5IT9b

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
MVLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 4
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9b00
3J80b 3JAMb 3J81b 5FLXb 3J7A4 5IT9b 5LL6f 5A2Qb
chains in the Genus database with same CATH superfamily
3MZKB 1AA6A 4AYBA 1Y1WI 3I56Z 3CCQZ 4DGLA 1QXFA 3M4OI 1YJNZ 3S1MI 3CPWY 4A93I 2G2KA 1LQLA 1VQK1 1RO4A 5D1PA 1S721 4RVHA 5D1OA 4E2ZA 2VPZA 3OW2Z 2GTIA 4E2YA 2JS4A 2Q51A 1VQKZ 4MD9A 3G711 1Q7Y1 5C3EI 1NP6A 2I3CA 2QLVB 3I07A 2QEX1 4E30A 1YJ9Z 2JIOA 3IF8A 4RVDA 1WZNA 4MH4A 1VQ41 1WIIA 3T4NB 3I561 3CCQ1 1QVGY 1KQSZ 5FLXb 2QR1B 3M3YI 2WAQA 4A3EI 3S1RI 2OZKA 1N8R1 3EEDA 1YJW1 2IZ4A 1VQP1 1QVFY 3Q87A 4E32A 1M902 2O53A 2ZAEB 3RZOI 2JIPA 4A3JI 5IT9f 3CCRZ 1P9NA 2E7ZA 5FLXf 3CCR1 2DE5A 4RVFA 1I6HI 1VQ9Z 2NAPA 3CC21 1YUKA 1FDOA 5T64A 4A3DI 2NVQI 1TWFI 4NBCA 5C4JI 1YHQ1 3CCSZ 4BY7I 1ZB8A 2PK7A 3NDIA 2JA5I 1W2BY 4NFRA 3S2HI 4A3LI 1KC82 1VQOZ 2M48A 3S1NI 4S1TA 2F4MA 1TWGI 3U50C 4E2WA 3LUSA 1VQ4Z 2E2II 2JA7I 2Y0SA 3J81f 1VLAA 2AKLA 2NVTI 1Q7Y2 3VMHA 2BJOA 2QA4Z 1NUIA 1YJN1 2JIRA 4NB9A 1SFOI 1M901 1VQ6Z 4Y7NI 1TWAI 1YI21 1VQ7Z 4MD8A 3S17I 3TE5B 4E33A 3VB9A 1VQMZ 1YUAA 2QRDB 5D1OB 3H0GI 4MXUA 1Q822 3I4NI 2AYDA 4HH4A 1R9TI 3MONA 1X3ZA 3IX0A 5A2Qf 2HF1A 1KD11 4NBBA 3HOVI 2P3YA 1X0TA 1K9M1 3GTKI 1Q812 4A3CI 2M6NA 5CM2M 2E2HI 4E2XA 2QKDA 3CC7Z 1VQM1 4A3GI 3PO3S 3J80f 3FQMA 2JA6I 4A3KI 5IP9I 2VPXA 2RPRA 4QTTA 3CCJ1 1WW9A 1NJI1 1RNIA 1N2FA 4DK1A 4NOZA 2YADA 4TNUA 3VMGA 2O4HA 4Y52I 3G4S1 3PO3I 3HOWI 2OOYB 1YJWZ 2IV2X 1Q821 3S16I 3S1QI 3RZDI 1Z01A 1K8A1 3K7AI 3H3VJ 1VQN1 3NH5A 2VPYA 3CC41 1K731 2V3VA 1W2BZ 3HOUI 2R7ZI 1YHQZ 1RO0A 1USPB 2OTJZ 2LIYA 1YIJ1 3PO2I 3VTNA 2RT9A 2JIMA 5AN9F 5C4XI 3CCVZ 2QRCB 3VMIA 2OOXB 2VF1A 1Z03A 3GTJI 3GCFA 3CC71 4BBSI 1WJ2A 3F3FC 3QWUA 3HOXI 4NBHA 3G6EZ 4HGZA 4RVGA 3G4SZ 3CMA1 2F4OA 4A3II 2OTL1 3G71Z 3IFUA 2DE7A 1X3WA 1QYPA 1USPA 3S14I 1TFIA 1FDIA 4RV9A 3J81b 1Y1VI 1VQL1 2P28A 4A3MI 4NBFA 3GKQA 5C44I 3NFZA 1S7MA 3TDHB 3ESWA 4NBAA 1JWHC 1Y1VS 3CPWZ 2H85A 2J6AA 1WCMI 3J80b 2E2JI 3I551 2JR6A 1VQLZ 3GTPI 3CCM1 5IP7I 1M1K1 2RHBA 2RBLA 2GTHA 1K9M2 3GTQI 4NBDA 1YIJZ 3CD6Z 1KC81 4NBEA 1Q16A 1VQ51 1VQ61 3G6E1 3CCS1 4MONA 2OTJ1 4MRIA 2V8JA 2YU9I 3CMEZ 1VQ8Z 2DE6A 4A3FI 2PMZA 1VQO1 1VQ81 3HOYI 4DQYB 3BG0B 2KPIA 1YIT1 1I3QI 2LFUA 3CCMZ 1I50I 4MD7A 4A3BI 2GU2A 4EWCA 3CD61 1ZB9A 2R92I 2VUGA 1DL6A 1SIWA 3S15I 3J7A4 3HOZI 5IT9b 3CCU1 3CCE1 2VPWA 1TWHI 3JAMb 3P5JB 1RQFA 3NH8A 4NBGA 2NVYI 4BXXI 1KRLA 2W03A 1K8A2 3GTOI 5T67A 1ML8A 1Z02A 2VUMI 1NJI2 4RS4A 2JUBA 1RO2A 1K83I 1S72Z 3S2DI 3CCUZ 5T6BA 1Q862 2HU9A 2R6MA 2V8IA 3CCEZ 2OTLZ 3D2LA 4NH1C 2JNYA 1YI2Z 2JA8I 2QA41 3GTLI 1TWCI 1YITZ 3CCV1 2W04A 2V45A 3FKII 3CC4Z 1VQ71 3F3PC 2B63I 3MZLB 4BBRI 3I4MI 2LEXA 4NB8A 3IR7A 5LL6f 1JJ2Y 2WB1A 1QVGZ 1KQSY 4XX2A 3CXCZ 1PFTA 2JIQA 2R93I 3EERA 1ZH1A 5A2Qb 3HKZA 4E31A 3FQQA 3NDJA 1N8R2 2Q4ZA 1QVFZ 1VQNZ 3CC2Z 2V8KA 1VQ5Z 2JMOA 1Q861 1Q811 3CCL1 3D6WA 3NH4A 2KI7B 3CME1 1KD12 3I55Z 5FLMI 3CQZI 3GTGI 1RLYA 3JAMf 3CCJZ 1JJ2Z 1VQ91 1K732 3CXCY 3KIHA 3KIFA 2PM9A 2EGTA 3GTMI 4QTUA 1VQPZ 3OW2Y 4BY1I 4HGYA 2QREB 2IZ3A 3CCLZ 4CL1A 1YJ91 2RIQA 3D9XA 1QF8A 3BG1B 3GTMS 2K3RA 2QEXZ 1Y8CA 3CMAZ 2E9HA 4X6AI 2NVXI 1L1OC 2K5RA 1M1K2
chains in the Genus database with same CATH topology
3MZKB 4AYBA 1Y1WI 3I56Z 3CCQZ 4DGLA 3M4OI 1YJNZ 3S1MI 3CPWY 4A93I 2G2KA 1LQLA 1VQK1 1RO4A 5D1PA 1S721 4RVHA 5D1OA 4E2ZA 3OW2Z 2GTIA 4E2YA 2JS4A 2Q51A 1VQKZ 4MD9A 3G711 1Q7Y1 5C3EI 1NP6A 2I3CA 2QLVB 3I07A 2QEX1 4E30A 1YJ9Z 3IF8A 4RVDA 4MH4A 1VQ41 1WIIA 3T4NB 3I561 3CCQ1 1QVGY 1KQSZ 5FLXb 2QR1B 3M3YI 2WAQA 4A3EI 3S1RI 2OZKA 1N8R1 3EEDA 1YJW1 2IZ4A 1VQP1 1QVFY 3Q87A 4E32A 1M902 2O53A 2ZAEB 3RZOI 4A3JI 5IT9f 3CCRZ 1P9NA 5FLXf 3CCR1 2DE5A 4RVFA 1I6HI 1VQ9Z 3CC21 1YUKA 5T64A 4A3DI 2NVQI 1TWFI 4NBCA 5C4JI 1YHQ1 3CCSZ 4BY7I 1ZB8A 2PK7A 3NDIA 2JA5I 1W2BY 4NFRA 3S2HI 4A3LI 1KC82 1VQOZ 2M48A 3S1NI 4S1TA 2F4MA 1TWGI 3U50C 4E2WA 3LUSA 1VQ4Z 2E2II 2JA7I 2Y0SA 3J81f 1VLAA 2AKLA 2NVTI 1Q7Y2 3VMHA 2BJOA 2QA4Z 1NUIA 1YJN1 4NB9A 1SFOI 1M901 1VQ6Z 4Y7NI 1TWAI 1YI21 1VQ7Z 4MD8A 3S17I 3TE5B 4E33A 3VB9A 1VQMZ 1YUAA 2QRDB 5D1OB 3H0GI 4MXUA 1Q822 3I4NI 4HH4A 1R9TI 3MONA 1X3ZA 3IX0A 5A2Qf 2HF1A 1KD11 4NBBA 3HOVI 2P3YA 1X0TA 1K9M1 3GTKI 1Q812 4A3CI 2M6NA 5CM2M 2E2HI 4E2XA 2QKDA 3CC7Z 1VQM1 4A3GI 3PO3S 3J80f 3FQMA 2JA6I 4A3KI 5IP9I 2RPRA 4QTTA 3CCJ1 1WW9A 1NJI1 1RNIA 1N2FA 4DK1A 4NOZA 2YADA 4TNUA 3VMGA 2O4HA 4Y52I 3G4S1 3PO3I 3HOWI 2OOYB 1YJWZ 1Q821 3S16I 3S1QI 3RZDI 1Z01A 1K8A1 3K7AI 3H3VJ 1VQN1 3NH5A 3CC41 1K731 1W2BZ 3HOUI 2R7ZI 1YHQZ 1RO0A 1USPB 2OTJZ 2LIYA 1YIJ1 3PO2I 3VTNA 2RT9A 5AN9F 5C4XI 3CCVZ 2QRCB 3VMIA 2OOXB 2VF1A 1Z03A 3GTJI 3GCFA 3CC71 4BBSI 3F3FC 3QWUA 3HOXI 4NBHA 3G6EZ 4HGZA 4RVGA 3G4SZ 3CMA1 2F4OA 4A3II 2OTL1 3G71Z 3IFUA 2DE7A 1X3WA 1QYPA 1USPA 3S14I 1TFIA 4RV9A 3J81b 1Y1VI 1VQL1 2P28A 4A3MI 4NBFA 3GKQA 5C44I 3NFZA 1S7MA 3TDHB 3ESWA 4NBAA 1JWHC 1Y1VS 3CPWZ 2H85A 2J6AA 1WCMI 3J80b 2E2JI 3I551 2JR6A 1VQLZ 3GTPI 3CCM1 5IP7I 1M1K1 2RHBA 2RBLA 2GTHA 1K9M2 3GTQI 4NBDA 1YIJZ 3CD6Z 1KC81 4NBEA 1VQ51 1VQ61 3G6E1 3CCS1 4MONA 2OTJ1 4MRIA 2V8JA 2YU9I 3CMEZ 1VQ8Z 2DE6A 4A3FI 2PMZA 1VQO1 1VQ81 3HOYI 4DQYB 3BG0B 2KPIA 1YIT1 1I3QI 2LFUA 3CCMZ 1I50I 4MD7A 4A3BI 2GU2A 4EWCA 3CD61 1ZB9A 2R92I 2VUGA 1DL6A 3S15I 3J7A4 3HOZI 5IT9b 3CCU1 3CCE1 1TWHI 3JAMb 3P5JB 1RQFA 3NH8A 4NBGA 2NVYI 4BXXI 1KRLA 2W03A 1K8A2 3GTOI 5T67A 1ML8A 1Z02A 2VUMI 1NJI2 4RS4A 2JUBA 1RO2A 1K83I 1S72Z 3S2DI 3CCUZ 5T6BA 1Q862 2HU9A 2R6MA 2V8IA 3CCEZ 2OTLZ 4NH1C 2JNYA 1YI2Z 2JA8I 2QA41 3GTLI 1TWCI 1YITZ 3CCV1 2W04A 3FKII 3CC4Z 1VQ71 3F3PC 2B63I 3MZLB 4BBRI 3I4MI 4NB8A 5LL6f 1JJ2Y 2WB1A 1QVGZ 1KQSY 4XX2A 3CXCZ 1PFTA 2R93I 3EERA 1ZH1A 5A2Qb 3HKZA 4E31A 3FQQA 3NDJA 1N8R2 2Q4ZA 1QVFZ 1VQNZ 3CC2Z 2V8KA 1VQ5Z 2JMOA 1Q861 1Q811 3CCL1 3D6WA 3NH4A 2KI7B 3CME1 1KD12 3I55Z 5FLMI 3CQZI 3GTGI 1RLYA 3JAMf 3CCJZ 1JJ2Z 1VQ91 1K732 3CXCY 3KIHA 3KIFA 2PM9A 2EGTA 3GTMI 4QTUA 1VQPZ 3OW2Y 4BY1I 4HGYA 2QREB 2IZ3A 3CCLZ 4CL1A 2RIQA 1YJ91 3D9XA 1QF8A 3BG1B 3GTMS 2K3RA 2QEXZ 3CMAZ 2E9HA 4X6AI 2NVXI 1L1OC 2K5RA 1M1K2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 b;  3JAM b;  3J81 b;  5FLX b;  3J7A 4;  5IT9 b;  5LL6 f;  5A2Q b; 
#chains in the Genus database with same CATH topology
 3MZK B;  1AA6 A;  4AYB A;  1Y1W I;  3I56 Z;  3CCQ Z;  4DGL A;  1QXF A;  3M4O I;  1YJN Z;  3S1M I;  3CPW Y;  4A93 I;  2G2K A;  1LQL A;  1VQK 1;  1RO4 A;  5D1P A;  1S72 1;  4RVH A;  5D1O A;  4E2Z A;  2VPZ A;  3OW2 Z;  2GTI A;  4E2Y A;  2JS4 A;  2Q51 A;  1VQK Z;  4MD9 A;  3G71 1;  1Q7Y 1;  5C3E I;  1NP6 A;  2I3C A;  2QLV B;  3I07 A;  2QEX 1;  4E30 A;  1YJ9 Z;  2JIO A;  3IF8 A;  4RVD A;  1WZN A;  4MH4 A;  1VQ4 1;  1WII A;  3T4N B;  3I56 1;  3CCQ 1;  1QVG Y;  1KQS Z;  5FLX b;  2QR1 B;  3M3Y I;  2WAQ A;  4A3E I;  3S1R I;  2OZK A;  1N8R 1;  3EED A;  1YJW 1;  2IZ4 A;  1VQP 1;  1QVF Y;  3Q87 A;  4E32 A;  1M90 2;  2O53 A;  2ZAE B;  3RZO I;  2JIP A;  4A3J I;  5IT9 f;  3CCR Z;  1P9N A;  2E7Z A;  5FLX f;  3CCR 1;  2DE5 A;  4RVF A;  1I6H I;  1VQ9 Z;  2NAP A;  3CC2 1;  1YUK A;  1FDO A;  5T64 A;  4A3D I;  2NVQ I;  1TWF I;  4NBC A;  5C4J I;  1YHQ 1;  3CCS Z;  4BY7 I;  1ZB8 A;  2PK7 A;  3NDI A;  2JA5 I;  1W2B Y;  4NFR A;  3S2H I;  4A3L I;  1KC8 2;  1VQO Z;  2M48 A;  3S1N I;  4S1T A;  2F4M A;  1TWG I;  3U50 C;  4E2W A;  3LUS A;  1VQ4 Z;  2E2I I;  2JA7 I;  2Y0S A;  3J81 f;  1VLA A;  2AKL A;  2NVT I;  1Q7Y 2;  3VMH A;  2BJO A;  2QA4 Z;  1NUI A;  1YJN 1;  2JIR A;  4NB9 A;  1SFO I;  1M90 1;  1VQ6 Z;  4Y7N I;  1TWA I;  1YI2 1;  1VQ7 Z;  4MD8 A;  3S17 I;  3TE5 B;  4E33 A;  3VB9 A;  1VQM Z;  1YUA A;  2QRD B;  5D1O B;  3H0G I;  4MXU A;  1Q82 2;  3I4N I;  2AYD A;  4HH4 A;  1R9T I;  3MON A;  1X3Z A;  3IX0 A;  5A2Q f;  2HF1 A;  1KD1 1;  4NBB A;  3HOV I;  2P3Y A;  1X0T A;  1K9M 1;  3GTK I;  1Q81 2;  4A3C I;  2M6N A;  5CM2 M;  2E2H I;  4E2X A;  2QKD A;  3CC7 Z;  1VQM 1;  4A3G I;  3PO3 S;  3J80 f;  3FQM A;  2JA6 I;  4A3K I;  5IP9 I;  2VPX A;  2RPR A;  4QTT A;  3CCJ 1;  1WW9 A;  1NJI 1;  1RNI A;  1N2F A;  4DK1 A;  4NOZ A;  2YAD A;  4TNU A;  3VMG A;  2O4H A;  4Y52 I;  3G4S 1;  3PO3 I;  3HOW I;  2OOY B;  1YJW Z;  2IV2 X;  1Q82 1;  3S16 I;  3S1Q I;  3RZD I;  1Z01 A;  1K8A 1;  3K7A I;  3H3V J;  1VQN 1;  3NH5 A;  2VPY A;  3CC4 1;  1K73 1;  2V3V A;  1W2B Z;  3HOU I;  2R7Z I;  1YHQ Z;  1RO0 A;  1USP B;  2OTJ Z;  2LIY A;  1YIJ 1;  3PO2 I;  3VTN A;  2RT9 A;  2JIM A;  5AN9 F;  5C4X I;  3CCV Z;  2QRC B;  3VMI A;  2OOX B;  2VF1 A;  1Z03 A;  3GTJ I;  3GCF A;  3CC7 1;  4BBS I;  1WJ2 A;  3F3F C;  3QWU A;  3HOX I;  4NBH A;  3G6E Z;  4HGZ A;  4RVG A;  3G4S Z;  3CMA 1;  2F4O A;  4A3I I;  2OTL 1;  3G71 Z;  3IFU A;  2DE7 A;  1X3W A;  1QYP A;  1USP A;  3S14 I;  1TFI A;  1FDI A;  4RV9 A;  3J81 b;  1Y1V I;  1VQL 1;  2P28 A;  4A3M I;  4NBF A;  3GKQ A;  5C44 I;  3NFZ A;  1S7M A;  3TDH B;  3ESW A;  4NBA A;  1JWH C;  1Y1V S;  3CPW Z;  2H85 A;  2J6A A;  1WCM I;  3J80 b;  2E2J I;  3I55 1;  2JR6 A;  1VQL Z;  3GTP I;  3CCM 1;  5IP7 I;  1M1K 1;  2RHB A;  2RBL A;  2GTH A;  1K9M 2;  3GTQ I;  4NBD A;  1YIJ Z;  3CD6 Z;  1KC8 1;  4NBE A;  1Q16 A;  1VQ5 1;  1VQ6 1;  3G6E 1;  3CCS 1;  4MON A;  2OTJ 1;  4MRI A;  2V8J A;  2YU9 I;  3CME Z;  1VQ8 Z;  2DE6 A;  4A3F I;  2PMZ A;  1VQO 1;  1VQ8 1;  3HOY I;  4DQY B;  3BG0 B;  2KPI A;  1YIT 1;  1I3Q I;  2LFU A;  3CCM Z;  1I50 I;  4MD7 A;  4A3B I;  2GU2 A;  4EWC A;  3CD6 1;  1ZB9 A;  2R92 I;  2VUG A;  1DL6 A;  1SIW A;  3S15 I;  3J7A 4;  3HOZ I;  5IT9 b;  3CCU 1;  3CCE 1;  2VPW A;  1TWH I;  3JAM b;  3P5J B;  1RQF A;  3NH8 A;  4NBG A;  2NVY I;  4BXX I;  1KRL A;  2W03 A;  1K8A 2;  3GTO I;  5T67 A;  1ML8 A;  1Z02 A;  2VUM I;  1NJI 2;  4RS4 A;  2JUB A;  1RO2 A;  1K83 I;  1S72 Z;  3S2D I;  3CCU Z;  5T6B A;  1Q86 2;  2HU9 A;  2R6M A;  2V8I A;  3CCE Z;  2OTL Z;  3D2L A;  4NH1 C;  2JNY A;  1YI2 Z;  2JA8 I;  2QA4 1;  3GTL I;  1TWC I;  1YIT Z;  3CCV 1;  2W04 A;  2V45 A;  3FKI I;  3CC4 Z;  1VQ7 1;  3F3P C;  2B63 I;  3MZL B;  4BBR I;  3I4M I;  2LEX A;  4NB8 A;  3IR7 A;  5LL6 f;  1JJ2 Y;  2WB1 A;  1QVG Z;  1KQS Y;  4XX2 A;  3CXC Z;  1PFT A;  2JIQ A;  2R93 I;  3EER A;  1ZH1 A;  5A2Q b;  3HKZ A;  4E31 A;  3FQQ A;  3NDJ A;  1N8R 2;  2Q4Z A;  1QVF Z;  1VQN Z;  3CC2 Z;  2V8K A;  1VQ5 Z;  2JMO A;  1Q86 1;  1Q81 1;  3CCL 1;  3D6W A;  3NH4 A;  2KI7 B;  3CME 1;  1KD1 2;  3I55 Z;  5FLM I;  3CQZ I;  3GTG I;  1RLY A;  3JAM f;  3CCJ Z;  1JJ2 Z;  1VQ9 1;  1K73 2;  3CXC Y;  3KIH A;  3KIF A;  2PM9 A;  2EGT A;  3GTM I;  4QTU A;  1VQP Z;  3OW2 Y;  4BY1 I;  4HGY A;  2QRE B;  2IZ3 A;  3CCL Z;  4CL1 A;  1YJ9 1;  2RIQ A;  3D9X A;  1QF8 A;  3BG1 B;  3GTM S;  2K3R A;  2QEX Z;  1Y8C A;  3CMA Z;  2E9H A;  4X6A I;  2NVX I;  1L1O C;  2K5R A;  1M1K 2; 
#chains in the Genus database with same CATH homology
 3MZK B;  4AYB A;  1Y1W I;  3I56 Z;  3CCQ Z;  4DGL A;  3M4O I;  1YJN Z;  3S1M I;  3CPW Y;  4A93 I;  2G2K A;  1LQL A;  1VQK 1;  1RO4 A;  5D1P A;  1S72 1;  4RVH A;  5D1O A;  4E2Z A;  3OW2 Z;  2GTI A;  4E2Y A;  2JS4 A;  2Q51 A;  1VQK Z;  4MD9 A;  3G71 1;  1Q7Y 1;  5C3E I;  1NP6 A;  2I3C A;  2QLV B;  3I07 A;  2QEX 1;  4E30 A;  1YJ9 Z;  3IF8 A;  4RVD A;  4MH4 A;  1VQ4 1;  1WII A;  3T4N B;  3I56 1;  3CCQ 1;  1QVG Y;  1KQS Z;  5FLX b;  2QR1 B;  3M3Y I;  2WAQ A;  4A3E I;  3S1R I;  2OZK A;  1N8R 1;  3EED A;  1YJW 1;  2IZ4 A;  1VQP 1;  1QVF Y;  3Q87 A;  4E32 A;  1M90 2;  2O53 A;  2ZAE B;  3RZO I;  4A3J I;  5IT9 f;  3CCR Z;  1P9N A;  5FLX f;  3CCR 1;  2DE5 A;  4RVF A;  1I6H I;  1VQ9 Z;  3CC2 1;  1YUK A;  5T64 A;  4A3D I;  2NVQ I;  1TWF I;  4NBC A;  5C4J I;  1YHQ 1;  3CCS Z;  4BY7 I;  1ZB8 A;  2PK7 A;  3NDI A;  2JA5 I;  1W2B Y;  4NFR A;  3S2H I;  4A3L I;  1KC8 2;  1VQO Z;  2M48 A;  3S1N I;  4S1T A;  2F4M A;  1TWG I;  3U50 C;  4E2W A;  3LUS A;  1VQ4 Z;  2E2I I;  2JA7 I;  2Y0S A;  3J81 f;  1VLA A;  2AKL A;  2NVT I;  1Q7Y 2;  3VMH A;  2BJO A;  2QA4 Z;  1NUI A;  1YJN 1;  4NB9 A;  1SFO I;  1M90 1;  1VQ6 Z;  4Y7N I;  1TWA I;  1YI2 1;  1VQ7 Z;  4MD8 A;  3S17 I;  3TE5 B;  4E33 A;  3VB9 A;  1VQM Z;  1YUA A;  2QRD B;  5D1O B;  3H0G I;  4MXU A;  1Q82 2;  3I4N I;  4HH4 A;  1R9T I;  3MON A;  1X3Z A;  3IX0 A;  5A2Q f;  2HF1 A;  1KD1 1;  4NBB A;  3HOV I;  2P3Y A;  1X0T A;  1K9M 1;  3GTK I;  1Q81 2;  4A3C I;  2M6N A;  5CM2 M;  2E2H I;  4E2X A;  2QKD A;  3CC7 Z;  1VQM 1;  4A3G I;  3PO3 S;  3J80 f;  3FQM A;  2JA6 I;  4A3K I;  5IP9 I;  2RPR A;  4QTT A;  3CCJ 1;  1WW9 A;  1NJI 1;  1RNI A;  1N2F A;  4DK1 A;  4NOZ A;  2YAD A;  4TNU A;  3VMG A;  2O4H A;  4Y52 I;  3G4S 1;  3PO3 I;  3HOW I;  2OOY B;  1YJW Z;  1Q82 1;  3S16 I;  3S1Q I;  3RZD I;  1Z01 A;  1K8A 1;  3K7A I;  3H3V J;  1VQN 1;  3NH5 A;  3CC4 1;  1K73 1;  1W2B Z;  3HOU I;  2R7Z I;  1YHQ Z;  1RO0 A;  1USP B;  2OTJ Z;  2LIY A;  1YIJ 1;  3PO2 I;  3VTN A;  2RT9 A;  5AN9 F;  5C4X I;  3CCV Z;  2QRC B;  3VMI A;  2OOX B;  2VF1 A;  1Z03 A;  3GTJ I;  3GCF A;  3CC7 1;  4BBS I;  3F3F C;  3QWU A;  3HOX I;  4NBH A;  3G6E Z;  4HGZ A;  4RVG A;  3G4S Z;  3CMA 1;  2F4O A;  4A3I I;  2OTL 1;  3G71 Z;  3IFU A;  2DE7 A;  1X3W A;  1QYP A;  1USP A;  3S14 I;  1TFI A;  4RV9 A;  3J81 b;  1Y1V I;  1VQL 1;  2P28 A;  4A3M I;  4NBF A;  3GKQ A;  5C44 I;  3NFZ A;  1S7M A;  3TDH B;  3ESW A;  4NBA A;  1JWH C;  1Y1V S;  3CPW Z;  2H85 A;  2J6A A;  1WCM I;  3J80 b;  2E2J I;  3I55 1;  2JR6 A;  1VQL Z;  3GTP I;  3CCM 1;  5IP7 I;  1M1K 1;  2RHB A;  2RBL A;  2GTH A;  1K9M 2;  3GTQ I;  4NBD A;  1YIJ Z;  3CD6 Z;  1KC8 1;  4NBE A;  1VQ5 1;  1VQ6 1;  3G6E 1;  3CCS 1;  4MON A;  2OTJ 1;  4MRI A;  2V8J A;  2YU9 I;  3CME Z;  1VQ8 Z;  2DE6 A;  4A3F I;  2PMZ A;  1VQO 1;  1VQ8 1;  3HOY I;  4DQY B;  3BG0 B;  2KPI A;  1YIT 1;  1I3Q I;  2LFU A;  3CCM Z;  1I50 I;  4MD7 A;  4A3B I;  2GU2 A;  4EWC A;  3CD6 1;  1ZB9 A;  2R92 I;  2VUG A;  1DL6 A;  3S15 I;  3J7A 4;  3HOZ I;  5IT9 b;  3CCU 1;  3CCE 1;  1TWH I;  3JAM b;  3P5J B;  1RQF A;  3NH8 A;  4NBG A;  2NVY I;  4BXX I;  1KRL A;  2W03 A;  1K8A 2;  3GTO I;  5T67 A;  1ML8 A;  1Z02 A;  2VUM I;  1NJI 2;  4RS4 A;  2JUB A;  1RO2 A;  1K83 I;  1S72 Z;  3S2D I;  3CCU Z;  5T6B A;  1Q86 2;  2HU9 A;  2R6M A;  2V8I A;  3CCE Z;  2OTL Z;  4NH1 C;  2JNY A;  1YI2 Z;  2JA8 I;  2QA4 1;  3GTL I;  1TWC I;  1YIT Z;  3CCV 1;  2W04 A;  3FKI I;  3CC4 Z;  1VQ7 1;  3F3P C;  2B63 I;  3MZL B;  4BBR I;  3I4M I;  4NB8 A;  5LL6 f;  1JJ2 Y;  2WB1 A;  1QVG Z;  1KQS Y;  4XX2 A;  3CXC Z;  1PFT A;  2R93 I;  3EER A;  1ZH1 A;  5A2Q b;  3HKZ A;  4E31 A;  3FQQ A;  3NDJ A;  1N8R 2;  2Q4Z A;  1QVF Z;  1VQN Z;  3CC2 Z;  2V8K A;  1VQ5 Z;  2JMO A;  1Q86 1;  1Q81 1;  3CCL 1;  3D6W A;  3NH4 A;  2KI7 B;  3CME 1;  1KD1 2;  3I55 Z;  5FLM I;  3CQZ I;  3GTG I;  1RLY A;  3JAM f;  3CCJ Z;  1JJ2 Z;  1VQ9 1;  1K73 2;  3CXC Y;  3KIH A;  3KIF A;  2PM9 A;  2EGT A;  3GTM I;  4QTU A;  1VQP Z;  3OW2 Y;  4BY1 I;  4HGY A;  2QRE B;  2IZ3 A;  3CCL Z;  4CL1 A;  2RIQ A;  1YJ9 1;  3D9X A;  1QF8 A;  3BG1 B;  3GTM S;  2K3R A;  2QEX Z;  3CMA Z;  2E9H A;  4X6A I;  2NVX I;  1L1O C;  2K5R A;  1M1K 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...