4RV9A 1M902 1NUIA 3CCR1 3GCFA 3CMAZ 2JMOA 2VUGA 1VLAA 1YITZ 1TWAI 1YHQ1 3CCRZ 1Q7Y1 3I4NI 1YIJ1 3OW2Z 1SFOI 3P5JB 1Q7Y2 1KD11 4MXUA 1VQP1 3MZKB 3J80f 1YHQZ 1KD12 4A3CI 1YIJZ 1Y1WI 4NB8A 2LFUA 2R6MA 1KC81 4NOZA 2JS4A 4HGZA 1KC82 2HU9A 5IP9I 1VQMZ 2PMZA 4E33A 5A2Qb 2W03A 2OTL1 2P3YA 5D1PA 3F3FC 2QREB 1WW9A 2KPIA 3H0GI 3CQZI 3CCEZ 3CCMZ 2OTLZ 4Y7NI 4MD7A 1USPB 4RVGA 2B63I 1RO4A 3GTGI 2JA6I 3NH5A 5CM2M 2RIQA 3GTLI 2QLVB 3CXCY 5A2Qf 1VQ51 3F3PC 4MONA 2AKLA 5C3EI 1Z01A 1VQ9Z 2IZ3A 3BG1B 4DGLA 1L1OC 1YI2Z 2V8IA 3CC71 1TWCI 2QRCB 1X3WA 3QWUA 2OOXB 2JA7I 3EERA 3CD61 4XX2A 3CC7Z 4NBEA 1K83I 1Q821 5D1OA 3ESWA 1K731 2E9HA 1RLYA 4NBFA 3CCQ1 1Q822 1K732 1Z03A 4BY1I 5FLXb 4E2ZA 1VQNZ 2Q51A 3CCU1 3CCSZ 4A3KI 3NDIA 1YJNZ 4A3FI 2DE6A 2QA4Z 3HOYI 4E30A 1Y1VI 3VTNA 2YADA 3CCUZ 1JJ2Z 2KI7B 1PFTA 3I56Z 1S7MA 2F4MA 3HOVI 1VQ6Z 4E2XA 1NP6A 2NVXI 3TE5B 4EWCA 1K8A1 3OW2Y 5FLXf 1K8A2 1KQSZ 1Z02A 3D6WA 1YJW1 1NJI1 1P9NA 2RBLA 3KIHA 2V8KA 1YJWZ 2M48A 1VQKZ 2JA5I 2JR6A 3GTOI 4DQYB 5C44I 2DE5A 1TWHI 3EEDA 4MD8A 2OZKA 1W2BZ 3CC41 4HGYA 2M6NA 1VQPZ 4NBBA 3CC4Z 4A3JI 3VMHA 2JUBA 2HF1A 1RO2A 5C4JI 3PO3S 3CCJ1 2JNYA 3TDHB 4A3II 3IFUA 3M4OI 1WIIA 3Q87A 3I4MI 2P28A 4RVHA 2GU2A 3S1NI 5T67A 1QVGZ 1ZB9A 3FQQA 3CCL1 2GTHA 1Q811 3VB9A 2NVYI 3JAMb 4RS4A 1TFIA 2K3RA 4HH4A 1Q812 3CCLZ 1QVFZ 2R7ZI 3S1RI 3GKQA 3LUSA 5FLMI 5T64A 4Y52I 4RVDA 2IZ4A 1I3QI 5AN9F 3I551 3HOUI 4BY7I 1N8R2 3S1MI 1VQ5Z 3NH4A 3S14I 3CCV1 3J81b 3RZDI 3CME1 2QKDA 4A3MI 1ZB8A 3K7AI 3G6E1 3CCVZ 4MD9A 3CMEZ 1YJ91 1JJ2Y 3CD6Z 2E2HI 3G6EZ 2O4HA 5T6BA 3CCQZ 1VQL1 1KQSY 2J6AA 1LQLA 2EGTA 2VF1A 3J81f 1ML8A 2O53A 3S2DI 2I3CA 3GTMS 2GTIA 1VQ81 1I6HI 2RPRA 2H85A 3GTPI 1S721 1TWFI 1M1K1 1M1K2 1VQ41 1VQ71 3KIFA 1S72Z 2PM9A 1X3ZA 2NVQI 1W2BY 1VQ7Z 1USPA 4CL1A 1VQO1 3FQMA 3HKZA 4E32A 3HOXI 3G711 2DE7A 2OTJ1 3S16I 1Q861 2Q4ZA 3HOZI 3D9XA 3CPWZ 3NDJA 1Q862 4TNUA 3CMA1 1QVGY 2E2JI 1YIT1 3NH8A 3BG0B 1YUKA 4A93I 3PO3I 1QVFY 4BBSI 2ZAEB 1N2FA 4NH1C 5D1OB 2Y0SA 2QEX1 3CCJZ 2WAQA 4S1TA 5IT9b 4NFRA 3IF8A 2QEXZ 4NBDA 2RHBA 1VQM1 2VUMI 5C4XI 4NBGA 4E31A 1YUAA 4A3BI 3GTQI 3S2HI 1X0TA 4MRIA 5IP7I 3CCE1 3MZLB 1RO0A 3CCM1 3RZOI 1QYPA 3J7A4 4A3DI 1N8R1 5IT9f 3MONA 3H3VJ 4NBAA 3JAMf 3I55Z 4NBHA 4A3EI 4A3LI 2E2II 3S17I 3GTJI 3VMGA 3HOWI 4AYBA 3S15I 2F4OA 1VQ91 3PO2I 2R93I 3FKII 2OOYB 2NVTI 1RQFA 2QR1B 1YI21 1DL6A 2V8JA 1QF8A 1YJ9Z 2BJOA 3VMIA 2W04A 2LIYA 4E2WA 1VQLZ 3CC21 4BXXI 3GTMI 3CXCZ 4E2YA 4QTTA 1K9M1 1VQN1 3I07A 3CC2Z 4BBRI 1K9M2 1TWGI 3CCS1 1VQ8Z 1WCMI 1YJN1 2QA41 4A3GI 3S1QI 3IX0A 1JWHC 5LL6f 3CPWY 2RT9A 2K5RA 4QTUA 3I561 3T4NB 1VQ4Z 3M3YI 2JA8I 4MH4A 1RNIA 1VQ61
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 b;  3JAM b;  5FLX b;  5A2Q b;  5IT9 b;  3J81 b;  3J7A 4;  5LL6 f; 
#chains in the Genus database with same CATH topology
 4NBC A;  1Y1V S;  3G4S 1;  2PK7 A;  1I50 I;  4X6A I;  4DK1 A;  3U50 C;  1VQO Z;  3G4S Z;  2G2K A;  3G71 Z;  2YU9 I;  4RVF A;  3J80 b;  1R9T I;  2OTJ Z;  2R92 I;  1KRL A;  4NB9 A;  1ZH1 A;  1VQK 1;  1M90 1;  2WB1 A;  3NFZ A;  3GTK I;  2QRD B;  1NJI 2;  4RV9 A;  1M90 2;  1NUI A;  3CCR 1;  3GCF A;  3CMA Z;  2JMO A;  2VUG A;  1VLA A;  1YIT Z;  2VPW A;  2AYD A;  1TWA I;  1YHQ 1;  3CCR Z;  1Q7Y 1;  3I4N I;  1YIJ 1;  3OW2 Z;  1SFO I;  3P5J B;  1Q7Y 2;  1KD1 1;  4MXU A;  1VQP 1;  3MZK B;  3J80 f;  1YHQ Z;  1KD1 2;  4A3C I;  1YIJ Z;  2JIO A;  1Y1W I;  4NB8 A;  2LFU A;  2R6M A;  1KC8 1;  4NOZ A;  2JIQ A;  2JS4 A;  4HGZ A;  1KC8 2;  2HU9 A;  5IP9 I;  1VQM Z;  2PMZ A;  4E33 A;  5A2Q b;  2W03 A;  2OTL 1;  2P3Y A;  5D1P A;  3F3F C;  2QRE B;  1WW9 A;  2KPI A;  3H0G I;  3CQZ I;  3CCE Z;  3CCM Z;  2OTL Z;  4Y7N I;  4MD7 A;  1USP B;  4RVG A;  2B63 I;  1RO4 A;  3GTG I;  2JA6 I;  3NH5 A;  5CM2 M;  2RIQ A;  3GTL I;  2QLV B;  3CXC Y;  5A2Q f;  1VQ5 1;  3F3P C;  4MON A;  2AKL A;  5C3E I;  1Z01 A;  1VQ9 Z;  2IZ3 A;  3BG1 B;  4DGL A;  1Q16 A;  1L1O C;  1YI2 Z;  2V8I A;  3CC7 1;  1TWC I;  2QRC B;  1WZN A;  1X3W A;  3QWU A;  2OOX B;  2JA7 I;  3EER A;  3CD6 1;  4XX2 A;  3CC7 Z;  4NBE A;  1K83 I;  1Q82 1;  5D1O A;  1AA6 A;  3ESW A;  1K73 1;  2E9H A;  1RLY A;  4NBF A;  3CCQ 1;  1Q82 2;  1K73 2;  1Z03 A;  4BY1 I;  5FLX b;  4E2Z A;  1VQN Z;  2Q51 A;  3CCU 1;  3CCS Z;  4A3K I;  3NDI A;  1YJN Z;  4A3F I;  2DE6 A;  2QA4 Z;  3HOY I;  4E30 A;  1Y1V I;  3VTN A;  2YAD A;  3CCU Z;  1JJ2 Z;  2KI7 B;  1PFT A;  3I56 Z;  1S7M A;  2F4M A;  3HOV I;  3D2L A;  1VQ6 Z;  4E2X A;  1NP6 A;  2NVX I;  3TE5 B;  4EWC A;  1K8A 1;  3OW2 Y;  5FLX f;  1K8A 2;  1KQS Z;  1Z02 A;  3D6W A;  1YJW 1;  1NJI 1;  1P9N A;  2RBL A;  3KIH A;  2V8K A;  1YJW Z;  2M48 A;  1QXF A;  1VQK Z;  2JA5 I;  2JR6 A;  3GTO I;  4DQY B;  5C44 I;  2DE5 A;  1TWH I;  3EED A;  4MD8 A;  2JIR A;  2OZK A;  1W2B Z;  3CC4 1;  4HGY A;  2M6N A;  1VQP Z;  4NBB A;  1WJ2 A;  3CC4 Z;  4A3J I;  3VMH A;  2JUB A;  2HF1 A;  1RO2 A;  5C4J I;  3PO3 S;  3CCJ 1;  2JNY A;  3TDH B;  4A3I I;  3IFU A;  3M4O I;  1WII A;  3Q87 A;  3I4M I;  2P28 A;  4RVH A;  2GU2 A;  3S1N I;  5T67 A;  1FDI A;  1QVG Z;  1ZB9 A;  3FQQ A;  3CCL 1;  2GTH A;  1Q81 1;  3VB9 A;  2NVY I;  3JAM b;  4RS4 A;  1TFI A;  2K3R A;  4HH4 A;  1Q81 2;  3CCL Z;  1QVF Z;  2V45 A;  2R7Z I;  3S1R I;  3GKQ A;  2V3V A;  3LUS A;  5FLM I;  5T64 A;  1Y8C A;  3IR7 A;  4Y52 I;  4RVD A;  2IV2 X;  2IZ4 A;  1I3Q I;  5AN9 F;  3I55 1;  3HOU I;  4BY7 I;  1N8R 2;  3S1M I;  1FDO A;  1VQ5 Z;  3NH4 A;  3S14 I;  3CCV 1;  3J81 b;  3RZD I;  3CME 1;  2QKD A;  4A3M I;  1ZB8 A;  3K7A I;  3G6E 1;  3CCV Z;  4MD9 A;  3CME Z;  1YJ9 1;  1JJ2 Y;  3CD6 Z;  2E2H I;  3G6E Z;  2O4H A;  5T6B A;  3CCQ Z;  1VQL 1;  1KQS Y;  2J6A A;  1LQL A;  2EGT A;  2VF1 A;  3J81 f;  2JIP A;  1ML8 A;  2O53 A;  3S2D I;  2I3C A;  3GTM S;  2VPY A;  2NAP A;  2GTI A;  1VQ8 1;  1I6H I;  2RPR A;  2H85 A;  3GTP I;  1S72 1;  1TWF I;  1M1K 1;  1M1K 2;  1VQ4 1;  1VQ7 1;  3KIF A;  1S72 Z;  2PM9 A;  1X3Z A;  2NVQ I;  1W2B Y;  2E7Z A;  1VQ7 Z;  1USP A;  4CL1 A;  1VQO 1;  3FQM A;  3HKZ A;  4E32 A;  3HOX I;  3G71 1;  2DE7 A;  2OTJ 1;  3S16 I;  1Q86 1;  2Q4Z A;  3HOZ I;  3D9X A;  3CPW Z;  3NDJ A;  1Q86 2;  4TNU A;  3CMA 1;  1QVG Y;  2E2J I;  1YIT 1;  3NH8 A;  3BG0 B;  1YUK A;  4A93 I;  3PO3 I;  1QVF Y;  4BBS I;  2ZAE B;  1N2F A;  2LEX A;  4NH1 C;  5D1O B;  2Y0S A;  2QEX 1;  3CCJ Z;  2WAQ A;  4S1T A;  5IT9 b;  4NFR A;  3IF8 A;  2QEX Z;  4NBD A;  2RHB A;  1VQM 1;  2VUM I;  5C4X I;  4NBG A;  4E31 A;  1YUA A;  4A3B I;  3GTQ I;  3S2H I;  1X0T A;  4MRI A;  5IP7 I;  3CCE 1;  3MZL B;  1RO0 A;  3CCM 1;  3RZO I;  1QYP A;  3J7A 4;  4A3D I;  1N8R 1;  5IT9 f;  3MON A;  3H3V J;  4NBA A;  3JAM f;  3I55 Z;  4NBH A;  4A3E I;  4A3L I;  2E2I I;  3S17 I;  3GTJ I;  3VMG A;  3HOW I;  4AYB A;  3S15 I;  2F4O A;  2VPZ A;  1VQ9 1;  3PO2 I;  2R93 I;  3FKI I;  2OOY B;  2NVT I;  1RQF A;  2QR1 B;  1YI2 1;  1DL6 A;  2V8J A;  1SIW A;  1QF8 A;  1YJ9 Z;  2BJO A;  3VMI A;  2W04 A;  2LIY A;  4E2W A;  1VQL Z;  3CC2 1;  4BXX I;  3GTM I;  3CXC Z;  2VPX A;  4E2Y A;  4QTT A;  1K9M 1;  1VQN 1;  3I07 A;  3CC2 Z;  4BBR I;  1K9M 2;  1TWG I;  3CCS 1;  1VQ8 Z;  1WCM I;  1YJN 1;  2QA4 1;  4A3G I;  3S1Q I;  3IX0 A;  1JWH C;  5LL6 f;  3CPW Y;  2RT9 A;  2K5R A;  2JIM A;  4QTU A;  3I56 1;  3T4N B;  1VQ4 Z;  3M3Y I;  2JA8 I;  4MH4 A;  1RNI A;  1VQ6 1; 
#chains in the Genus database with same CATH homology
 4NBC A;  1Y1V S;  3G4S 1;  2PK7 A;  1I50 I;  4X6A I;  4DK1 A;  3U50 C;  1VQO Z;  3G4S Z;  2G2K A;  3G71 Z;  2YU9 I;  4RVF A;  3J80 b;  1R9T I;  2OTJ Z;  2R92 I;  1KRL A;  4NB9 A;  1ZH1 A;  1VQK 1;  1M90 1;  2WB1 A;  3NFZ A;  3GTK I;  2QRD B;  1NJI 2;  4RV9 A;  1M90 2;  1NUI A;  3CCR 1;  3GCF A;  3CMA Z;  2JMO A;  2VUG A;  1VLA A;  1YIT Z;  1TWA I;  1YHQ 1;  3CCR Z;  1Q7Y 1;  3I4N I;  1YIJ 1;  3OW2 Z;  1SFO I;  3P5J B;  1Q7Y 2;  1KD1 1;  4MXU A;  1VQP 1;  3MZK B;  3J80 f;  1YHQ Z;  1KD1 2;  4A3C I;  1YIJ Z;  1Y1W I;  4NB8 A;  2LFU A;  2R6M A;  1KC8 1;  4NOZ A;  2JS4 A;  4HGZ A;  1KC8 2;  2HU9 A;  5IP9 I;  1VQM Z;  2PMZ A;  4E33 A;  5A2Q b;  2W03 A;  2OTL 1;  2P3Y A;  5D1P A;  3F3F C;  2QRE B;  1WW9 A;  2KPI A;  3H0G I;  3CQZ I;  3CCE Z;  3CCM Z;  2OTL Z;  4Y7N I;  4MD7 A;  1USP B;  4RVG A;  2B63 I;  1RO4 A;  3GTG I;  2JA6 I;  3NH5 A;  5CM2 M;  2RIQ A;  3GTL I;  2QLV B;  3CXC Y;  5A2Q f;  1VQ5 1;  3F3P C;  4MON A;  2AKL A;  5C3E I;  1Z01 A;  1VQ9 Z;  2IZ3 A;  3BG1 B;  4DGL A;  1L1O C;  1YI2 Z;  2V8I A;  3CC7 1;  1TWC I;  2QRC B;  1X3W A;  3QWU A;  2OOX B;  2JA7 I;  3EER A;  3CD6 1;  4XX2 A;  3CC7 Z;  4NBE A;  1K83 I;  1Q82 1;  5D1O A;  3ESW A;  1K73 1;  2E9H A;  1RLY A;  4NBF A;  3CCQ 1;  1Q82 2;  1K73 2;  1Z03 A;  4BY1 I;  5FLX b;  4E2Z A;  1VQN Z;  2Q51 A;  3CCU 1;  3CCS Z;  4A3K I;  3NDI A;  1YJN Z;  4A3F I;  2DE6 A;  2QA4 Z;  3HOY I;  4E30 A;  1Y1V I;  3VTN A;  2YAD A;  3CCU Z;  1JJ2 Z;  2KI7 B;  1PFT A;  3I56 Z;  1S7M A;  2F4M A;  3HOV I;  1VQ6 Z;  4E2X A;  1NP6 A;  2NVX I;  3TE5 B;  4EWC A;  1K8A 1;  3OW2 Y;  5FLX f;  1K8A 2;  1KQS Z;  1Z02 A;  3D6W A;  1YJW 1;  1NJI 1;  1P9N A;  2RBL A;  3KIH A;  2V8K A;  1YJW Z;  2M48 A;  1VQK Z;  2JA5 I;  2JR6 A;  3GTO I;  4DQY B;  5C44 I;  2DE5 A;  1TWH I;  3EED A;  4MD8 A;  2OZK A;  1W2B Z;  3CC4 1;  4HGY A;  2M6N A;  1VQP Z;  4NBB A;  3CC4 Z;  4A3J I;  3VMH A;  2JUB A;  2HF1 A;  1RO2 A;  5C4J I;  3PO3 S;  3CCJ 1;  2JNY A;  3TDH B;  4A3I I;  3IFU A;  3M4O I;  1WII A;  3Q87 A;  3I4M I;  2P28 A;  4RVH A;  2GU2 A;  3S1N I;  5T67 A;  1QVG Z;  1ZB9 A;  3FQQ A;  3CCL 1;  2GTH A;  1Q81 1;  3VB9 A;  2NVY I;  3JAM b;  4RS4 A;  1TFI A;  2K3R A;  4HH4 A;  1Q81 2;  3CCL Z;  1QVF Z;  2R7Z I;  3S1R I;  3GKQ A;  3LUS A;  5FLM I;  5T64 A;  4Y52 I;  4RVD A;  2IZ4 A;  1I3Q I;  5AN9 F;  3I55 1;  3HOU I;  4BY7 I;  1N8R 2;  3S1M I;  1VQ5 Z;  3NH4 A;  3S14 I;  3CCV 1;  3J81 b;  3RZD I;  3CME 1;  2QKD A;  4A3M I;  1ZB8 A;  3K7A I;  3G6E 1;  3CCV Z;  4MD9 A;  3CME Z;  1YJ9 1;  1JJ2 Y;  3CD6 Z;  2E2H I;  3G6E Z;  2O4H A;  5T6B A;  3CCQ Z;  1VQL 1;  1KQS Y;  2J6A A;  1LQL A;  2EGT A;  2VF1 A;  3J81 f;  1ML8 A;  2O53 A;  3S2D I;  2I3C A;  3GTM S;  2GTI A;  1VQ8 1;  1I6H I;  2RPR A;  2H85 A;  3GTP I;  1S72 1;  1TWF I;  1M1K 1;  1M1K 2;  1VQ4 1;  1VQ7 1;  3KIF A;  1S72 Z;  2PM9 A;  1X3Z A;  2NVQ I;  1W2B Y;  1VQ7 Z;  1USP A;  4CL1 A;  1VQO 1;  3FQM A;  3HKZ A;  4E32 A;  3HOX I;  3G71 1;  2DE7 A;  2OTJ 1;  3S16 I;  1Q86 1;  2Q4Z A;  3HOZ I;  3D9X A;  3CPW Z;  3NDJ A;  1Q86 2;  4TNU A;  3CMA 1;  1QVG Y;  2E2J I;  1YIT 1;  3NH8 A;  3BG0 B;  1YUK A;  4A93 I;  3PO3 I;  1QVF Y;  4BBS I;  2ZAE B;  1N2F A;  4NH1 C;  5D1O B;  2Y0S A;  2QEX 1;  3CCJ Z;  2WAQ A;  4S1T A;  5IT9 b;  4NFR A;  3IF8 A;  2QEX Z;  4NBD A;  2RHB A;  1VQM 1;  2VUM I;  5C4X I;  4NBG A;  4E31 A;  1YUA A;  4A3B I;  3GTQ I;  3S2H I;  1X0T A;  4MRI A;  5IP7 I;  3CCE 1;  3MZL B;  1RO0 A;  3CCM 1;  3RZO I;  1QYP A;  3J7A 4;  4A3D I;  1N8R 1;  5IT9 f;  3MON A;  3H3V J;  4NBA A;  3JAM f;  3I55 Z;  4NBH A;  4A3E I;  4A3L I;  2E2I I;  3S17 I;  3GTJ I;  3VMG A;  3HOW I;  4AYB A;  3S15 I;  2F4O A;  1VQ9 1;  3PO2 I;  2R93 I;  3FKI I;  2OOY B;  2NVT I;  1RQF A;  2QR1 B;  1YI2 1;  1DL6 A;  2V8J A;  1QF8 A;  1YJ9 Z;  2BJO A;  3VMI A;  2W04 A;  2LIY A;  4E2W A;  1VQL Z;  3CC2 1;  4BXX I;  3GTM I;  3CXC Z;  4E2Y A;  4QTT A;  1K9M 1;  1VQN 1;  3I07 A;  3CC2 Z;  4BBR I;  1K9M 2;  1TWG I;  3CCS 1;  1VQ8 Z;  1WCM I;  1YJN 1;  2QA4 1;  4A3G I;  3S1Q I;  3IX0 A;  1JWH C;  5LL6 f;  3CPW Y;  2RT9 A;  2K5R A;  4QTU A;  3I56 1;  3T4N B;  1VQ4 Z;  3M3Y I;  2JA8 I;  4MH4 A;  1RNI A;  1VQ6 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...