3HOWI

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI02
3HOUI 5C4JI 2K5RA 3S14I 1ZB9A 2E2II 1TWCI 3RZDI 3GTMS 3S2DI 3HOXI 2F4MA 2NVYI 4XX2A 4A93I 3Q87A 1TWAI 4A3II 1RLYA 2F4OA 2JA5I 3ESWA 4A3DI 1Y1WI 3VMHA 2YU9I 2B63I 3I4NI 3HOVI 3VMGA 4A3CI 5IP7I 3H0GI 3FKII 2PK7A 4X6AI 1TWHI 2JA8I 1I3QI 1ZB8A 1YUAA 2J6AA 3M3YI 4NB8A 4A3EI 1Y1VI 1I50I 2E2HI 2NVXI 4NBCA 4BXXI 1WCMI 1Y1VS 2JNYA 4NBAA 3S1MI 1PFTA 2AKLA 1DL6A 2NVQI 3GTOI 4NBFA 2DE6A 1USPA 2DE7A 3U50C 4NBHA 3M4OI 2E2JI 3PO2I 4NBEA 4A3FI 3RZOI 4MH4A 4A3KI 3CQZI 3I07A 1TWGI 4NBDA 3HOWI 2R7ZI 4NBBA 1WW9A 3I4MI 1R9TI 2R92I 3PO3I 4A3BI 5FLMI 3EERA 4A3MI 3PO3S 1X3WA 2JR6A 1VLAA 3GTPI 2JS4A 3GKQA 1I6HI 3S2HI 1LQLA 2P3YA 4A3GI 4BY1I 4NBGA 2BJOA 5CM2M 3GTKI 4A3JI 4BBSI 4A3LI 1N2FA 2JA6I 1RO4A 1TFIA 4NOZA 2JA7I 5C4XI 3K7AI 3VMIA 3S16I 3GCFA 1ML8A 4BY7I 1NUIA 3S1QI 4BBRI 3GTQI 3GTLI 2R93I 1USPB 1L1OC 2RBLA 3GTMI 3S1NI 5C3EI 4QTUA 2HF1A 2VUMI 2NVTI 4Y7NI 3HOYI 2KPIA 3S1RI 1SFOI 2DE5A 3VB9A 4QTTA 5C44I 1K83I 3H3VJ 3GTGI 1X3ZA 3S15I 1TWFI 3LUSA 3S17I 1QYPA 3HOZI 5IP9I 3D6WA 4NB9A 4Y52I 3GTJI
chains in the Genus database with same CATH superfamily
2IZ4A 1VQ81 2QRDB 1NJI1 1ZB9A 3CCMZ 1TWCI 3RZDI 3GTMS 1RO2A 1VQ8Z 2YADA 2F4MA 1Q822 4XX2A 3Q87A 1KD12 3G4S1 2Q51A 5T67A 3CC41 2O53A 2JA5I 3ESWA 2RHBA 4E32A 3CXCY 3J7A4 4HGZA 3G4SZ 5IP7I 1S721 1TWHI 3CXCZ 3QWUA 2E2HI 4BXXI 3CPWZ 1RNIA 1WCMI 4NBAA 3S1MI 4DK1A 3CCQ1 2NAPA 2Y0SA 4NBHA 2H85A 4MD7A 4NFRA 2E2JI 4NBEA 1YHQ1 3RZOI 2PM9A 2VPXA 3J80f 4A3KI 2R7ZI 2JIMA 2RT9A 2W03A 2OTJ1 4TNUA 3PO3I 4A3MI 1YHQZ 1N8R1 1X3WA 5D1OB 3PO3S 1YUKA 1VLAA 3GTPI 1S7MA 3I561 1I6HI 3S2HI 2VF1A 1QXFA 1VQ71 1K731 1ZH1A 2OTJZ 3G6E1 2RIQA 4MRIA 4BBSI 4A3LI 3EEDA 3CC2Z 5T6BA 1JWHC 2G2KA 4RV9A 4DQYB 3S16I 1VQLZ 3GCFA 1VQ7Z 2PMZA 4RVFA 2QRCB 1NUIA 3G6EZ 2QLVB 1L1OC 2RBLA 1K9M2 2V8IA 2HF1A 2NVTI 4MD8A 1K8A2 3CME1 2DE5A 1Q812 3VB9A 2M6NA 1K83I 1AA6A 1QYPA 3CC71 5IP9I 5IT9b 3CMEZ 5D1OA 2JIPA 2GTIA 5C4JI 2K5RA 3CC7Z 2E2II 1WJ2A 2QEX1 1Q862 3D2LA 3NH5A 1M1K1 3TE5B 1YJWZ 1QVGY 3CMA1 4A93I 2O4HA 2QEXZ 2VUGA 1P9NA 1YI2Z 2GTHA 1QVGZ 1RLYA 3CMAZ 1Y1WI 3VMHA 3I4NI 3HOVI 4X6AI 2PK7A 2W04A 2JA8I 1ZB8A 1YUAA 2J6AA 1RQFA 2OTLZ 1Y1VI 4NBCA 2JNYA 1Y1VS 2AKLA 1DL6A 2KI7B 4NBFA 3M4OI 4E31A 4A3FI 3HOWI 1TWGI 1KRLA 3NDIA 3CPWY 2E7ZA 2R92I 3CCU1 3MZKB 2OOYB 2EGTA 2OOXB 2QA4Z 3J81f 2P3YA 4BY1I 4MXUA 3GTKI 3CCUZ 1KC82 3IR7A 1VQ4Z 3OW2Z 2JA6I 1VQP1 4NOZA 2JA7I 3VMIA 3CCR1 1KQSZ 3CCE1 2R93I 1USPB 2JIQA 1VQPZ 2V3VA 2VPYA 2KPIA 3CC21 1SFOI 3FQMA 3CCRZ 3JAMb 1M901 3CCEZ 1VQL1 1Y8CA 3F3FC 3H3VJ 3LUSA 3S17I 4RVGA 3HOZI 3MONA 5FLXb 4EWCA 3NH4A 3S14I 4HGYA 1Q821 3MZLB 1KD11 2E9HA 3F3PC 1NJI2 2M48A 2Q4ZA 3NDJA 3BG1B 2F4OA 3CCV1 3G711 2LEXA 2B63I 2P28A 4A3CI 4E30A 4S1TA 3H0GI 3FKII 1YJNZ 1YJW1 3BG0B 1FDIA 3CCVZ 1FDOA 3G71Z 4A3EI 1YI21 4HH4A 1PFTA 3T4NB 2DE6A 3CCL1 4E2YA 1Z03A 5AN9F 3CCS1 3PO2I 2K3RA 1Q7Y2 1QVFZ 3I551 2OTL1 3CCLZ 2JIRA 3I07A 4NBDA 3CCSZ 5A2Qb 1VQO1 1R9TI 2QREB 4A3BI 3EERA 3CD6Z 2JR6A 3FQQA 3I55Z 3GKQA 1W2BY 1LQLA 1JJ2Z 4A3GI 2VPZA 1VQOZ 4NBGA 2BJOA 4A3JI 1N8R2 1K9M1 3IF8A 5C4XI 3K7AI 1W2BZ 4MONA 1ML8A 1K732 4BY7I 4BBRI 2LFUA 1VQ9Z 3GTQI 1K8A1 1Q811 2QA41 1VQMZ 3GTMI 4QTUA 2VUMI 3HOYI 2IZ3A 3S1RI 1VQ41 3OW2Y 4QTTA 5LL6f 1VQK1 3D9XA 1VQ51 2QKDA 3GTGI 1X3ZA 3S15I 1KQSY 4MD9A 3D6WA 4NB9A 2JMOA 3JAMf 1Z02A 1Q861 1VQKZ 1YIT1 4E33A 1VQ5Z 3HOUI 3CC4Z 3IFUA 2V8JA 4Y52I 4RVHA 5D1PA 3S2DI 1YITZ 5FLXf 1S72Z 3HOXI 2WAQA 2NVYI 1Q7Y1 1TWAI 4A3II 1M1K2 1NP6A 1WIIA 3J81b 4NH1C 3CCQZ 4A3DI 2YU9I 2I3CA 3VMGA 2RPRA 1I3QI 3M3YI 4E2WA 4NB8A 5IT9f 1I50I 2NVXI 1SIWA 2V8KA 3J80b 2NVQI 3GTOI 1USPA 2DE7A 2IV2X 3U50C 4CL1A 3I56Z 1YJN1 2GU2A 2V45A 3TDHB 1QF8A 2AYDA 4MH4A 4RVDA 1VQN1 3CQZI 4NBBA 1WW9A 3IX0A 3I4MI 2JUBA 5FLMI 1KC81 1VQNZ 2JS4A 2R6MA 1WZNA 4AYBA 3VTNA 1Z01A 1YIJ1 5CM2M 4E2ZA 4DGLA 1QVFY 1N2FA 5A2Qf 2QR1B 5T64A 1RO4A 3CCJ1 1TFIA 1VQ61 1Q16A 3KIHA 3CD61 2ZAEB 3S1QI 1YIJZ 3GTLI 2HU9A 3CCJZ 3P5JB 1JJ2Y 2JIOA 3S1NI 5C3EI 1RO0A 4Y7NI 1VQ6Z 2OZKA 4RS4A 1YJ91 2LIYA 1X0TA 2WB1A 5C44I 3NFZA 2VPWA 1VQ91 1TWFI 3NH8A 1M902 3CCM1 1VQM1 3HKZA 1YJ9Z 3KIFA 4E2XA 3GTJI
chains in the Genus database with same CATH topology
2IZ4A 1VQ81 2QRDB 1NJI1 1ZB9A 3CCMZ 1TWCI 3RZDI 3GTMS 1RO2A 1VQ8Z 2YADA 2F4MA 1Q822 4XX2A 3Q87A 1KD12 3G4S1 2Q51A 5T67A 3CC41 2O53A 2JA5I 3ESWA 2RHBA 4E32A 3CXCY 3J7A4 4HGZA 3G4SZ 5IP7I 1S721 1TWHI 3CXCZ 3QWUA 2E2HI 4BXXI 3CPWZ 1RNIA 1WCMI 4NBAA 3S1MI 4DK1A 3CCQ1 2Y0SA 4NBHA 2H85A 4MD7A 4NFRA 2E2JI 4NBEA 1YHQ1 3RZOI 2PM9A 3J80f 4A3KI 2R7ZI 2RT9A 2W03A 2OTJ1 4TNUA 3PO3I 4A3MI 1YHQZ 1N8R1 1X3WA 5D1OB 3PO3S 1YUKA 1VLAA 3GTPI 1S7MA 3I561 1I6HI 3S2HI 2VF1A 1VQ71 1K731 1ZH1A 2OTJZ 3G6E1 2RIQA 4MRIA 4BBSI 4A3LI 3EEDA 3CC2Z 5T6BA 1JWHC 2G2KA 4RV9A 4DQYB 3S16I 1VQLZ 3GCFA 1VQ7Z 2PMZA 4RVFA 2QRCB 1NUIA 3G6EZ 2QLVB 1L1OC 2RBLA 1K9M2 2V8IA 2HF1A 2NVTI 4MD8A 1K8A2 3CME1 2DE5A 1Q812 3VB9A 2M6NA 1K83I 1QYPA 3CC71 5IP9I 5IT9b 3CMEZ 5D1OA 2GTIA 5C4JI 2K5RA 3CC7Z 2E2II 2QEX1 1Q862 3NH5A 1M1K1 3TE5B 1YJWZ 1QVGY 3CMA1 4A93I 2O4HA 2QEXZ 2VUGA 1P9NA 1YI2Z 2GTHA 1QVGZ 1RLYA 3CMAZ 1Y1WI 3VMHA 3I4NI 3HOVI 4X6AI 2PK7A 2W04A 2JA8I 1ZB8A 1YUAA 2J6AA 1RQFA 2OTLZ 1Y1VI 4NBCA 2JNYA 1Y1VS 2AKLA 1DL6A 2KI7B 4NBFA 3M4OI 4E31A 4A3FI 3HOWI 1TWGI 1KRLA 3NDIA 3CPWY 2R92I 3CCU1 3MZKB 2OOYB 2EGTA 2OOXB 2QA4Z 3J81f 2P3YA 4BY1I 4MXUA 3GTKI 3CCUZ 1KC82 1VQ4Z 3OW2Z 2JA6I 1VQP1 4NOZA 2JA7I 3VMIA 3CCR1 1KQSZ 3CCE1 2R93I 1USPB 1VQPZ 2KPIA 3CC21 1SFOI 3FQMA 3CCRZ 3JAMb 1M901 3CCEZ 1VQL1 3F3FC 3H3VJ 3LUSA 3S17I 4RVGA 3HOZI 3MONA 5FLXb 4EWCA 3NH4A 3S14I 4HGYA 1Q821 3MZLB 1KD11 2E9HA 3F3PC 1NJI2 2M48A 2Q4ZA 3NDJA 3BG1B 2F4OA 3CCV1 3G711 2B63I 2P28A 4A3CI 4E30A 4S1TA 3H0GI 3FKII 1YJNZ 1YJW1 3BG0B 3CCVZ 3G71Z 4A3EI 1YI21 4HH4A 1PFTA 3T4NB 2DE6A 3CCL1 4E2YA 1Z03A 5AN9F 3CCS1 3PO2I 2K3RA 1Q7Y2 1QVFZ 3I551 2OTL1 3CCLZ 3I07A 4NBDA 3CCSZ 5A2Qb 1VQO1 1R9TI 2QREB 4A3BI 3EERA 3CD6Z 2JR6A 3FQQA 3I55Z 3GKQA 1W2BY 1LQLA 1JJ2Z 4A3GI 1VQOZ 4NBGA 2BJOA 4A3JI 1N8R2 1K9M1 3IF8A 5C4XI 3K7AI 1W2BZ 4MONA 1ML8A 1K732 4BY7I 4BBRI 2LFUA 1VQ9Z 3GTQI 1K8A1 1Q811 2QA41 1VQMZ 3GTMI 4QTUA 2VUMI 3HOYI 2IZ3A 3S1RI 1VQ41 3OW2Y 4QTTA 5LL6f 1VQK1 3D9XA 1VQ51 2QKDA 3GTGI 1X3ZA 3S15I 1KQSY 4MD9A 3D6WA 4NB9A 2JMOA 3JAMf 1Z02A 1Q861 1VQKZ 1YIT1 4E33A 1VQ5Z 3HOUI 3CC4Z 3IFUA 2V8JA 4Y52I 4RVHA 5D1PA 3S2DI 1YITZ 5FLXf 1S72Z 3HOXI 2WAQA 2NVYI 1Q7Y1 1TWAI 4A3II 1M1K2 1NP6A 1WIIA 3J81b 4NH1C 3CCQZ 4A3DI 2YU9I 2I3CA 3VMGA 2RPRA 1I3QI 3M3YI 4E2WA 4NB8A 5IT9f 1I50I 2NVXI 2V8KA 3J80b 2NVQI 3GTOI 1USPA 2DE7A 3U50C 4CL1A 3I56Z 1YJN1 2GU2A 3TDHB 1QF8A 4MH4A 4RVDA 1VQN1 3CQZI 4NBBA 1WW9A 3IX0A 3I4MI 2JUBA 5FLMI 1KC81 1VQNZ 2JS4A 2R6MA 4AYBA 3VTNA 1Z01A 1YIJ1 5CM2M 4E2ZA 4DGLA 1QVFY 1N2FA 5A2Qf 2QR1B 5T64A 1RO4A 3CCJ1 1TFIA 1VQ61 3KIHA 3CD61 2ZAEB 3S1QI 1YIJZ 3GTLI 2HU9A 3CCJZ 3P5JB 1JJ2Y 3S1NI 5C3EI 1RO0A 4Y7NI 1VQ6Z 2OZKA 4RS4A 1YJ91 2LIYA 1X0TA 2WB1A 5C44I 3NFZA 1VQ91 1TWFI 3NH8A 1M902 3CCM1 1VQM1 3HKZA 1YJ9Z 3KIFA 4E2XA 3GTJI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU I;  5C4J I;  2K5R A;  3S14 I;  1ZB9 A;  2E2I I;  1TWC I;  3RZD I;  3GTM S;  3S2D I;  3HOX I;  2F4M A;  2NVY I;  4XX2 A;  4A93 I;  3Q87 A;  1TWA I;  4A3I I;  1RLY A;  2F4O A;  2JA5 I;  3ESW A;  4A3D I;  1Y1W I;  3VMH A;  2YU9 I;  2B63 I;  3I4N I;  3HOV I;  3VMG A;  4A3C I;  5IP7 I;  3H0G I;  3FKI I;  2PK7 A;  4X6A I;  1TWH I;  2JA8 I;  1I3Q I;  1ZB8 A;  1YUA A;  2J6A A;  3M3Y I;  4NB8 A;  4A3E I;  1Y1V I;  1I50 I;  2E2H I;  2NVX I;  4NBC A;  4BXX I;  1WCM I;  1Y1V S;  2JNY A;  4NBA A;  3S1M I;  1PFT A;  2AKL A;  1DL6 A;  2NVQ I;  3GTO I;  4NBF A;  2DE6 A;  1USP A;  2DE7 A;  3U50 C;  4NBH A;  3M4O I;  2E2J I;  3PO2 I;  4NBE A;  4A3F I;  3RZO I;  4MH4 A;  4A3K I;  3CQZ I;  3I07 A;  1TWG I;  4NBD A;  3HOW I;  2R7Z I;  4NBB A;  1WW9 A;  3I4M I;  1R9T I;  2R92 I;  3PO3 I;  4A3B I;  5FLM I;  3EER A;  4A3M I;  3PO3 S;  1X3W A;  2JR6 A;  1VLA A;  3GTP I;  2JS4 A;  3GKQ A;  1I6H I;  3S2H I;  1LQL A;  2P3Y A;  4A3G I;  4BY1 I;  4NBG A;  2BJO A;  5CM2 M;  3GTK I;  4A3J I;  4BBS I;  4A3L I;  1N2F A;  2JA6 I;  1RO4 A;  1TFI A;  4NOZ A;  2JA7 I;  5C4X I;  3K7A I;  3VMI A;  3S16 I;  3GCF A;  1ML8 A;  4BY7 I;  1NUI A;  3S1Q I;  4BBR I;  3GTQ I;  3GTL I;  2R93 I;  1USP B;  1L1O C;  2RBL A;  3GTM I;  3S1N I;  5C3E I;  4QTU A;  2HF1 A;  2VUM I;  2NVT I;  4Y7N I;  3HOY I;  2KPI A;  3S1R I;  1SFO I;  2DE5 A;  3VB9 A;  4QTT A;  5C44 I;  1K83 I;  3H3V J;  3GTG I;  1X3Z A;  3S15 I;  1TWF I;  3LUS A;  3S17 I;  1QYP A;  3HOZ I;  5IP9 I;  3D6W A;  4NB9 A;  4Y52 I;  3GTJ I; 
#chains in the Genus database with same CATH topology
 2IZ4 A;  1VQ8 1;  2QRD B;  1NJI 1;  1ZB9 A;  3CCM Z;  1TWC I;  3RZD I;  3GTM S;  1RO2 A;  1VQ8 Z;  2YAD A;  2F4M A;  1Q82 2;  4XX2 A;  3Q87 A;  1KD1 2;  3G4S 1;  2Q51 A;  5T67 A;  3CC4 1;  2O53 A;  2JA5 I;  3ESW A;  2RHB A;  4E32 A;  3CXC Y;  3J7A 4;  4HGZ A;  3G4S Z;  5IP7 I;  1S72 1;  1TWH I;  3CXC Z;  3QWU A;  2E2H I;  4BXX I;  3CPW Z;  1RNI A;  1WCM I;  4NBA A;  3S1M I;  4DK1 A;  3CCQ 1;  2NAP A;  2Y0S A;  4NBH A;  2H85 A;  4MD7 A;  4NFR A;  2E2J I;  4NBE A;  1YHQ 1;  3RZO I;  2PM9 A;  2VPX A;  3J80 f;  4A3K I;  2R7Z I;  2JIM A;  2RT9 A;  2W03 A;  2OTJ 1;  4TNU A;  3PO3 I;  4A3M I;  1YHQ Z;  1N8R 1;  1X3W A;  5D1O B;  3PO3 S;  1YUK A;  1VLA A;  3GTP I;  1S7M A;  3I56 1;  1I6H I;  3S2H I;  2VF1 A;  1QXF A;  1VQ7 1;  1K73 1;  1ZH1 A;  2OTJ Z;  3G6E 1;  2RIQ A;  4MRI A;  4BBS I;  4A3L I;  3EED A;  3CC2 Z;  5T6B A;  1JWH C;  2G2K A;  4RV9 A;  4DQY B;  3S16 I;  1VQL Z;  3GCF A;  1VQ7 Z;  2PMZ A;  4RVF A;  2QRC B;  1NUI A;  3G6E Z;  2QLV B;  1L1O C;  2RBL A;  1K9M 2;  2V8I A;  2HF1 A;  2NVT I;  4MD8 A;  1K8A 2;  3CME 1;  2DE5 A;  1Q81 2;  3VB9 A;  2M6N A;  1K83 I;  1AA6 A;  1QYP A;  3CC7 1;  5IP9 I;  5IT9 b;  3CME Z;  5D1O A;  2JIP A;  2GTI A;  5C4J I;  2K5R A;  3CC7 Z;  2E2I I;  1WJ2 A;  2QEX 1;  1Q86 2;  3D2L A;  3NH5 A;  1M1K 1;  3TE5 B;  1YJW Z;  1QVG Y;  3CMA 1;  4A93 I;  2O4H A;  2QEX Z;  2VUG A;  1P9N A;  1YI2 Z;  2GTH A;  1QVG Z;  1RLY A;  3CMA Z;  1Y1W I;  3VMH A;  3I4N I;  3HOV I;  4X6A I;  2PK7 A;  2W04 A;  2JA8 I;  1ZB8 A;  1YUA A;  2J6A A;  1RQF A;  2OTL Z;  1Y1V I;  4NBC A;  2JNY A;  1Y1V S;  2AKL A;  1DL6 A;  2KI7 B;  4NBF A;  3M4O I;  4E31 A;  4A3F I;  3HOW I;  1TWG I;  1KRL A;  3NDI A;  3CPW Y;  2E7Z A;  2R92 I;  3CCU 1;  3MZK B;  2OOY B;  2EGT A;  2OOX B;  2QA4 Z;  3J81 f;  2P3Y A;  4BY1 I;  4MXU A;  3GTK I;  3CCU Z;  1KC8 2;  3IR7 A;  1VQ4 Z;  3OW2 Z;  2JA6 I;  1VQP 1;  4NOZ A;  2JA7 I;  3VMI A;  3CCR 1;  1KQS Z;  3CCE 1;  2R93 I;  1USP B;  2JIQ A;  1VQP Z;  2V3V A;  2VPY A;  2KPI A;  3CC2 1;  1SFO I;  3FQM A;  3CCR Z;  3JAM b;  1M90 1;  3CCE Z;  1VQL 1;  1Y8C A;  3F3F C;  3H3V J;  3LUS A;  3S17 I;  4RVG A;  3HOZ I;  3MON A;  5FLX b;  4EWC A;  3NH4 A;  3S14 I;  4HGY A;  1Q82 1;  3MZL B;  1KD1 1;  2E9H A;  3F3P C;  1NJI 2;  2M48 A;  2Q4Z A;  3NDJ A;  3BG1 B;  2F4O A;  3CCV 1;  3G71 1;  2LEX A;  2B63 I;  2P28 A;  4A3C I;  4E30 A;  4S1T A;  3H0G I;  3FKI I;  1YJN Z;  1YJW 1;  3BG0 B;  1FDI A;  3CCV Z;  1FDO A;  3G71 Z;  4A3E I;  1YI2 1;  4HH4 A;  1PFT A;  3T4N B;  2DE6 A;  3CCL 1;  4E2Y A;  1Z03 A;  5AN9 F;  3CCS 1;  3PO2 I;  2K3R A;  1Q7Y 2;  1QVF Z;  3I55 1;  2OTL 1;  3CCL Z;  2JIR A;  3I07 A;  4NBD A;  3CCS Z;  5A2Q b;  1VQO 1;  1R9T I;  2QRE B;  4A3B I;  3EER A;  3CD6 Z;  2JR6 A;  3FQQ A;  3I55 Z;  3GKQ A;  1W2B Y;  1LQL A;  1JJ2 Z;  4A3G I;  2VPZ A;  1VQO Z;  4NBG A;  2BJO A;  4A3J I;  1N8R 2;  1K9M 1;  3IF8 A;  5C4X I;  3K7A I;  1W2B Z;  4MON A;  1ML8 A;  1K73 2;  4BY7 I;  4BBR I;  2LFU A;  1VQ9 Z;  3GTQ I;  1K8A 1;  1Q81 1;  2QA4 1;  1VQM Z;  3GTM I;  4QTU A;  2VUM I;  3HOY I;  2IZ3 A;  3S1R I;  1VQ4 1;  3OW2 Y;  4QTT A;  5LL6 f;  1VQK 1;  3D9X A;  1VQ5 1;  2QKD A;  3GTG I;  1X3Z A;  3S15 I;  1KQS Y;  4MD9 A;  3D6W A;  4NB9 A;  2JMO A;  3JAM f;  1Z02 A;  1Q86 1;  1VQK Z;  1YIT 1;  4E33 A;  1VQ5 Z;  3HOU I;  3CC4 Z;  3IFU A;  2V8J A;  4Y52 I;  4RVH A;  5D1P A;  3S2D I;  1YIT Z;  5FLX f;  1S72 Z;  3HOX I;  2WAQ A;  2NVY I;  1Q7Y 1;  1TWA I;  4A3I I;  1M1K 2;  1NP6 A;  1WII A;  3J81 b;  4NH1 C;  3CCQ Z;  4A3D I;  2YU9 I;  2I3C A;  3VMG A;  2RPR A;  1I3Q I;  3M3Y I;  4E2W A;  4NB8 A;  5IT9 f;  1I50 I;  2NVX I;  1SIW A;  2V8K A;  3J80 b;  2NVQ I;  3GTO I;  1USP A;  2DE7 A;  2IV2 X;  3U50 C;  4CL1 A;  3I56 Z;  1YJN 1;  2GU2 A;  2V45 A;  3TDH B;  1QF8 A;  2AYD A;  4MH4 A;  4RVD A;  1VQN 1;  3CQZ I;  4NBB A;  1WW9 A;  3IX0 A;  3I4M I;  2JUB A;  5FLM I;  1KC8 1;  1VQN Z;  2JS4 A;  2R6M A;  1WZN A;  4AYB A;  3VTN A;  1Z01 A;  1YIJ 1;  5CM2 M;  4E2Z A;  4DGL A;  1QVF Y;  1N2F A;  5A2Q f;  2QR1 B;  5T64 A;  1RO4 A;  3CCJ 1;  1TFI A;  1VQ6 1;  1Q16 A;  3KIH A;  3CD6 1;  2ZAE B;  3S1Q I;  1YIJ Z;  3GTL I;  2HU9 A;  3CCJ Z;  3P5J B;  1JJ2 Y;  2JIO A;  3S1N I;  5C3E I;  1RO0 A;  4Y7N I;  1VQ6 Z;  2OZK A;  4RS4 A;  1YJ9 1;  2LIY A;  1X0T A;  2WB1 A;  5C44 I;  3NFZ A;  2VPW A;  1VQ9 1;  1TWF I;  3NH8 A;  1M90 2;  3CCM 1;  1VQM 1;  3HKZ A;  1YJ9 Z;  3KIF A;  4E2X A;  3GTJ I; 
#chains in the Genus database with same CATH homology
 2IZ4 A;  1VQ8 1;  2QRD B;  1NJI 1;  1ZB9 A;  3CCM Z;  1TWC I;  3RZD I;  3GTM S;  1RO2 A;  1VQ8 Z;  2YAD A;  2F4M A;  1Q82 2;  4XX2 A;  3Q87 A;  1KD1 2;  3G4S 1;  2Q51 A;  5T67 A;  3CC4 1;  2O53 A;  2JA5 I;  3ESW A;  2RHB A;  4E32 A;  3CXC Y;  3J7A 4;  4HGZ A;  3G4S Z;  5IP7 I;  1S72 1;  1TWH I;  3CXC Z;  3QWU A;  2E2H I;  4BXX I;  3CPW Z;  1RNI A;  1WCM I;  4NBA A;  3S1M I;  4DK1 A;  3CCQ 1;  2Y0S A;  4NBH A;  2H85 A;  4MD7 A;  4NFR A;  2E2J I;  4NBE A;  1YHQ 1;  3RZO I;  2PM9 A;  3J80 f;  4A3K I;  2R7Z I;  2RT9 A;  2W03 A;  2OTJ 1;  4TNU A;  3PO3 I;  4A3M I;  1YHQ Z;  1N8R 1;  1X3W A;  5D1O B;  3PO3 S;  1YUK A;  1VLA A;  3GTP I;  1S7M A;  3I56 1;  1I6H I;  3S2H I;  2VF1 A;  1VQ7 1;  1K73 1;  1ZH1 A;  2OTJ Z;  3G6E 1;  2RIQ A;  4MRI A;  4BBS I;  4A3L I;  3EED A;  3CC2 Z;  5T6B A;  1JWH C;  2G2K A;  4RV9 A;  4DQY B;  3S16 I;  1VQL Z;  3GCF A;  1VQ7 Z;  2PMZ A;  4RVF A;  2QRC B;  1NUI A;  3G6E Z;  2QLV B;  1L1O C;  2RBL A;  1K9M 2;  2V8I A;  2HF1 A;  2NVT I;  4MD8 A;  1K8A 2;  3CME 1;  2DE5 A;  1Q81 2;  3VB9 A;  2M6N A;  1K83 I;  1QYP A;  3CC7 1;  5IP9 I;  5IT9 b;  3CME Z;  5D1O A;  2GTI A;  5C4J I;  2K5R A;  3CC7 Z;  2E2I I;  2QEX 1;  1Q86 2;  3NH5 A;  1M1K 1;  3TE5 B;  1YJW Z;  1QVG Y;  3CMA 1;  4A93 I;  2O4H A;  2QEX Z;  2VUG A;  1P9N A;  1YI2 Z;  2GTH A;  1QVG Z;  1RLY A;  3CMA Z;  1Y1W I;  3VMH A;  3I4N I;  3HOV I;  4X6A I;  2PK7 A;  2W04 A;  2JA8 I;  1ZB8 A;  1YUA A;  2J6A A;  1RQF A;  2OTL Z;  1Y1V I;  4NBC A;  2JNY A;  1Y1V S;  2AKL A;  1DL6 A;  2KI7 B;  4NBF A;  3M4O I;  4E31 A;  4A3F I;  3HOW I;  1TWG I;  1KRL A;  3NDI A;  3CPW Y;  2R92 I;  3CCU 1;  3MZK B;  2OOY B;  2EGT A;  2OOX B;  2QA4 Z;  3J81 f;  2P3Y A;  4BY1 I;  4MXU A;  3GTK I;  3CCU Z;  1KC8 2;  1VQ4 Z;  3OW2 Z;  2JA6 I;  1VQP 1;  4NOZ A;  2JA7 I;  3VMI A;  3CCR 1;  1KQS Z;  3CCE 1;  2R93 I;  1USP B;  1VQP Z;  2KPI A;  3CC2 1;  1SFO I;  3FQM A;  3CCR Z;  3JAM b;  1M90 1;  3CCE Z;  1VQL 1;  3F3F C;  3H3V J;  3LUS A;  3S17 I;  4RVG A;  3HOZ I;  3MON A;  5FLX b;  4EWC A;  3NH4 A;  3S14 I;  4HGY A;  1Q82 1;  3MZL B;  1KD1 1;  2E9H A;  3F3P C;  1NJI 2;  2M48 A;  2Q4Z A;  3NDJ A;  3BG1 B;  2F4O A;  3CCV 1;  3G71 1;  2B63 I;  2P28 A;  4A3C I;  4E30 A;  4S1T A;  3H0G I;  3FKI I;  1YJN Z;  1YJW 1;  3BG0 B;  3CCV Z;  3G71 Z;  4A3E I;  1YI2 1;  4HH4 A;  1PFT A;  3T4N B;  2DE6 A;  3CCL 1;  4E2Y A;  1Z03 A;  5AN9 F;  3CCS 1;  3PO2 I;  2K3R A;  1Q7Y 2;  1QVF Z;  3I55 1;  2OTL 1;  3CCL Z;  3I07 A;  4NBD A;  3CCS Z;  5A2Q b;  1VQO 1;  1R9T I;  2QRE B;  4A3B I;  3EER A;  3CD6 Z;  2JR6 A;  3FQQ A;  3I55 Z;  3GKQ A;  1W2B Y;  1LQL A;  1JJ2 Z;  4A3G I;  1VQO Z;  4NBG A;  2BJO A;  4A3J I;  1N8R 2;  1K9M 1;  3IF8 A;  5C4X I;  3K7A I;  1W2B Z;  4MON A;  1ML8 A;  1K73 2;  4BY7 I;  4BBR I;  2LFU A;  1VQ9 Z;  3GTQ I;  1K8A 1;  1Q81 1;  2QA4 1;  1VQM Z;  3GTM I;  4QTU A;  2VUM I;  3HOY I;  2IZ3 A;  3S1R I;  1VQ4 1;  3OW2 Y;  4QTT A;  5LL6 f;  1VQK 1;  3D9X A;  1VQ5 1;  2QKD A;  3GTG I;  1X3Z A;  3S15 I;  1KQS Y;  4MD9 A;  3D6W A;  4NB9 A;  2JMO A;  3JAM f;  1Z02 A;  1Q86 1;  1VQK Z;  1YIT 1;  4E33 A;  1VQ5 Z;  3HOU I;  3CC4 Z;  3IFU A;  2V8J A;  4Y52 I;  4RVH A;  5D1P A;  3S2D I;  1YIT Z;  5FLX f;  1S72 Z;  3HOX I;  2WAQ A;  2NVY I;  1Q7Y 1;  1TWA I;  4A3I I;  1M1K 2;  1NP6 A;  1WII A;  3J81 b;  4NH1 C;  3CCQ Z;  4A3D I;  2YU9 I;  2I3C A;  3VMG A;  2RPR A;  1I3Q I;  3M3Y I;  4E2W A;  4NB8 A;  5IT9 f;  1I50 I;  2NVX I;  2V8K A;  3J80 b;  2NVQ I;  3GTO I;  1USP A;  2DE7 A;  3U50 C;  4CL1 A;  3I56 Z;  1YJN 1;  2GU2 A;  3TDH B;  1QF8 A;  4MH4 A;  4RVD A;  1VQN 1;  3CQZ I;  4NBB A;  1WW9 A;  3IX0 A;  3I4M I;  2JUB A;  5FLM I;  1KC8 1;  1VQN Z;  2JS4 A;  2R6M A;  4AYB A;  3VTN A;  1Z01 A;  1YIJ 1;  5CM2 M;  4E2Z A;  4DGL A;  1QVF Y;  1N2F A;  5A2Q f;  2QR1 B;  5T64 A;  1RO4 A;  3CCJ 1;  1TFI A;  1VQ6 1;  3KIH A;  3CD6 1;  2ZAE B;  3S1Q I;  1YIJ Z;  3GTL I;  2HU9 A;  3CCJ Z;  3P5J B;  1JJ2 Y;  3S1N I;  5C3E I;  1RO0 A;  4Y7N I;  1VQ6 Z;  2OZK A;  4RS4 A;  1YJ9 1;  2LIY A;  1X0T A;  2WB1 A;  5C44 I;  3NFZ A;  1VQ9 1;  1TWF I;  3NH8 A;  1M90 2;  3CCM 1;  1VQM 1;  3HKZ A;  1YJ9 Z;  3KIF A;  4E2X A;  3GTJ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...