3HOWI

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI02
2DE5A 2J6AA 3HOYI 3I07A 4NBBA 1TWGI 3S1QI 3GKQA 2YU9I 2E2HI 1ZB9A 4A3LI 2NVTI 2JA8I 3S1MI 5C44I 3GTKI 1SFOI 1I6HI 1N2FA 3S17I 1TWAI 3FKII 4NBFA 2VUMI 1R9TI 4NBGA 1K83I 3GTJI 3S16I 2HF1A 2JNYA 3K7AI 2DE6A 3PO3S 1TWFI 3U50C 1TWCI 1Y1VS 2BJOA 1VLAA 1NUIA 1I50I 1TWHI 4A3CI 3HOVI 3Q87A 5C3EI 4NBEA 3VMGA 4Y7NI 1L1OC 3VB9A 3GCFA 3HOZI 4A3DI 2NVXI 3GTQI 2JR6A 2R7ZI 3HOXI 2NVQI 4Y52I 4NB8A 1RO4A 2KPIA 1ZB8A 2P3YA 1DL6A 3GTMI 3I4NI 3GTLI 3D6WA 3VMIA 5IP9I 3I4MI 4BY7I 2E2JI 5IP7I 4BY1I 3LUSA 2E2II 3S1NI 4A93I 3GTMS 2JA7I 3HOUI 3GTOI 4QTTA 3HOWI 4A3KI 3CQZI 4NBAA 4A3JI 2DE7A 1WW9A 3EERA 4A3II 1Y1WI 4NOZA 2F4MA 3S15I 4A3FI 4QTUA 4A3EI 1WCMI 2B63I 3S1RI 2K5RA 4NBCA 4XX2A 1QYPA 4MH4A 4A3GI 2JA6I 1ML8A 4NBHA 1PFTA 4NB9A 1X3ZA 4BXXI 2R93I 2JS4A 3M4OI 3GTGI 3H3VJ 3VMHA 2NVYI 4A3BI 2RBLA 3ESWA 2R92I 1X3WA 4A3MI 3GTPI 3RZOI 5CM2M 5C4XI 1I3QI 1TFIA 2F4OA 3S2DI 3RZDI 2JA5I 2AKLA 5FLMI 3S14I 4NBDA 3M3YI 3PO3I 4BBSI 1Y1VI 1RLYA 5C4JI 1YUAA 1USPA 4X6AI 3PO2I 1USPB 1LQLA 4BBRI 2PK7A 3H0GI 3S2HI
chains in the Genus database with same CATH superfamily
3JAMb 2J6AA 2QA4Z 1YIJ1 4NBBA 3CCRZ 2E2HI 3G711 1QVFY 2JA8I 1Z01A 2V45A 1I6HI 1N2FA 1S7MA 2I3CA 2W04A 3FKII 3S17I 1R9TI 3G4S1 4E2ZA 1YJW1 3GTJI 3I561 1YJNZ 2HF1A 1K731 2OOXB 2DE6A 1TWFI 1TWCI 3CMA1 1NUIA 1I50I 4A3CI 2RT9A 3IR7A 1VQ4Z 3VB9A 4A3DI 1VQN1 2NVXI 2R7ZI 5A2Qf 3HOXI 4NB8A 2K3RA 3GTLI 1N8R1 4BY7I 2E2JI 5IP7I 1YHQ1 3HKZA 2R6MA 4A93I 3GTMS 1S72Z 3CC4Z 3HOUI 3HOWI 3CQZI 2H85A 3CC21 4MRIA 2OTL1 3T4NB 4NOZA 3S15I 4A3FI 2IV2X 2WAQA 3MZKB 2W03A 2QRCB 4NBCA 1Q821 3CME1 4MH4A 5D1OB 1YI2Z 3EEDA 3NDIA 2O4HA 2YADA 1VQL1 4S1TA 3F3FC 4A3BI 3RZOI 2M6NA 1RNIA 3CCQ1 1VQ7Z 1I3QI 4E30A 1VQ61 3RZDI 2OTJZ 1VQKZ 2AKLA 5FLMI 1YIT1 1VQ8Z 3M3YI 1Y1VI 4E32A 1FDOA 4EWCA 4RVHA 1YUAA 5A2Qb 3CCSZ 4X6AI 4E31A 3P5JB 2QRDB 1KQSZ 1Z02A 2IZ4A 1QVGY 2VPXA 1Q811 2DE5A 3CCJZ 3CCL1 2QR1B 4RS4A 1WJ2A 2JIMA 1QVFZ 4CL1A 3CCV1 3GTKI 2GTIA 1SFOI 4NBFA 1QF8A 4MONA 1VQM1 1RO0A 1KQSY 1VQPZ 3K7AI 3CCM1 1K9M1 3U50C 5LL6f 1K8A1 1Y1VS 1VLAA 3NFZA 4HH4A 1TWHI 3HOVI 3Q87A 5C3EI 1P9NA 3VMGA 1AA6A 4Y7NI 1VQ91 1L1OC 3CCU1 3GCFA 2Q4ZA 3HOZI 3CPWZ 1K9M2 2JR6A 1K8A2 3OW2Z 4Y52I 2KPIA 1ZB8A 3GTMI 3VMIA 1JJ2Y 1WZNA 2VPYA 5D1PA 3IX0A 1KD11 1YJN1 4BY1I 3LUSA 2E2II 3S1NI 2O53A 1YIJZ 3BG0B 2QLVB 4A3KI 1KD12 3G71Z 2DE7A 3EERA 1Y1WI 2LFUA 3CPWY 3F3PC 1YJ91 3OW2Y 4QTUA 4A3EI 1WCMI 2V8JA 2K5RA 4E2XA 4XX2A 1YJWZ 4A3GI 2JA6I 4NBHA 1PFTA 3I56Z 3CC71 2OOYB 1Z03A 2EGTA 3CMAZ 2Q51A 1S721 3TE5B 3VMHA 2R92I 2V3VA 4MD8A 5CM2M 1M1K2 1VQNZ 1TFIA 3S2DI 3S14I 3PO3I 1QXFA 3CXCY 1RLYA 3J7A4 4RVFA 1RQFA 2VUGA 1USPA 1YHQZ 3MZLB 3PO2I 2Y0SA 4BBRI 3CD61 3H0GI 1QVGZ 3S2HI 2QKDA 2GU2A 2JIOA 3CC2Z 2WB1A 2GTHA 3HOYI 1TWGI 1Q862 1NJI2 3GKQA 2YU9I 4A3LI 2NVTI 1M901 5C44I 1VQK1 1TWAI 3CCE1 3CMEZ 2M48A 1VQOZ 4NBGA 1K83I 5IT9f 1M902 3BG1B 2PMZA 2VPZA 1VQ51 1VQLZ 2JNYA 3IF8A 2IZ3A 3PO3S 2BJOA 4RV9A 3QWUA 3I551 1KRLA 3GTQI 2JIQA 2QEX1 1YITZ 1SIWA 2NVQI 1Q7Y1 4HGYA 1RO4A 2P3YA 3I4NI 3D6WA 5IP9I 1JJ2Z 3I4MI 2QREB 2JUBA 1FDIA 1Y8CA 2PM9A 1Q7Y2 2AYDA 1JWHC 1VQP1 3D2LA 3G6E1 2JA7I 4QTTA 1RO2A 2RPRA 4NBAA 4A3JI 2QA41 5T67A 2VPWA 1WW9A 3CCR1 3CCVZ 3NH5A 2F4MA 2HU9A 4HGZA 2B63I 3S1RI 4MD7A 2E7ZA 3J80f 1ML8A 3J81f 4NB9A 4DGLA 3FQQA 4MXUA 3CCMZ 5T64A 2JS4A 2P28A 3GTGI 3H3VJ 5IT9b 1VQ9Z 3CCUZ 2NVYI 2RBLA 1VQ41 2JIRA 4A3MI 2ZAEB 1ZH1A 1X0TA 5AN9F 2JA5I 1W2BZ 4NBDA 2KI7B 5C4JI 3CXCZ 3G4SZ 2E9HA 2OZKA 1USPB 3NDJA 1M1K1 1LQLA 4E33A 4DK1A 3CC41 3I07A 2V8IA 3S1QI 2LEXA 1K732 1NP6A 4MD9A 1Q16A 1ZB9A 4TNUA 1YJ9Z 3S1MI 1W2BY 3MONA 2VUMI 3CC7Z 2NAPA 4NFRA 4RVGA 4RVDA 1YI21 3S16I 1Q861 1NJI1 1N8R2 3J80b 5FLXf 3J81b 2LIYA 4NBEA 2JIPA 1KC81 2OTLZ 2V8KA 1VQ71 4AYBA 2OTJ1 5T6BA 1DL6A 1KC82 1VQ81 1VQO1 3JAMf 2VF1A 3CCS1 3CD6Z 1Q822 3GTOI 1WIIA 3CCJ1 3NH8A 3CCQZ 4NH1C 4A3II 1VQ6Z 3D9XA 3VTNA 3CCEZ 2JMOA 5D1OA 4E2WA 1QYPA 1YUKA 3NH4A 1VQ5Z 1X3ZA 4BXXI 2R93I 3FQMA 3M4OI 2RIQA 3KIHA 3CCLZ 3I55Z 3ESWA 3TDHB 1X3WA 3GTPI 5C4XI 2F4OA 2QEXZ 5FLXb 1Q812 3IFUA 4BBSI 3KIFA 1VQMZ 2G2KA 4E2YA 3G6EZ 2RHBA 4DQYB 2PK7A
chains in the Genus database with same CATH topology
3JAMb 2J6AA 2QA4Z 1YIJ1 4NBBA 3CCRZ 2E2HI 3G711 1QVFY 2JA8I 1Z01A 1I6HI 1N2FA 1S7MA 2I3CA 2W04A 3FKII 3S17I 1R9TI 3G4S1 4E2ZA 1YJW1 3GTJI 3I561 1YJNZ 2HF1A 1K731 2OOXB 2DE6A 1TWFI 1TWCI 3CMA1 1NUIA 1I50I 4A3CI 2RT9A 1VQ4Z 3VB9A 4A3DI 1VQN1 2NVXI 2R7ZI 5A2Qf 3HOXI 4NB8A 2K3RA 3GTLI 1N8R1 4BY7I 2E2JI 5IP7I 1YHQ1 3HKZA 2R6MA 4A93I 3GTMS 1S72Z 3CC4Z 3HOUI 3HOWI 3CQZI 2H85A 3CC21 4MRIA 2OTL1 3T4NB 4NOZA 3S15I 4A3FI 2WAQA 3MZKB 2W03A 2QRCB 4NBCA 1Q821 3CME1 4MH4A 5D1OB 1YI2Z 3EEDA 3NDIA 2O4HA 2YADA 1VQL1 4S1TA 3F3FC 4A3BI 3RZOI 2M6NA 1RNIA 3CCQ1 1VQ7Z 1I3QI 4E30A 1VQ61 3RZDI 2OTJZ 1VQKZ 2AKLA 5FLMI 1YIT1 1VQ8Z 3M3YI 1Y1VI 4E32A 4EWCA 4RVHA 1YUAA 5A2Qb 3CCSZ 4X6AI 4E31A 3P5JB 2QRDB 1KQSZ 1Z02A 2IZ4A 1QVGY 1Q811 2DE5A 3CCJZ 3CCL1 2QR1B 4RS4A 1QVFZ 4CL1A 3CCV1 3GTKI 2GTIA 1SFOI 4NBFA 1QF8A 4MONA 1VQM1 1RO0A 1KQSY 1VQPZ 3K7AI 3CCM1 1K9M1 3U50C 5LL6f 1K8A1 1Y1VS 1VLAA 3NFZA 4HH4A 1TWHI 3HOVI 3Q87A 5C3EI 1P9NA 3VMGA 4Y7NI 1VQ91 1L1OC 3CCU1 3GCFA 2Q4ZA 3HOZI 3CPWZ 1K9M2 2JR6A 1K8A2 3OW2Z 4Y52I 2KPIA 1ZB8A 3GTMI 3VMIA 1JJ2Y 5D1PA 3IX0A 1KD11 1YJN1 4BY1I 3LUSA 2E2II 3S1NI 2O53A 1YIJZ 3BG0B 2QLVB 4A3KI 1KD12 3G71Z 2DE7A 3EERA 1Y1WI 2LFUA 3CPWY 3F3PC 1YJ91 3OW2Y 4QTUA 4A3EI 1WCMI 2V8JA 2K5RA 4E2XA 4XX2A 1YJWZ 4A3GI 2JA6I 4NBHA 1PFTA 3I56Z 3CC71 2OOYB 1Z03A 2EGTA 3CMAZ 2Q51A 1S721 3TE5B 3VMHA 2R92I 1VQNZ 4MD8A 5CM2M 1M1K2 1TFIA 3S2DI 3S14I 3PO3I 3CXCY 1RLYA 3J7A4 4RVFA 1RQFA 2VUGA 1USPA 1YHQZ 3MZLB 3PO2I 2Y0SA 4BBRI 3CD61 3H0GI 1QVGZ 3S2HI 2QKDA 2GU2A 3CC2Z 2WB1A 2GTHA 3HOYI 1TWGI 1Q862 1NJI2 3GKQA 2YU9I 4A3LI 2NVTI 1M901 5C44I 1VQK1 1TWAI 3CCE1 3CMEZ 2M48A 1VQOZ 4NBGA 1K83I 5IT9f 1M902 3BG1B 2PMZA 1VQ51 1VQLZ 2JNYA 3IF8A 2IZ3A 3PO3S 2BJOA 4RV9A 3QWUA 3I551 1KRLA 3GTQI 2QEX1 1YITZ 2NVQI 1Q7Y1 4HGYA 1RO4A 2P3YA 3I4NI 3D6WA 5IP9I 1JJ2Z 3I4MI 2QREB 2JUBA 2PM9A 1Q7Y2 1JWHC 1VQP1 3G6E1 2JA7I 4QTTA 1RO2A 2RPRA 4NBAA 4A3JI 2QA41 5T67A 1WW9A 3CCR1 3CCVZ 3NH5A 2F4MA 2HU9A 4HGZA 2B63I 3S1RI 4MD7A 3J80f 1ML8A 3J81f 4NB9A 4DGLA 3FQQA 4MXUA 3CCMZ 5T64A 2JS4A 2P28A 3GTGI 3H3VJ 5IT9b 1VQ9Z 3CCUZ 2NVYI 2RBLA 1VQ41 4A3MI 2ZAEB 1ZH1A 1X0TA 5AN9F 2JA5I 1W2BZ 4NBDA 2KI7B 5C4JI 3CXCZ 3G4SZ 2E9HA 2OZKA 1USPB 3NDJA 1M1K1 1LQLA 4E33A 4DK1A 3CC41 3I07A 2V8IA 3S1QI 1K732 1NP6A 4MD9A 1ZB9A 4TNUA 1YJ9Z 3S1MI 1W2BY 3MONA 2VUMI 3CC7Z 4NFRA 4RVGA 4RVDA 1YI21 3S16I 1Q861 1NJI1 1N8R2 3J80b 5FLXf 3J81b 2LIYA 4NBEA 1KC81 2OTLZ 2V8KA 1VQ71 4AYBA 2OTJ1 5T6BA 1DL6A 1KC82 1VQ81 1VQO1 3JAMf 2VF1A 3CCS1 3CD6Z 1Q822 3GTOI 1WIIA 3CCJ1 3NH8A 3CCQZ 4NH1C 4A3II 1VQ6Z 3D9XA 3VTNA 3CCEZ 2JMOA 5D1OA 4E2WA 1QYPA 1YUKA 3NH4A 1VQ5Z 1X3ZA 4BXXI 2R93I 3FQMA 3M4OI 2RIQA 3KIHA 3CCLZ 3I55Z 3ESWA 3TDHB 1X3WA 3GTPI 5C4XI 2F4OA 2QEXZ 5FLXb 1Q812 3IFUA 4BBSI 3KIFA 1VQMZ 2G2KA 4E2YA 3G6EZ 2RHBA 4DQYB 2PK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE5 A;  2J6A A;  3HOY I;  3I07 A;  4NBB A;  1TWG I;  3S1Q I;  3GKQ A;  2YU9 I;  2E2H I;  1ZB9 A;  4A3L I;  2NVT I;  2JA8 I;  3S1M I;  5C44 I;  3GTK I;  1SFO I;  1I6H I;  1N2F A;  3S17 I;  1TWA I;  3FKI I;  4NBF A;  2VUM I;  1R9T I;  4NBG A;  1K83 I;  3GTJ I;  3S16 I;  2HF1 A;  2JNY A;  3K7A I;  2DE6 A;  3PO3 S;  1TWF I;  3U50 C;  1TWC I;  1Y1V S;  2BJO A;  1VLA A;  1NUI A;  1I50 I;  1TWH I;  4A3C I;  3HOV I;  3Q87 A;  5C3E I;  4NBE A;  3VMG A;  4Y7N I;  1L1O C;  3VB9 A;  3GCF A;  3HOZ I;  4A3D I;  2NVX I;  3GTQ I;  2JR6 A;  2R7Z I;  3HOX I;  2NVQ I;  4Y52 I;  4NB8 A;  1RO4 A;  2KPI A;  1ZB8 A;  2P3Y A;  1DL6 A;  3GTM I;  3I4N I;  3GTL I;  3D6W A;  3VMI A;  5IP9 I;  3I4M I;  4BY7 I;  2E2J I;  5IP7 I;  4BY1 I;  3LUS A;  2E2I I;  3S1N I;  4A93 I;  3GTM S;  2JA7 I;  3HOU I;  3GTO I;  4QTT A;  3HOW I;  4A3K I;  3CQZ I;  4NBA A;  4A3J I;  2DE7 A;  1WW9 A;  3EER A;  4A3I I;  1Y1W I;  4NOZ A;  2F4M A;  3S15 I;  4A3F I;  4QTU A;  4A3E I;  1WCM I;  2B63 I;  3S1R I;  2K5R A;  4NBC A;  4XX2 A;  1QYP A;  4MH4 A;  4A3G I;  2JA6 I;  1ML8 A;  4NBH A;  1PFT A;  4NB9 A;  1X3Z A;  4BXX I;  2R93 I;  2JS4 A;  3M4O I;  3GTG I;  3H3V J;  3VMH A;  2NVY I;  4A3B I;  2RBL A;  3ESW A;  2R92 I;  1X3W A;  4A3M I;  3GTP I;  3RZO I;  5CM2 M;  5C4X I;  1I3Q I;  1TFI A;  2F4O A;  3S2D I;  3RZD I;  2JA5 I;  2AKL A;  5FLM I;  3S14 I;  4NBD A;  3M3Y I;  3PO3 I;  4BBS I;  1Y1V I;  1RLY A;  5C4J I;  1YUA A;  1USP A;  4X6A I;  3PO2 I;  1USP B;  1LQL A;  4BBR I;  2PK7 A;  3H0G I;  3S2H I; 
#chains in the Genus database with same CATH topology
 3JAM b;  2J6A A;  2QA4 Z;  1YIJ 1;  4NBB A;  3CCR Z;  2E2H I;  3G71 1;  1QVF Y;  2JA8 I;  1Z01 A;  2V45 A;  1I6H I;  1N2F A;  1S7M A;  2I3C A;  2W04 A;  3FKI I;  3S17 I;  1R9T I;  3G4S 1;  4E2Z A;  1YJW 1;  3GTJ I;  3I56 1;  1YJN Z;  2HF1 A;  1K73 1;  2OOX B;  2DE6 A;  1TWF I;  1TWC I;  3CMA 1;  1NUI A;  1I50 I;  4A3C I;  2RT9 A;  3IR7 A;  1VQ4 Z;  3VB9 A;  4A3D I;  1VQN 1;  2NVX I;  2R7Z I;  5A2Q f;  3HOX I;  4NB8 A;  2K3R A;  3GTL I;  1N8R 1;  4BY7 I;  2E2J I;  5IP7 I;  1YHQ 1;  3HKZ A;  2R6M A;  4A93 I;  3GTM S;  1S72 Z;  3CC4 Z;  3HOU I;  3HOW I;  3CQZ I;  2H85 A;  3CC2 1;  4MRI A;  2OTL 1;  3T4N B;  4NOZ A;  3S15 I;  4A3F I;  2IV2 X;  2WAQ A;  3MZK B;  2W03 A;  2QRC B;  4NBC A;  1Q82 1;  3CME 1;  4MH4 A;  5D1O B;  1YI2 Z;  3EED A;  3NDI A;  2O4H A;  2YAD A;  1VQL 1;  4S1T A;  3F3F C;  4A3B I;  3RZO I;  2M6N A;  1RNI A;  3CCQ 1;  1VQ7 Z;  1I3Q I;  4E30 A;  1VQ6 1;  3RZD I;  2OTJ Z;  1VQK Z;  2AKL A;  5FLM I;  1YIT 1;  1VQ8 Z;  3M3Y I;  1Y1V I;  4E32 A;  1FDO A;  4EWC A;  4RVH A;  1YUA A;  5A2Q b;  3CCS Z;  4X6A I;  4E31 A;  3P5J B;  2QRD B;  1KQS Z;  1Z02 A;  2IZ4 A;  1QVG Y;  2VPX A;  1Q81 1;  2DE5 A;  3CCJ Z;  3CCL 1;  2QR1 B;  4RS4 A;  1WJ2 A;  2JIM A;  1QVF Z;  4CL1 A;  3CCV 1;  3GTK I;  2GTI A;  1SFO I;  4NBF A;  1QF8 A;  4MON A;  1VQM 1;  1RO0 A;  1KQS Y;  1VQP Z;  3K7A I;  3CCM 1;  1K9M 1;  3U50 C;  5LL6 f;  1K8A 1;  1Y1V S;  1VLA A;  3NFZ A;  4HH4 A;  1TWH I;  3HOV I;  3Q87 A;  5C3E I;  1P9N A;  3VMG A;  1AA6 A;  4Y7N I;  1VQ9 1;  1L1O C;  3CCU 1;  3GCF A;  2Q4Z A;  3HOZ I;  3CPW Z;  1K9M 2;  2JR6 A;  1K8A 2;  3OW2 Z;  4Y52 I;  2KPI A;  1ZB8 A;  3GTM I;  3VMI A;  1JJ2 Y;  1WZN A;  2VPY A;  5D1P A;  3IX0 A;  1KD1 1;  1YJN 1;  4BY1 I;  3LUS A;  2E2I I;  3S1N I;  2O53 A;  1YIJ Z;  3BG0 B;  2QLV B;  4A3K I;  1KD1 2;  3G71 Z;  2DE7 A;  3EER A;  1Y1W I;  2LFU A;  3CPW Y;  3F3P C;  1YJ9 1;  3OW2 Y;  4QTU A;  4A3E I;  1WCM I;  2V8J A;  2K5R A;  4E2X A;  4XX2 A;  1YJW Z;  4A3G I;  2JA6 I;  4NBH A;  1PFT A;  3I56 Z;  3CC7 1;  2OOY B;  1Z03 A;  2EGT A;  3CMA Z;  2Q51 A;  1S72 1;  3TE5 B;  3VMH A;  2R92 I;  2V3V A;  4MD8 A;  5CM2 M;  1M1K 2;  1VQN Z;  1TFI A;  3S2D I;  3S14 I;  3PO3 I;  1QXF A;  3CXC Y;  1RLY A;  3J7A 4;  4RVF A;  1RQF A;  2VUG A;  1USP A;  1YHQ Z;  3MZL B;  3PO2 I;  2Y0S A;  4BBR I;  3CD6 1;  3H0G I;  1QVG Z;  3S2H I;  2QKD A;  2GU2 A;  2JIO A;  3CC2 Z;  2WB1 A;  2GTH A;  3HOY I;  1TWG I;  1Q86 2;  1NJI 2;  3GKQ A;  2YU9 I;  4A3L I;  2NVT I;  1M90 1;  5C44 I;  1VQK 1;  1TWA I;  3CCE 1;  3CME Z;  2M48 A;  1VQO Z;  4NBG A;  1K83 I;  5IT9 f;  1M90 2;  3BG1 B;  2PMZ A;  2VPZ A;  1VQ5 1;  1VQL Z;  2JNY A;  3IF8 A;  2IZ3 A;  3PO3 S;  2BJO A;  4RV9 A;  3QWU A;  3I55 1;  1KRL A;  3GTQ I;  2JIQ A;  2QEX 1;  1YIT Z;  1SIW A;  2NVQ I;  1Q7Y 1;  4HGY A;  1RO4 A;  2P3Y A;  3I4N I;  3D6W A;  5IP9 I;  1JJ2 Z;  3I4M I;  2QRE B;  2JUB A;  1FDI A;  1Y8C A;  2PM9 A;  1Q7Y 2;  2AYD A;  1JWH C;  1VQP 1;  3D2L A;  3G6E 1;  2JA7 I;  4QTT A;  1RO2 A;  2RPR A;  4NBA A;  4A3J I;  2QA4 1;  5T67 A;  2VPW A;  1WW9 A;  3CCR 1;  3CCV Z;  3NH5 A;  2F4M A;  2HU9 A;  4HGZ A;  2B63 I;  3S1R I;  4MD7 A;  2E7Z A;  3J80 f;  1ML8 A;  3J81 f;  4NB9 A;  4DGL A;  3FQQ A;  4MXU A;  3CCM Z;  5T64 A;  2JS4 A;  2P28 A;  3GTG I;  3H3V J;  5IT9 b;  1VQ9 Z;  3CCU Z;  2NVY I;  2RBL A;  1VQ4 1;  2JIR A;  4A3M I;  2ZAE B;  1ZH1 A;  1X0T A;  5AN9 F;  2JA5 I;  1W2B Z;  4NBD A;  2KI7 B;  5C4J I;  3CXC Z;  3G4S Z;  2E9H A;  2OZK A;  1USP B;  3NDJ A;  1M1K 1;  1LQL A;  4E33 A;  4DK1 A;  3CC4 1;  3I07 A;  2V8I A;  3S1Q I;  2LEX A;  1K73 2;  1NP6 A;  4MD9 A;  1Q16 A;  1ZB9 A;  4TNU A;  1YJ9 Z;  3S1M I;  1W2B Y;  3MON A;  2VUM I;  3CC7 Z;  2NAP A;  4NFR A;  4RVG A;  4RVD A;  1YI2 1;  3S16 I;  1Q86 1;  1NJI 1;  1N8R 2;  3J80 b;  5FLX f;  3J81 b;  2LIY A;  4NBE A;  2JIP A;  1KC8 1;  2OTL Z;  2V8K A;  1VQ7 1;  4AYB A;  2OTJ 1;  5T6B A;  1DL6 A;  1KC8 2;  1VQ8 1;  1VQO 1;  3JAM f;  2VF1 A;  3CCS 1;  3CD6 Z;  1Q82 2;  3GTO I;  1WII A;  3CCJ 1;  3NH8 A;  3CCQ Z;  4NH1 C;  4A3I I;  1VQ6 Z;  3D9X A;  3VTN A;  3CCE Z;  2JMO A;  5D1O A;  4E2W A;  1QYP A;  1YUK A;  3NH4 A;  1VQ5 Z;  1X3Z A;  4BXX I;  2R93 I;  3FQM A;  3M4O I;  2RIQ A;  3KIH A;  3CCL Z;  3I55 Z;  3ESW A;  3TDH B;  1X3W A;  3GTP I;  5C4X I;  2F4O A;  2QEX Z;  5FLX b;  1Q81 2;  3IFU A;  4BBS I;  3KIF A;  1VQM Z;  2G2K A;  4E2Y A;  3G6E Z;  2RHB A;  4DQY B;  2PK7 A; 
#chains in the Genus database with same CATH homology
 3JAM b;  2J6A A;  2QA4 Z;  1YIJ 1;  4NBB A;  3CCR Z;  2E2H I;  3G71 1;  1QVF Y;  2JA8 I;  1Z01 A;  1I6H I;  1N2F A;  1S7M A;  2I3C A;  2W04 A;  3FKI I;  3S17 I;  1R9T I;  3G4S 1;  4E2Z A;  1YJW 1;  3GTJ I;  3I56 1;  1YJN Z;  2HF1 A;  1K73 1;  2OOX B;  2DE6 A;  1TWF I;  1TWC I;  3CMA 1;  1NUI A;  1I50 I;  4A3C I;  2RT9 A;  1VQ4 Z;  3VB9 A;  4A3D I;  1VQN 1;  2NVX I;  2R7Z I;  5A2Q f;  3HOX I;  4NB8 A;  2K3R A;  3GTL I;  1N8R 1;  4BY7 I;  2E2J I;  5IP7 I;  1YHQ 1;  3HKZ A;  2R6M A;  4A93 I;  3GTM S;  1S72 Z;  3CC4 Z;  3HOU I;  3HOW I;  3CQZ I;  2H85 A;  3CC2 1;  4MRI A;  2OTL 1;  3T4N B;  4NOZ A;  3S15 I;  4A3F I;  2WAQ A;  3MZK B;  2W03 A;  2QRC B;  4NBC A;  1Q82 1;  3CME 1;  4MH4 A;  5D1O B;  1YI2 Z;  3EED A;  3NDI A;  2O4H A;  2YAD A;  1VQL 1;  4S1T A;  3F3F C;  4A3B I;  3RZO I;  2M6N A;  1RNI A;  3CCQ 1;  1VQ7 Z;  1I3Q I;  4E30 A;  1VQ6 1;  3RZD I;  2OTJ Z;  1VQK Z;  2AKL A;  5FLM I;  1YIT 1;  1VQ8 Z;  3M3Y I;  1Y1V I;  4E32 A;  4EWC A;  4RVH A;  1YUA A;  5A2Q b;  3CCS Z;  4X6A I;  4E31 A;  3P5J B;  2QRD B;  1KQS Z;  1Z02 A;  2IZ4 A;  1QVG Y;  1Q81 1;  2DE5 A;  3CCJ Z;  3CCL 1;  2QR1 B;  4RS4 A;  1QVF Z;  4CL1 A;  3CCV 1;  3GTK I;  2GTI A;  1SFO I;  4NBF A;  1QF8 A;  4MON A;  1VQM 1;  1RO0 A;  1KQS Y;  1VQP Z;  3K7A I;  3CCM 1;  1K9M 1;  3U50 C;  5LL6 f;  1K8A 1;  1Y1V S;  1VLA A;  3NFZ A;  4HH4 A;  1TWH I;  3HOV I;  3Q87 A;  5C3E I;  1P9N A;  3VMG A;  4Y7N I;  1VQ9 1;  1L1O C;  3CCU 1;  3GCF A;  2Q4Z A;  3HOZ I;  3CPW Z;  1K9M 2;  2JR6 A;  1K8A 2;  3OW2 Z;  4Y52 I;  2KPI A;  1ZB8 A;  3GTM I;  3VMI A;  1JJ2 Y;  5D1P A;  3IX0 A;  1KD1 1;  1YJN 1;  4BY1 I;  3LUS A;  2E2I I;  3S1N I;  2O53 A;  1YIJ Z;  3BG0 B;  2QLV B;  4A3K I;  1KD1 2;  3G71 Z;  2DE7 A;  3EER A;  1Y1W I;  2LFU A;  3CPW Y;  3F3P C;  1YJ9 1;  3OW2 Y;  4QTU A;  4A3E I;  1WCM I;  2V8J A;  2K5R A;  4E2X A;  4XX2 A;  1YJW Z;  4A3G I;  2JA6 I;  4NBH A;  1PFT A;  3I56 Z;  3CC7 1;  2OOY B;  1Z03 A;  2EGT A;  3CMA Z;  2Q51 A;  1S72 1;  3TE5 B;  3VMH A;  2R92 I;  1VQN Z;  4MD8 A;  5CM2 M;  1M1K 2;  1TFI A;  3S2D I;  3S14 I;  3PO3 I;  3CXC Y;  1RLY A;  3J7A 4;  4RVF A;  1RQF A;  2VUG A;  1USP A;  1YHQ Z;  3MZL B;  3PO2 I;  2Y0S A;  4BBR I;  3CD6 1;  3H0G I;  1QVG Z;  3S2H I;  2QKD A;  2GU2 A;  3CC2 Z;  2WB1 A;  2GTH A;  3HOY I;  1TWG I;  1Q86 2;  1NJI 2;  3GKQ A;  2YU9 I;  4A3L I;  2NVT I;  1M90 1;  5C44 I;  1VQK 1;  1TWA I;  3CCE 1;  3CME Z;  2M48 A;  1VQO Z;  4NBG A;  1K83 I;  5IT9 f;  1M90 2;  3BG1 B;  2PMZ A;  1VQ5 1;  1VQL Z;  2JNY A;  3IF8 A;  2IZ3 A;  3PO3 S;  2BJO A;  4RV9 A;  3QWU A;  3I55 1;  1KRL A;  3GTQ I;  2QEX 1;  1YIT Z;  2NVQ I;  1Q7Y 1;  4HGY A;  1RO4 A;  2P3Y A;  3I4N I;  3D6W A;  5IP9 I;  1JJ2 Z;  3I4M I;  2QRE B;  2JUB A;  2PM9 A;  1Q7Y 2;  1JWH C;  1VQP 1;  3G6E 1;  2JA7 I;  4QTT A;  1RO2 A;  2RPR A;  4NBA A;  4A3J I;  2QA4 1;  5T67 A;  1WW9 A;  3CCR 1;  3CCV Z;  3NH5 A;  2F4M A;  2HU9 A;  4HGZ A;  2B63 I;  3S1R I;  4MD7 A;  3J80 f;  1ML8 A;  3J81 f;  4NB9 A;  4DGL A;  3FQQ A;  4MXU A;  3CCM Z;  5T64 A;  2JS4 A;  2P28 A;  3GTG I;  3H3V J;  5IT9 b;  1VQ9 Z;  3CCU Z;  2NVY I;  2RBL A;  1VQ4 1;  4A3M I;  2ZAE B;  1ZH1 A;  1X0T A;  5AN9 F;  2JA5 I;  1W2B Z;  4NBD A;  2KI7 B;  5C4J I;  3CXC Z;  3G4S Z;  2E9H A;  2OZK A;  1USP B;  3NDJ A;  1M1K 1;  1LQL A;  4E33 A;  4DK1 A;  3CC4 1;  3I07 A;  2V8I A;  3S1Q I;  1K73 2;  1NP6 A;  4MD9 A;  1ZB9 A;  4TNU A;  1YJ9 Z;  3S1M I;  1W2B Y;  3MON A;  2VUM I;  3CC7 Z;  4NFR A;  4RVG A;  4RVD A;  1YI2 1;  3S16 I;  1Q86 1;  1NJI 1;  1N8R 2;  3J80 b;  5FLX f;  3J81 b;  2LIY A;  4NBE A;  1KC8 1;  2OTL Z;  2V8K A;  1VQ7 1;  4AYB A;  2OTJ 1;  5T6B A;  1DL6 A;  1KC8 2;  1VQ8 1;  1VQO 1;  3JAM f;  2VF1 A;  3CCS 1;  3CD6 Z;  1Q82 2;  3GTO I;  1WII A;  3CCJ 1;  3NH8 A;  3CCQ Z;  4NH1 C;  4A3I I;  1VQ6 Z;  3D9X A;  3VTN A;  3CCE Z;  2JMO A;  5D1O A;  4E2W A;  1QYP A;  1YUK A;  3NH4 A;  1VQ5 Z;  1X3Z A;  4BXX I;  2R93 I;  3FQM A;  3M4O I;  2RIQ A;  3KIH A;  3CCL Z;  3I55 Z;  3ESW A;  3TDH B;  1X3W A;  3GTP I;  5C4X I;  2F4O A;  2QEX Z;  5FLX b;  1Q81 2;  3IFU A;  4BBS I;  3KIF A;  1VQM Z;  2G2K A;  4E2Y A;  3G6E Z;  2RHB A;  4DQY B;  2PK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...