3HOWI

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI02
4A3BI 4MH4A 1YUAA 3HOYI 4A3DI 4A3CI 4QTUA 3FKII 3GCFA 1SFOI 2JA7I 2JA8I 5FLMI 1X3WA 1I3QI 1TWHI 1VLAA 1LQLA 3VMIA 2E2HI 4A3LI 2DE6A 4NBHA 3M4OI 1PFTA 4X6AI 3GTPI 1NUIA 3S16I 3S17I 3GTOI 2HF1A 3H3VJ 1WCMI 3I4NI 4A3KI 1DL6A 1TWCI 3GTQI 1WW9A 3GKQA 2NVYI 3HOVI 4A3II 4A3JI 3H0GI 2P3YA 3D6WA 4NBEA 3S1QI 2K5RA 2F4MA 3GTLI 2R93I 3LUSA 4XX2A 4NBDA 1I50I 1Y1VI 3HOZI 3M3YI 2NVTI 1Y1VS 4BY7I 2R7ZI 3S1RI 1RLYA 1RO4A 2AKLA 1QYPA 4NBCA 2NVXI 3RZDI 5IP9I 2JS4A 2E2II 3CQZI 3K7AI 3U50C 2JA6I 4NB9A 3GTMI 3GTJI 4BBRI 4BBSI 4NBAA 2PK7A 3GTMS 5C4JI 1USPA 1ML8A 3HOXI 3S2HI 1L1OC 2BJOA 3S2DI 2E2JI 3S1NI 2J6AA 1Y1WI 5C44I 3RZOI 4NBGA 2B63I 1TWAI 3HOWI 4A3FI 5C3EI 3S1MI 1X3ZA 4NBBA 2JNYA 4Y7NI 4A3EI 1ZB9A 1R9TI 4A3GI 2YU9I 5IP7I 4BXXI 3I07A 1USPB 3GTKI 2R92I 4A3MI 5CM2M 3VMHA 4NBFA 3I4MI 4BY1I 3VMGA 3GTGI 3HOUI 1ZB8A 3Q87A 4Y52I 3S14I 1N2FA 1TWFI 4A93I 2F4OA 2DE7A 1K83I 2NVQI 5C4XI 3ESWA 2JA5I 3VB9A 2RBLA 3S15I 2DE5A 2KPIA 3PO3I 4NB8A 1I6HI 4NOZA 4QTTA 2JR6A 1TFIA 1TWGI 3PO3S 3EERA 3PO2I 2VUMI
chains in the Genus database with same CATH superfamily
1P9NA 1K8A1 3HOYI 4A3DI 1S721 1QVFY 2OTJZ 3FKII 3GCFA 1SFOI 1X3WA 2LEXA 3NH4A 2VPWA 1LQLA 4NBHA 1PFTA 2OTL1 3KIFA 3S17I 3I4NI 2I3CA 2V3VA 1RO2A 3CD6Z 3HOVI 4DK1A 3D6WA 4MXUA 4TNUA 2VPYA 2F4MA 2R93I 3LUSA 5IT9b 1I50I 2Q4ZA 1Z01A 4NH1C 4RV9A 5T6BA 3CCQZ 1Q7Y1 3M3YI 2R7ZI 1RLYA 3JAMf 2AKLA 3CCLZ 4NBCA 2NVXI 3RZDI 2RPRA 2LFUA 2M6NA 2JIQA 5FLXf 1YJW1 3GTMI 4HGZA 3GTJI 3CCM1 4BBSI 3NFZA 1RQFA 1S72Z 2PK7A 2OZKA 4MD9A 1KC82 1USPA 4DGLA 3CC71 1W2BY 3HOXI 1RNIA 1YJN1 1K9M1 2E2JI 1Y1WI 5C44I 2GTHA 2OTLZ 3RZOI 1QVFZ 2JIMA 3HOWI 1Q862 2O53A 3IFUA 4Y7NI 3CXCY 5T64A 2R92I 1NP6A 3VMHA 1Q821 4NBFA 3CC41 2PM9A 1ZB8A 1KRLA 5D1OA 3S14I 2JIPA 2NVQI 1VQ71 5AN9F 2E9HA 2JMOA 3CCE1 1VQK1 3IR7A 3MZKB 2KPIA 3D9XA 1YJWZ 3CC21 3J81f 4HH4A 3CCMZ 2VUMI 4QTUA 3CC7Z 1X0TA 2JA7I 2G2KA 1YJNZ 1QXFA 1NJI1 1VQL1 1K8A2 2IZ4A 2OOXB 1JJ2Y 2JUBA 2QEX1 4S1TA 2E2HI 1Z03A 2QRDB 4E2WA 3GTPI 1WZNA 3G6E1 2HF1A 1YHQ1 3H3VJ 1TWCI 3GTQI 2NVYI 4A3II 4A3JI 3CC4Z 2P3YA 4RVHA 4MONA 3HKZA 3IF8A 2K5RA 3GTLI 3CCS1 4NBDA 1VQ7Z 2O4HA 2YADA 3CCEZ 1Y1VS 3CXCZ 1AA6A 1VQKZ 1QYPA 1KD11 2VPXA 2GTIA 5IP9I 4MD7A 2JS4A 4DQYB 1Q7Y2 3K7AI 4NFRA 1YIT1 3U50C 3CC2Z 2JA6I 1RO0A 2GU2A 4NBAA 3QWUA 1ZH1A 3CMA1 3JAMb 1ML8A 5D1PA 1VQLZ 3CME1 2QEXZ 4CL1A 3S2DI 2V8JA 5FLXb 3I551 4E33A 2QREB 1K9M2 3OW2Y 3G6EZ 5C3EI 1YHQZ 2WAQA 1YIJ1 3FQQA 1JJ2Z 3I561 2YU9I 5IP7I 2EGTA 3I4MI 4BY1I 3Q87A 3CCSZ 1TWFI 2VF1A 1K731 1Q822 2DE7A 1K83I 5C4XI 3F3FC 3NDIA 1YUKA 3BG1B 3P5JB 1N8R1 3S15I 1VQO1 1I6HI 1YITZ 1TWGI 3PO3S 3PO2I 1YUAA 3F3PC 3D2LA 2H85A 2LIYA 3CMAZ 3CMEZ 1QVGZ 2VUGA 1I3QI 3KIHA 1VLAA 3I55Z 1VQ81 3J81b 4A3LI 1NJI2 3M4OI 1FDOA 2Y0SA 1YIJZ 1Y8CA 4A3KI 3I56Z 1WW9A 3H0GI 3NH8A 1QF8A 2P28A 1VQ41 3S1QI 3OW2Z 4XX2A 2QLVB 4MD8A 2R6MA 2E7ZA 2NVTI 3S1RI 2VPZA 4RS4A 1VQOZ 2WB1A 1VQN1 2E2II 3CQZI 1M901 2ZAEB 1VQ51 2QRCB 3T4NB 1KD12 3NH5A 3IX0A 3BG0B 3GTMS 3CCJ1 1L1OC 2BJOA 3S1NI 3J7A4 2J6AA 2KI7B 1VQ8Z 1WIIA 1Q811 4NBGA 2B63I 4E32A 4RVDA 3S1MI 1QVGY 1X3ZA 4NBBA 1YI21 2JNYA 4A3GI 4AYBA 1M1K1 1USPB 2PMZA 3GTKI 4E31A 4A3MI 5CM2M 1VQ4Z 3GTGI 3VMGA 1S7MA 2W04A 1N2FA 4A93I 1VQ91 5A2Qb 1Q16A 3ESWA 4RVGA 1KQSY 2JA5I 2V45A 3VB9A 2RBLA 1K732 1VQNZ 5LL6f 1JWHC 4NB8A 3TE5B 3CCU1 4NOZA 1WJ2A 4QTTA 2JR6A 5A2Qf 1N8R2 1VQ5Z 3EERA 4A3BI 5D1OB 4MH4A 2RT9A 3CCJZ 4A3CI 3MONA 2JA8I 5FLMI 3CCR1 1TWHI 2K3RA 1YJ91 3VMIA 3CPWY 2DE6A 2OOYB 5IT9f 4X6AI 1NUIA 4E2ZA 3S16I 1YI2Z 3GTOI 1WCMI 1DL6A 3FQMA 5T67A 3GKQA 3CCV1 3G4S1 3VTNA 4NBEA 2IZ3A 2JIRA 1VQP1 1VQ9Z 1Y1VI 3G711 2V8KA 3HOZI 2RHBA 1VQ61 4BY7I 1RO4A 1FDIA 1Z02A 3EEDA 4RVFA 3CCUZ 4E2YA 3TDHB 2W03A 1VQM1 4E30A 1KC81 2HU9A 4NB9A 4BBRI 2QA41 1KQSZ 5C4JI 2M48A 1M902 2OTJ1 2V8IA 3CCRZ 3S2HI 2Q51A 4EWCA 2QR1B 1Q861 1YJ9Z 1SIWA 3MZLB 4E2XA 1TWAI 4A3FI 4MRIA 1Q812 4A3EI 1ZB9A 1R9TI 4BXXI 2RIQA 3I07A 3CCVZ 3G4SZ 3CD61 3J80b 3NDJA 3CPWZ 2NAPA 3HOUI 1VQPZ 4HGYA 4Y52I 1M1K2 2F4OA 3G71Z 3CCQ1 2QKDA 3J80f 1VQ6Z 2IV2X 3CCL1 2AYDA 2DE5A 1W2BZ 3PO3I 1VQMZ 1TFIA 2QA4Z 2JIOA
chains in the Genus database with same CATH topology
1P9NA 1K8A1 3HOYI 4A3DI 1S721 1QVFY 2OTJZ 3FKII 3GCFA 1SFOI 1X3WA 3NH4A 1LQLA 4NBHA 1PFTA 2OTL1 3KIFA 3S17I 3I4NI 2I3CA 1RO2A 3CD6Z 3HOVI 4DK1A 3D6WA 4MXUA 4TNUA 2F4MA 2R93I 3LUSA 5IT9b 1I50I 2Q4ZA 1Z01A 4NH1C 4RV9A 5T6BA 3CCQZ 1Q7Y1 3M3YI 2R7ZI 1RLYA 3JAMf 2AKLA 3CCLZ 4NBCA 2NVXI 3RZDI 2RPRA 2LFUA 2M6NA 5FLXf 1YJW1 3GTMI 4HGZA 3GTJI 3CCM1 4BBSI 3NFZA 1RQFA 1S72Z 2PK7A 2OZKA 4MD9A 1KC82 1USPA 4DGLA 3CC71 1W2BY 3HOXI 1RNIA 1YJN1 1K9M1 2E2JI 1Y1WI 5C44I 2GTHA 2OTLZ 3RZOI 1QVFZ 3HOWI 1Q862 2O53A 3IFUA 4Y7NI 3CXCY 5T64A 2R92I 1NP6A 3VMHA 1Q821 4NBFA 3CC41 2PM9A 1ZB8A 1KRLA 5D1OA 3S14I 2NVQI 1VQ71 5AN9F 2E9HA 2JMOA 3CCE1 1VQK1 3MZKB 2KPIA 3D9XA 1YJWZ 3CC21 3J81f 4HH4A 3CCMZ 2VUMI 4QTUA 3CC7Z 1X0TA 2JA7I 2G2KA 1YJNZ 1NJI1 1VQL1 1K8A2 2IZ4A 2OOXB 1JJ2Y 2JUBA 2QEX1 4S1TA 2E2HI 1Z03A 2QRDB 4E2WA 3GTPI 3G6E1 2HF1A 1YHQ1 3H3VJ 1TWCI 3GTQI 2NVYI 4A3II 4A3JI 3CC4Z 2P3YA 4RVHA 4MONA 3HKZA 3IF8A 2K5RA 3GTLI 3CCS1 4NBDA 1VQ7Z 2O4HA 2YADA 3CCEZ 1Y1VS 3CXCZ 1VQKZ 1QYPA 1KD11 2GTIA 5IP9I 4MD7A 2JS4A 4DQYB 1Q7Y2 3K7AI 4NFRA 1YIT1 3U50C 3CC2Z 2JA6I 1RO0A 2GU2A 4NBAA 3QWUA 1ZH1A 3CMA1 3JAMb 1ML8A 5D1PA 1VQLZ 3CME1 2QEXZ 4CL1A 3S2DI 2V8JA 5FLXb 3I551 4E33A 2QREB 1K9M2 3OW2Y 3G6EZ 5C3EI 1YHQZ 2WAQA 1YIJ1 3FQQA 1JJ2Z 3I561 2YU9I 5IP7I 2EGTA 3I4MI 4BY1I 3Q87A 3CCSZ 1TWFI 2VF1A 1K731 1Q822 2DE7A 1K83I 5C4XI 3F3FC 3NDIA 1YUKA 3BG1B 3P5JB 1N8R1 3S15I 1VQO1 1I6HI 1YITZ 1TWGI 3PO3S 3PO2I 1YUAA 3F3PC 2H85A 2LIYA 3CMAZ 3CMEZ 1QVGZ 2VUGA 1I3QI 3KIHA 1VLAA 3I55Z 1VQ81 3J81b 4A3LI 1NJI2 3M4OI 2Y0SA 1YIJZ 4A3KI 3I56Z 1WW9A 3H0GI 3NH8A 1QF8A 2P28A 1VQ41 3S1QI 3OW2Z 4XX2A 2QLVB 4MD8A 2R6MA 2NVTI 3S1RI 4RS4A 1VQOZ 2WB1A 1VQN1 2E2II 3CQZI 1M901 2ZAEB 1VQ51 2QRCB 3T4NB 1KD12 3NH5A 3IX0A 3BG0B 3GTMS 3CCJ1 1L1OC 2BJOA 3S1NI 3J7A4 2J6AA 2KI7B 1VQ8Z 1WIIA 1Q811 4NBGA 2B63I 4E32A 4RVDA 3S1MI 1QVGY 1X3ZA 4NBBA 1YI21 2JNYA 4A3GI 4AYBA 1M1K1 1USPB 2PMZA 3GTKI 4E31A 4A3MI 5CM2M 1VQ4Z 3GTGI 3VMGA 1S7MA 2W04A 1N2FA 4A93I 1VQ91 5A2Qb 3ESWA 4RVGA 1KQSY 2JA5I 3VB9A 2RBLA 1K732 1VQNZ 5LL6f 1JWHC 4NB8A 3TE5B 3CCU1 4NOZA 4QTTA 2JR6A 5A2Qf 1N8R2 1VQ5Z 3EERA 4A3BI 5D1OB 4MH4A 2RT9A 3CCJZ 4A3CI 3MONA 2JA8I 5FLMI 3CCR1 1TWHI 2K3RA 1YJ91 3VMIA 3CPWY 2DE6A 2OOYB 5IT9f 4X6AI 1NUIA 4E2ZA 3S16I 1YI2Z 3GTOI 1WCMI 1DL6A 3FQMA 5T67A 3GKQA 3CCV1 3G4S1 3VTNA 4NBEA 2IZ3A 1VQP1 1VQ9Z 1Y1VI 3G711 2V8KA 3HOZI 2RHBA 1VQ61 4BY7I 1RO4A 1Z02A 3EEDA 4RVFA 3CCUZ 4E2YA 3TDHB 2W03A 1VQM1 4E30A 1KC81 2HU9A 4NB9A 4BBRI 2QA41 1KQSZ 5C4JI 2M48A 1M902 2OTJ1 2V8IA 3CCRZ 3S2HI 2Q51A 4EWCA 2QR1B 1Q861 1YJ9Z 3MZLB 4E2XA 1TWAI 4A3FI 4MRIA 1Q812 4A3EI 1ZB9A 1R9TI 4BXXI 2RIQA 3I07A 3CCVZ 3G4SZ 3CD61 3J80b 3NDJA 3CPWZ 3HOUI 1VQPZ 4HGYA 4Y52I 1M1K2 2F4OA 3G71Z 3CCQ1 2QKDA 3J80f 1VQ6Z 3CCL1 2DE5A 1W2BZ 3PO3I 1VQMZ 1TFIA 2QA4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B I;  4MH4 A;  1YUA A;  3HOY I;  4A3D I;  4A3C I;  4QTU A;  3FKI I;  3GCF A;  1SFO I;  2JA7 I;  2JA8 I;  5FLM I;  1X3W A;  1I3Q I;  1TWH I;  1VLA A;  1LQL A;  3VMI A;  2E2H I;  4A3L I;  2DE6 A;  4NBH A;  3M4O I;  1PFT A;  4X6A I;  3GTP I;  1NUI A;  3S16 I;  3S17 I;  3GTO I;  2HF1 A;  3H3V J;  1WCM I;  3I4N I;  4A3K I;  1DL6 A;  1TWC I;  3GTQ I;  1WW9 A;  3GKQ A;  2NVY I;  3HOV I;  4A3I I;  4A3J I;  3H0G I;  2P3Y A;  3D6W A;  4NBE A;  3S1Q I;  2K5R A;  2F4M A;  3GTL I;  2R93 I;  3LUS A;  4XX2 A;  4NBD A;  1I50 I;  1Y1V I;  3HOZ I;  3M3Y I;  2NVT I;  1Y1V S;  4BY7 I;  2R7Z I;  3S1R I;  1RLY A;  1RO4 A;  2AKL A;  1QYP A;  4NBC A;  2NVX I;  3RZD I;  5IP9 I;  2JS4 A;  2E2I I;  3CQZ I;  3K7A I;  3U50 C;  2JA6 I;  4NB9 A;  3GTM I;  3GTJ I;  4BBR I;  4BBS I;  4NBA A;  2PK7 A;  3GTM S;  5C4J I;  1USP A;  1ML8 A;  3HOX I;  3S2H I;  1L1O C;  2BJO A;  3S2D I;  2E2J I;  3S1N I;  2J6A A;  1Y1W I;  5C44 I;  3RZO I;  4NBG A;  2B63 I;  1TWA I;  3HOW I;  4A3F I;  5C3E I;  3S1M I;  1X3Z A;  4NBB A;  2JNY A;  4Y7N I;  4A3E I;  1ZB9 A;  1R9T I;  4A3G I;  2YU9 I;  5IP7 I;  4BXX I;  3I07 A;  1USP B;  3GTK I;  2R92 I;  4A3M I;  5CM2 M;  3VMH A;  4NBF A;  3I4M I;  4BY1 I;  3VMG A;  3GTG I;  3HOU I;  1ZB8 A;  3Q87 A;  4Y52 I;  3S14 I;  1N2F A;  1TWF I;  4A93 I;  2F4O A;  2DE7 A;  1K83 I;  2NVQ I;  5C4X I;  3ESW A;  2JA5 I;  3VB9 A;  2RBL A;  3S15 I;  2DE5 A;  2KPI A;  3PO3 I;  4NB8 A;  1I6H I;  4NOZ A;  4QTT A;  2JR6 A;  1TFI A;  1TWG I;  3PO3 S;  3EER A;  3PO2 I;  2VUM I; 
#chains in the Genus database with same CATH topology
 1P9N A;  1K8A 1;  3HOY I;  4A3D I;  1S72 1;  1QVF Y;  2OTJ Z;  3FKI I;  3GCF A;  1SFO I;  1X3W A;  2LEX A;  3NH4 A;  2VPW A;  1LQL A;  4NBH A;  1PFT A;  2OTL 1;  3KIF A;  3S17 I;  3I4N I;  2I3C A;  2V3V A;  1RO2 A;  3CD6 Z;  3HOV I;  4DK1 A;  3D6W A;  4MXU A;  4TNU A;  2VPY A;  2F4M A;  2R93 I;  3LUS A;  5IT9 b;  1I50 I;  2Q4Z A;  1Z01 A;  4NH1 C;  4RV9 A;  5T6B A;  3CCQ Z;  1Q7Y 1;  3M3Y I;  2R7Z I;  1RLY A;  3JAM f;  2AKL A;  3CCL Z;  4NBC A;  2NVX I;  3RZD I;  2RPR A;  2LFU A;  2M6N A;  2JIQ A;  5FLX f;  1YJW 1;  3GTM I;  4HGZ A;  3GTJ I;  3CCM 1;  4BBS I;  3NFZ A;  1RQF A;  1S72 Z;  2PK7 A;  2OZK A;  4MD9 A;  1KC8 2;  1USP A;  4DGL A;  3CC7 1;  1W2B Y;  3HOX I;  1RNI A;  1YJN 1;  1K9M 1;  2E2J I;  1Y1W I;  5C44 I;  2GTH A;  2OTL Z;  3RZO I;  1QVF Z;  2JIM A;  3HOW I;  1Q86 2;  2O53 A;  3IFU A;  4Y7N I;  3CXC Y;  5T64 A;  2R92 I;  1NP6 A;  3VMH A;  1Q82 1;  4NBF A;  3CC4 1;  2PM9 A;  1ZB8 A;  1KRL A;  5D1O A;  3S14 I;  2JIP A;  2NVQ I;  1VQ7 1;  5AN9 F;  2E9H A;  2JMO A;  3CCE 1;  1VQK 1;  3IR7 A;  3MZK B;  2KPI A;  3D9X A;  1YJW Z;  3CC2 1;  3J81 f;  4HH4 A;  3CCM Z;  2VUM I;  4QTU A;  3CC7 Z;  1X0T A;  2JA7 I;  2G2K A;  1YJN Z;  1QXF A;  1NJI 1;  1VQL 1;  1K8A 2;  2IZ4 A;  2OOX B;  1JJ2 Y;  2JUB A;  2QEX 1;  4S1T A;  2E2H I;  1Z03 A;  2QRD B;  4E2W A;  3GTP I;  1WZN A;  3G6E 1;  2HF1 A;  1YHQ 1;  3H3V J;  1TWC I;  3GTQ I;  2NVY I;  4A3I I;  4A3J I;  3CC4 Z;  2P3Y A;  4RVH A;  4MON A;  3HKZ A;  3IF8 A;  2K5R A;  3GTL I;  3CCS 1;  4NBD A;  1VQ7 Z;  2O4H A;  2YAD A;  3CCE Z;  1Y1V S;  3CXC Z;  1AA6 A;  1VQK Z;  1QYP A;  1KD1 1;  2VPX A;  2GTI A;  5IP9 I;  4MD7 A;  2JS4 A;  4DQY B;  1Q7Y 2;  3K7A I;  4NFR A;  1YIT 1;  3U50 C;  3CC2 Z;  2JA6 I;  1RO0 A;  2GU2 A;  4NBA A;  3QWU A;  1ZH1 A;  3CMA 1;  3JAM b;  1ML8 A;  5D1P A;  1VQL Z;  3CME 1;  2QEX Z;  4CL1 A;  3S2D I;  2V8J A;  5FLX b;  3I55 1;  4E33 A;  2QRE B;  1K9M 2;  3OW2 Y;  3G6E Z;  5C3E I;  1YHQ Z;  2WAQ A;  1YIJ 1;  3FQQ A;  1JJ2 Z;  3I56 1;  2YU9 I;  5IP7 I;  2EGT A;  3I4M I;  4BY1 I;  3Q87 A;  3CCS Z;  1TWF I;  2VF1 A;  1K73 1;  1Q82 2;  2DE7 A;  1K83 I;  5C4X I;  3F3F C;  3NDI A;  1YUK A;  3BG1 B;  3P5J B;  1N8R 1;  3S15 I;  1VQO 1;  1I6H I;  1YIT Z;  1TWG I;  3PO3 S;  3PO2 I;  1YUA A;  3F3P C;  3D2L A;  2H85 A;  2LIY A;  3CMA Z;  3CME Z;  1QVG Z;  2VUG A;  1I3Q I;  3KIH A;  1VLA A;  3I55 Z;  1VQ8 1;  3J81 b;  4A3L I;  1NJI 2;  3M4O I;  1FDO A;  2Y0S A;  1YIJ Z;  1Y8C A;  4A3K I;  3I56 Z;  1WW9 A;  3H0G I;  3NH8 A;  1QF8 A;  2P28 A;  1VQ4 1;  3S1Q I;  3OW2 Z;  4XX2 A;  2QLV B;  4MD8 A;  2R6M A;  2E7Z A;  2NVT I;  3S1R I;  2VPZ A;  4RS4 A;  1VQO Z;  2WB1 A;  1VQN 1;  2E2I I;  3CQZ I;  1M90 1;  2ZAE B;  1VQ5 1;  2QRC B;  3T4N B;  1KD1 2;  3NH5 A;  3IX0 A;  3BG0 B;  3GTM S;  3CCJ 1;  1L1O C;  2BJO A;  3S1N I;  3J7A 4;  2J6A A;  2KI7 B;  1VQ8 Z;  1WII A;  1Q81 1;  4NBG A;  2B63 I;  4E32 A;  4RVD A;  3S1M I;  1QVG Y;  1X3Z A;  4NBB A;  1YI2 1;  2JNY A;  4A3G I;  4AYB A;  1M1K 1;  1USP B;  2PMZ A;  3GTK I;  4E31 A;  4A3M I;  5CM2 M;  1VQ4 Z;  3GTG I;  3VMG A;  1S7M A;  2W04 A;  1N2F A;  4A93 I;  1VQ9 1;  5A2Q b;  1Q16 A;  3ESW A;  4RVG A;  1KQS Y;  2JA5 I;  2V45 A;  3VB9 A;  2RBL A;  1K73 2;  1VQN Z;  5LL6 f;  1JWH C;  4NB8 A;  3TE5 B;  3CCU 1;  4NOZ A;  1WJ2 A;  4QTT A;  2JR6 A;  5A2Q f;  1N8R 2;  1VQ5 Z;  3EER A;  4A3B I;  5D1O B;  4MH4 A;  2RT9 A;  3CCJ Z;  4A3C I;  3MON A;  2JA8 I;  5FLM I;  3CCR 1;  1TWH I;  2K3R A;  1YJ9 1;  3VMI A;  3CPW Y;  2DE6 A;  2OOY B;  5IT9 f;  4X6A I;  1NUI A;  4E2Z A;  3S16 I;  1YI2 Z;  3GTO I;  1WCM I;  1DL6 A;  3FQM A;  5T67 A;  3GKQ A;  3CCV 1;  3G4S 1;  3VTN A;  4NBE A;  2IZ3 A;  2JIR A;  1VQP 1;  1VQ9 Z;  1Y1V I;  3G71 1;  2V8K A;  3HOZ I;  2RHB A;  1VQ6 1;  4BY7 I;  1RO4 A;  1FDI A;  1Z02 A;  3EED A;  4RVF A;  3CCU Z;  4E2Y A;  3TDH B;  2W03 A;  1VQM 1;  4E30 A;  1KC8 1;  2HU9 A;  4NB9 A;  4BBR I;  2QA4 1;  1KQS Z;  5C4J I;  2M48 A;  1M90 2;  2OTJ 1;  2V8I A;  3CCR Z;  3S2H I;  2Q51 A;  4EWC A;  2QR1 B;  1Q86 1;  1YJ9 Z;  1SIW A;  3MZL B;  4E2X A;  1TWA I;  4A3F I;  4MRI A;  1Q81 2;  4A3E I;  1ZB9 A;  1R9T I;  4BXX I;  2RIQ A;  3I07 A;  3CCV Z;  3G4S Z;  3CD6 1;  3J80 b;  3NDJ A;  3CPW Z;  2NAP A;  3HOU I;  1VQP Z;  4HGY A;  4Y52 I;  1M1K 2;  2F4O A;  3G71 Z;  3CCQ 1;  2QKD A;  3J80 f;  1VQ6 Z;  2IV2 X;  3CCL 1;  2AYD A;  2DE5 A;  1W2B Z;  3PO3 I;  1VQM Z;  1TFI A;  2QA4 Z;  2JIO A; 
#chains in the Genus database with same CATH homology
 1P9N A;  1K8A 1;  3HOY I;  4A3D I;  1S72 1;  1QVF Y;  2OTJ Z;  3FKI I;  3GCF A;  1SFO I;  1X3W A;  3NH4 A;  1LQL A;  4NBH A;  1PFT A;  2OTL 1;  3KIF A;  3S17 I;  3I4N I;  2I3C A;  1RO2 A;  3CD6 Z;  3HOV I;  4DK1 A;  3D6W A;  4MXU A;  4TNU A;  2F4M A;  2R93 I;  3LUS A;  5IT9 b;  1I50 I;  2Q4Z A;  1Z01 A;  4NH1 C;  4RV9 A;  5T6B A;  3CCQ Z;  1Q7Y 1;  3M3Y I;  2R7Z I;  1RLY A;  3JAM f;  2AKL A;  3CCL Z;  4NBC A;  2NVX I;  3RZD I;  2RPR A;  2LFU A;  2M6N A;  5FLX f;  1YJW 1;  3GTM I;  4HGZ A;  3GTJ I;  3CCM 1;  4BBS I;  3NFZ A;  1RQF A;  1S72 Z;  2PK7 A;  2OZK A;  4MD9 A;  1KC8 2;  1USP A;  4DGL A;  3CC7 1;  1W2B Y;  3HOX I;  1RNI A;  1YJN 1;  1K9M 1;  2E2J I;  1Y1W I;  5C44 I;  2GTH A;  2OTL Z;  3RZO I;  1QVF Z;  3HOW I;  1Q86 2;  2O53 A;  3IFU A;  4Y7N I;  3CXC Y;  5T64 A;  2R92 I;  1NP6 A;  3VMH A;  1Q82 1;  4NBF A;  3CC4 1;  2PM9 A;  1ZB8 A;  1KRL A;  5D1O A;  3S14 I;  2NVQ I;  1VQ7 1;  5AN9 F;  2E9H A;  2JMO A;  3CCE 1;  1VQK 1;  3MZK B;  2KPI A;  3D9X A;  1YJW Z;  3CC2 1;  3J81 f;  4HH4 A;  3CCM Z;  2VUM I;  4QTU A;  3CC7 Z;  1X0T A;  2JA7 I;  2G2K A;  1YJN Z;  1NJI 1;  1VQL 1;  1K8A 2;  2IZ4 A;  2OOX B;  1JJ2 Y;  2JUB A;  2QEX 1;  4S1T A;  2E2H I;  1Z03 A;  2QRD B;  4E2W A;  3GTP I;  3G6E 1;  2HF1 A;  1YHQ 1;  3H3V J;  1TWC I;  3GTQ I;  2NVY I;  4A3I I;  4A3J I;  3CC4 Z;  2P3Y A;  4RVH A;  4MON A;  3HKZ A;  3IF8 A;  2K5R A;  3GTL I;  3CCS 1;  4NBD A;  1VQ7 Z;  2O4H A;  2YAD A;  3CCE Z;  1Y1V S;  3CXC Z;  1VQK Z;  1QYP A;  1KD1 1;  2GTI A;  5IP9 I;  4MD7 A;  2JS4 A;  4DQY B;  1Q7Y 2;  3K7A I;  4NFR A;  1YIT 1;  3U50 C;  3CC2 Z;  2JA6 I;  1RO0 A;  2GU2 A;  4NBA A;  3QWU A;  1ZH1 A;  3CMA 1;  3JAM b;  1ML8 A;  5D1P A;  1VQL Z;  3CME 1;  2QEX Z;  4CL1 A;  3S2D I;  2V8J A;  5FLX b;  3I55 1;  4E33 A;  2QRE B;  1K9M 2;  3OW2 Y;  3G6E Z;  5C3E I;  1YHQ Z;  2WAQ A;  1YIJ 1;  3FQQ A;  1JJ2 Z;  3I56 1;  2YU9 I;  5IP7 I;  2EGT A;  3I4M I;  4BY1 I;  3Q87 A;  3CCS Z;  1TWF I;  2VF1 A;  1K73 1;  1Q82 2;  2DE7 A;  1K83 I;  5C4X I;  3F3F C;  3NDI A;  1YUK A;  3BG1 B;  3P5J B;  1N8R 1;  3S15 I;  1VQO 1;  1I6H I;  1YIT Z;  1TWG I;  3PO3 S;  3PO2 I;  1YUA A;  3F3P C;  2H85 A;  2LIY A;  3CMA Z;  3CME Z;  1QVG Z;  2VUG A;  1I3Q I;  3KIH A;  1VLA A;  3I55 Z;  1VQ8 1;  3J81 b;  4A3L I;  1NJI 2;  3M4O I;  2Y0S A;  1YIJ Z;  4A3K I;  3I56 Z;  1WW9 A;  3H0G I;  3NH8 A;  1QF8 A;  2P28 A;  1VQ4 1;  3S1Q I;  3OW2 Z;  4XX2 A;  2QLV B;  4MD8 A;  2R6M A;  2NVT I;  3S1R I;  4RS4 A;  1VQO Z;  2WB1 A;  1VQN 1;  2E2I I;  3CQZ I;  1M90 1;  2ZAE B;  1VQ5 1;  2QRC B;  3T4N B;  1KD1 2;  3NH5 A;  3IX0 A;  3BG0 B;  3GTM S;  3CCJ 1;  1L1O C;  2BJO A;  3S1N I;  3J7A 4;  2J6A A;  2KI7 B;  1VQ8 Z;  1WII A;  1Q81 1;  4NBG A;  2B63 I;  4E32 A;  4RVD A;  3S1M I;  1QVG Y;  1X3Z A;  4NBB A;  1YI2 1;  2JNY A;  4A3G I;  4AYB A;  1M1K 1;  1USP B;  2PMZ A;  3GTK I;  4E31 A;  4A3M I;  5CM2 M;  1VQ4 Z;  3GTG I;  3VMG A;  1S7M A;  2W04 A;  1N2F A;  4A93 I;  1VQ9 1;  5A2Q b;  3ESW A;  4RVG A;  1KQS Y;  2JA5 I;  3VB9 A;  2RBL A;  1K73 2;  1VQN Z;  5LL6 f;  1JWH C;  4NB8 A;  3TE5 B;  3CCU 1;  4NOZ A;  4QTT A;  2JR6 A;  5A2Q f;  1N8R 2;  1VQ5 Z;  3EER A;  4A3B I;  5D1O B;  4MH4 A;  2RT9 A;  3CCJ Z;  4A3C I;  3MON A;  2JA8 I;  5FLM I;  3CCR 1;  1TWH I;  2K3R A;  1YJ9 1;  3VMI A;  3CPW Y;  2DE6 A;  2OOY B;  5IT9 f;  4X6A I;  1NUI A;  4E2Z A;  3S16 I;  1YI2 Z;  3GTO I;  1WCM I;  1DL6 A;  3FQM A;  5T67 A;  3GKQ A;  3CCV 1;  3G4S 1;  3VTN A;  4NBE A;  2IZ3 A;  1VQP 1;  1VQ9 Z;  1Y1V I;  3G71 1;  2V8K A;  3HOZ I;  2RHB A;  1VQ6 1;  4BY7 I;  1RO4 A;  1Z02 A;  3EED A;  4RVF A;  3CCU Z;  4E2Y A;  3TDH B;  2W03 A;  1VQM 1;  4E30 A;  1KC8 1;  2HU9 A;  4NB9 A;  4BBR I;  2QA4 1;  1KQS Z;  5C4J I;  2M48 A;  1M90 2;  2OTJ 1;  2V8I A;  3CCR Z;  3S2H I;  2Q51 A;  4EWC A;  2QR1 B;  1Q86 1;  1YJ9 Z;  3MZL B;  4E2X A;  1TWA I;  4A3F I;  4MRI A;  1Q81 2;  4A3E I;  1ZB9 A;  1R9T I;  4BXX I;  2RIQ A;  3I07 A;  3CCV Z;  3G4S Z;  3CD6 1;  3J80 b;  3NDJ A;  3CPW Z;  3HOU I;  1VQP Z;  4HGY A;  4Y52 I;  1M1K 2;  2F4O A;  3G71 Z;  3CCQ 1;  2QKD A;  3J80 f;  1VQ6 Z;  3CCL 1;  2DE5 A;  1W2B Z;  3PO3 I;  1VQM Z;  1TFI A;  2QA4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...