3HOWI

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI02
3S1QI 2E2II 1WW9A 3GTMS 1WCMI 4NBCA 1USPB 4A3LI 2JA7I 2DE5A 3HOWI 2R93I 1USPA 3S1MI 1TWHI 5C3EI 2P3YA 3PO2I 4A93I 2BJOA 1Y1WI 1X3ZA 2NVQI 3H0GI 3FKII 4BXXI 4A3GI 2KPIA 4NBEA 1K83I 1QYPA 2AKLA 1NUIA 1Y1VS 3S15I 1L1OC 3I4NI 3HOXI 3HOZI 3VMHA 1LQLA 2E2HI 3HOVI 3S2DI 1ML8A 2E2JI 1I50I 4NB8A 3GTPI 5FLMI 4A3CI 1VLAA 4NOZA 1DL6A 1TWAI 3GTLI 3PO3I 2K5RA 2NVYI 1N2FA 3ESWA 3GTJI 2NVXI 4A3MI 4BBRI 3VB9A 4A3II 3H3VJ 3S14I 2F4OA 3GTKI 3S1NI 2DE7A 4NBAA 1TWGI 1TWCI 4A3JI 3M4OI 3GCFA 2NVTI 3K7AI 1I3QI 2PK7A 4BY7I 4QTTA 4QTUA 2F4MA 4BY1I 3GKQA 5C44I 3LUSA 1Y1VI 4NBDA 3I07A 4A3FI 3RZOI 4BBSI 3S2HI 4NB9A 3VMGA 2R92I 3GTOI 3EERA 3VMIA 2JA6I 3GTMI 3CQZI 5C4JI 3RZDI 2JA5I 1ZB9A 2HF1A 4X6AI 1ZB8A 1R9TI 4A3DI 3Q87A 2JS4A 4A3KI 4NBHA 3S16I 4Y7NI 3HOYI 2YU9I 1RLYA 4NBFA 2JNYA 4NBBA 3D6WA 5C4XI 2R7ZI 5IP7I 2JR6A 3HOUI 4XX2A 5CM2M 3U50C 1PFTA 3I4MI 1RO4A 4NBGA 2DE6A 5IP9I 3PO3S 4MH4A 2B63I 1SFOI 2VUMI 1I6HI 3S1RI 1TWFI 4Y52I 3GTGI 3S17I 2RBLA 4A3BI 2J6AA 1TFIA 1X3WA 1YUAA 2JA8I 3GTQI 4A3EI 3M3YI
chains in the Genus database with same CATH superfamily
1VQ6Z 2Q51A 1WCMI 4E30A 2VPXA 4DGLA 2OTJ1 2R93I 3J7A4 5AN9F 3J81f 4RVGA 3CCM1 3CCLZ 4HGZA 1NP6A 2QEX1 2RT9A 2OTLZ 1M901 1YUKA 1M902 1QYPA 5IT9f 2AKLA 4MD8A 2V8KA 3I55Z 3S15I 1L1OC 2AYDA 2E2HI 1ML8A 1K732 1I50I 5FLMI 1VLAA 1DL6A 1NJI2 2G2KA 5T64A 4MRIA 3F3FC 1KD11 4A3MI 3VB9A 4NH1C 3S14I 2F4OA 1KQSZ 4E2YA 1VQOZ 2DE7A 2OTL1 1TWGI 1K8A1 3CD61 4BY7I 2PK7A 4QTTA 2HU9A 1VQ71 2JIPA 2KI7B 2O53A 1QVGY 1VQMZ 3I07A 1P9NA 3RZOI 4BBSI 2VPWA 3D9XA 1VQ9Z 2JA6I 3MZKB 1Q7Y1 5C4JI 3QWUA 1YJNZ 2JA5I 2GTIA 3TDHB 3I56Z 3CC41 4A3KI 4Y7NI 3HOYI 1VQ41 2R6MA 1Q16A 4NBFA 2JNYA 1Z03A 3J81b 2JR6A 1WIIA 1RO4A 4NBGA 1VQN1 3CCQ1 3NH8A 5IT9b 2JA8I 3GTQI 4E2WA 3JAMb 4CL1A 1JWHC 3NH5A 2QLVB 2OTJZ 4MD9A 1WW9A 4RS4A 2JA7I 3CC71 2QREB 1TWHI 4RVFA 2GU2A 1Y1WI 2OOXB 3G711 3G71Z 4E32A 1S7MA 1X3ZA 3CMAZ 3H0GI 3FKII 4BXXI 4NBEA 1VQPZ 1NUIA 2JIMA 3I4NI 2E9HA 3HOZI 3OW2Y 3F3PC 2Y0SA 1VQ61 2P28A 2JIOA 2YADA 2IV2X 2JUBA 1QVFZ 4NOZA 1TWAI 3GTLI 3MZLB 2NVYI 3KIHA 3GTJI 1K8A2 3NH4A 1VQK1 1RQFA 1VQ5Z 2VF1A 3H3VJ 3EEDA 3CCE1 1VQ7Z 3S1NI 2RPRA 2O4HA 2QKDA 4RVHA 1TWCI 2GTHA 4A3JI 1VQ8Z 1I3QI 1S72Z 3J80f 4QTUA 2JIQA 4NFRA 1YIJ1 3GKQA 4BY1I 4TNUA 1Y1VI 1ZH1A 5A2Qf 4A3FI 2ZAEB 2I3CA 4HGYA 1YIT1 4NB9A 3EERA 2WAQA 1YI21 2EGTA 4A3DI 5FLXb 1YJ91 3CD6Z 5T6BA 1Z02A 1Q812 3CCUZ 3CCU1 5C4XI 3OW2Z 2K3RA 2R7ZI 4XX2A 2H85A 1PFTA 3I4MI 2DE6A 1SFOI 1I6HI 4A3BI 2VPZA 1SIWA 3I561 1VQO1 1YUAA 1YI2Z 5D1OA 1YJN1 3M3YI 3CXCZ 3S1QI 2E2II 1USPB 3I551 3HOWI 3IF8A 3J80b 3CCSZ 3CMA1 2W03A 5LL6f 4RVDA 2RIQA 2NVQI 2IZ4A 1WJ2A 2KPIA 2QRDB 2V3VA 3CCVZ 1W2BY 3NDJA 1K9M1 3HOXI 3CPWZ 1YITZ 3VMHA 1KQSY 1VQ4Z 3HOVI 3S2DI 2E2JI 4NB8A 3IFUA 4EWCA 2NAPA 5A2Qb 3PO3I 3HKZA 2K5RA 3ESWA 2LIYA 2NVXI 1VQNZ 3CCRZ 1W2BZ 2V8JA 4BBRI 4A3II 1Q862 2M6NA 3CPWY 1VQM1 2QA4Z 1YIJZ 3CCQZ 1KRLA 3GCFA 2NVTI 3K7AI 4MXUA 3BG1B 2F4MA 1QF8A 4DQYB 4NBDA 3CC2Z 1RNIA 2M48A 3NFZA 1VQKZ 3S2HI 3VMGA 3GTOI 1YJW1 3GTMI 5FLXf 3G4S1 4X6AI 1Q822 3S16I 1Z01A 1KC81 1QVFY 1S721 1QVGZ 1VQ81 1VQ91 3T4NB 4NBBA 3D6WA 4DK1A 3CCV1 3CCMZ 1JJ2Z 3HOUI 3U50C 5IP9I 3PO3S 3P5JB 4MH4A 2B63I 2PMZA 2VUMI 3VTNA 3CME1 3GTGI 4E31A 2J6AA 3JAMf 1X3WA 3CMEZ 2JMOA 2IZ3A 5D1PA 1VQLZ 3GTMS 1Q7Y2 3CCJZ 4NBCA 4A3LI 3FQQA 2DE5A 1FDIA 1Q811 1USPA 3S1MI 3TE5B 2OZKA 5C3EI 2P3YA 3PO2I 4A93I 2BJOA 3KIFA 1AA6A 2V8IA 3CC4Z 4MONA 4A3GI 4MD7A 3BG0B 1K83I 2OOYB 4E33A 2E7ZA 1Y1VS 1YJWZ 3IX0A 1LQLA 1YJ9Z 1KD12 3IR7A 4E2XA 2W04A 3GTPI 2QRCB 3CCS1 4A3CI 3G4SZ 4AYBA 3FQMA 1N2FA 1FDOA 2RHBA 1K731 2QA41 3G6E1 3G6EZ 3GTKI 1Q821 2PM9A 1KC82 2VPYA 4NBAA 2V45A 3M4OI 2QR1B 2QEXZ 1M1K1 1N8R2 1N8R1 5D1OB 5C44I 3LUSA 3CCEZ 2LEXA 1RO0A 3CCJ1 3CCR1 2JIRA 3NDIA 1VQL1 1WZNA 2R92I 3VMIA 2VUGA 3CQZI 1VQP1 1RO2A 3RZDI 1Q861 1ZB9A 2HF1A 1YHQZ 1ZB8A 1X0TA 1YHQ1 3Q87A 1R9TI 5T67A 2JS4A 4NBHA 2YU9I 1RLYA 4HH4A 1QXFA 1Y8CA 2WB1A 3CCL1 4RV9A 3D2LA 4S1TA 3CXCY 3CC21 5IP7I 3CC7Z 5CM2M 2Q4ZA 1VQ51 1K9M2 1M1K2 1JJ2Y 3MONA 3S1RI 1TWFI 4Y52I 2LFUA 2RBLA 3S17I 1TFIA 4E2ZA 4A3EI 1NJI1
chains in the Genus database with same CATH topology
1VQ6Z 2Q51A 1WCMI 4E30A 4DGLA 2OTJ1 2R93I 3J7A4 5AN9F 3J81f 4RVGA 3CCM1 3CCLZ 4HGZA 1NP6A 2QEX1 2RT9A 2OTLZ 1M901 1YUKA 1M902 1QYPA 5IT9f 2AKLA 4MD8A 2V8KA 3I55Z 3S15I 1L1OC 2E2HI 1ML8A 1K732 1I50I 5FLMI 1VLAA 1DL6A 1NJI2 2G2KA 5T64A 4MRIA 3F3FC 1KD11 4A3MI 3VB9A 4NH1C 3S14I 2F4OA 1KQSZ 4E2YA 1VQOZ 2DE7A 2OTL1 1TWGI 1K8A1 3CD61 4BY7I 2PK7A 4QTTA 2HU9A 1VQ71 2KI7B 2O53A 1QVGY 1VQMZ 3I07A 1P9NA 3RZOI 4BBSI 3D9XA 1VQ9Z 2JA6I 3MZKB 1Q7Y1 5C4JI 3QWUA 1YJNZ 2JA5I 2GTIA 3TDHB 3I56Z 3CC41 4A3KI 4Y7NI 3HOYI 1VQ41 2R6MA 4NBFA 2JNYA 1Z03A 3J81b 2JR6A 1WIIA 1RO4A 4NBGA 1VQN1 3CCQ1 3NH8A 5IT9b 2JA8I 3GTQI 4E2WA 3JAMb 4CL1A 1JWHC 3NH5A 2QLVB 2OTJZ 4MD9A 1WW9A 4RS4A 2JA7I 3CC71 2QREB 1TWHI 4RVFA 2GU2A 1Y1WI 2OOXB 3G711 3G71Z 4E32A 1S7MA 1X3ZA 3CMAZ 3H0GI 3FKII 4BXXI 4NBEA 1VQPZ 1NUIA 3I4NI 2E9HA 3HOZI 3OW2Y 3F3PC 2Y0SA 1VQ61 2P28A 2YADA 2JUBA 1QVFZ 4NOZA 1TWAI 3GTLI 3MZLB 2NVYI 3KIHA 3GTJI 1K8A2 3NH4A 1VQK1 1RQFA 1VQ5Z 2VF1A 3H3VJ 3EEDA 3CCE1 1VQ7Z 3S1NI 2RPRA 2O4HA 2QKDA 4RVHA 1TWCI 2GTHA 4A3JI 1VQ8Z 1I3QI 1S72Z 3J80f 4QTUA 4NFRA 4BY1I 1YIJ1 3GKQA 4TNUA 1Y1VI 1ZH1A 5A2Qf 4A3FI 2ZAEB 2I3CA 4HGYA 1YIT1 4NB9A 3EERA 2WAQA 1YI21 2EGTA 4A3DI 5FLXb 1YJ91 3CD6Z 5T6BA 1Z02A 1Q812 3CCUZ 3CCU1 5C4XI 3OW2Z 2K3RA 2R7ZI 4XX2A 2H85A 1PFTA 3I4MI 2DE6A 1SFOI 1I6HI 4A3BI 3I561 1VQO1 1YUAA 1YI2Z 5D1OA 1YJN1 3M3YI 3CXCZ 3S1QI 2E2II 1USPB 3I551 3HOWI 3IF8A 3J80b 3CCSZ 3CMA1 2W03A 5LL6f 4RVDA 2RIQA 2NVQI 2IZ4A 2KPIA 2QRDB 3CCVZ 1W2BY 3NDJA 1K9M1 3HOXI 3CPWZ 1YITZ 3VMHA 1KQSY 1VQ4Z 3HOVI 3S2DI 2E2JI 4NB8A 3IFUA 4EWCA 5A2Qb 3PO3I 3HKZA 2K5RA 3ESWA 2LIYA 2NVXI 1VQNZ 3CCRZ 1W2BZ 2V8JA 4BBRI 4A3II 1Q862 2M6NA 3CPWY 1VQM1 2QA4Z 1YIJZ 3CCQZ 1KRLA 3GCFA 2NVTI 3K7AI 4MXUA 3BG1B 2F4MA 1QF8A 4DQYB 4NBDA 3CC2Z 1RNIA 2M48A 3NFZA 1VQKZ 3S2HI 3VMGA 3GTOI 1YJW1 3GTMI 5FLXf 3G4S1 4X6AI 1Q822 3S16I 1Z01A 1KC81 1QVFY 1S721 1QVGZ 1VQ81 1VQ91 3T4NB 4NBBA 3D6WA 4DK1A 3CCV1 3CCMZ 1JJ2Z 3HOUI 3U50C 5IP9I 3PO3S 3P5JB 4MH4A 2B63I 2PMZA 2VUMI 3VTNA 3CME1 3GTGI 4E31A 2J6AA 3JAMf 1X3WA 3CMEZ 2JMOA 2IZ3A 5D1PA 1VQLZ 3GTMS 1Q7Y2 3CCJZ 4NBCA 4A3LI 3FQQA 2DE5A 1Q811 1USPA 3S1MI 3TE5B 2OZKA 5C3EI 2P3YA 3PO2I 4A93I 2BJOA 3KIFA 2V8IA 3CC4Z 4MONA 4A3GI 4MD7A 3BG0B 1K83I 2OOYB 4E33A 1Y1VS 1YJWZ 3IX0A 1LQLA 1YJ9Z 1KD12 4E2XA 2W04A 3GTPI 2QRCB 3CCS1 4A3CI 3G4SZ 4AYBA 3FQMA 1N2FA 2RHBA 1K731 2QA41 3G6E1 3G6EZ 3GTKI 1Q821 2PM9A 1KC82 4NBAA 3M4OI 2QR1B 2QEXZ 1M1K1 1N8R2 1N8R1 5D1OB 5C44I 3LUSA 3CCEZ 1RO0A 3CCJ1 3CCR1 3NDIA 1VQL1 2R92I 3VMIA 2VUGA 3CQZI 1VQP1 1RO2A 3RZDI 1Q861 1ZB9A 2HF1A 1YHQZ 1ZB8A 1R9TI 1X0TA 3Q87A 1YHQ1 5T67A 2JS4A 4NBHA 2YU9I 1RLYA 4HH4A 2WB1A 3CCL1 4RV9A 4S1TA 3CXCY 3CC21 5IP7I 3CC7Z 5CM2M 2Q4ZA 1VQ51 1K9M2 1M1K2 1JJ2Y 3MONA 3S1RI 1TWFI 4Y52I 2LFUA 2RBLA 3S17I 1TFIA 4E2ZA 4A3EI 1NJI1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q I;  2E2I I;  1WW9 A;  3GTM S;  1WCM I;  4NBC A;  1USP B;  4A3L I;  2JA7 I;  2DE5 A;  3HOW I;  2R93 I;  1USP A;  3S1M I;  1TWH I;  5C3E I;  2P3Y A;  3PO2 I;  4A93 I;  2BJO A;  1Y1W I;  1X3Z A;  2NVQ I;  3H0G I;  3FKI I;  4BXX I;  4A3G I;  2KPI A;  4NBE A;  1K83 I;  1QYP A;  2AKL A;  1NUI A;  1Y1V S;  3S15 I;  1L1O C;  3I4N I;  3HOX I;  3HOZ I;  3VMH A;  1LQL A;  2E2H I;  3HOV I;  3S2D I;  1ML8 A;  2E2J I;  1I50 I;  4NB8 A;  3GTP I;  5FLM I;  4A3C I;  1VLA A;  4NOZ A;  1DL6 A;  1TWA I;  3GTL I;  3PO3 I;  2K5R A;  2NVY I;  1N2F A;  3ESW A;  3GTJ I;  2NVX I;  4A3M I;  4BBR I;  3VB9 A;  4A3I I;  3H3V J;  3S14 I;  2F4O A;  3GTK I;  3S1N I;  2DE7 A;  4NBA A;  1TWG I;  1TWC I;  4A3J I;  3M4O I;  3GCF A;  2NVT I;  3K7A I;  1I3Q I;  2PK7 A;  4BY7 I;  4QTT A;  4QTU A;  2F4M A;  4BY1 I;  3GKQ A;  5C44 I;  3LUS A;  1Y1V I;  4NBD A;  3I07 A;  4A3F I;  3RZO I;  4BBS I;  3S2H I;  4NB9 A;  3VMG A;  2R92 I;  3GTO I;  3EER A;  3VMI A;  2JA6 I;  3GTM I;  3CQZ I;  5C4J I;  3RZD I;  2JA5 I;  1ZB9 A;  2HF1 A;  4X6A I;  1ZB8 A;  1R9T I;  4A3D I;  3Q87 A;  2JS4 A;  4A3K I;  4NBH A;  3S16 I;  4Y7N I;  3HOY I;  2YU9 I;  1RLY A;  4NBF A;  2JNY A;  4NBB A;  3D6W A;  5C4X I;  2R7Z I;  5IP7 I;  2JR6 A;  3HOU I;  4XX2 A;  5CM2 M;  3U50 C;  1PFT A;  3I4M I;  1RO4 A;  4NBG A;  2DE6 A;  5IP9 I;  3PO3 S;  4MH4 A;  2B63 I;  1SFO I;  2VUM I;  1I6H I;  3S1R I;  1TWF I;  4Y52 I;  3GTG I;  3S17 I;  2RBL A;  4A3B I;  2J6A A;  1TFI A;  1X3W A;  1YUA A;  2JA8 I;  3GTQ I;  4A3E I;  3M3Y I; 
#chains in the Genus database with same CATH topology
 1VQ6 Z;  2Q51 A;  1WCM I;  4E30 A;  2VPX A;  4DGL A;  2OTJ 1;  2R93 I;  3J7A 4;  5AN9 F;  3J81 f;  4RVG A;  3CCM 1;  3CCL Z;  4HGZ A;  1NP6 A;  2QEX 1;  2RT9 A;  2OTL Z;  1M90 1;  1YUK A;  1M90 2;  1QYP A;  5IT9 f;  2AKL A;  4MD8 A;  2V8K A;  3I55 Z;  3S15 I;  1L1O C;  2AYD A;  2E2H I;  1ML8 A;  1K73 2;  1I50 I;  5FLM I;  1VLA A;  1DL6 A;  1NJI 2;  2G2K A;  5T64 A;  4MRI A;  3F3F C;  1KD1 1;  4A3M I;  3VB9 A;  4NH1 C;  3S14 I;  2F4O A;  1KQS Z;  4E2Y A;  1VQO Z;  2DE7 A;  2OTL 1;  1TWG I;  1K8A 1;  3CD6 1;  4BY7 I;  2PK7 A;  4QTT A;  2HU9 A;  1VQ7 1;  2JIP A;  2KI7 B;  2O53 A;  1QVG Y;  1VQM Z;  3I07 A;  1P9N A;  3RZO I;  4BBS I;  2VPW A;  3D9X A;  1VQ9 Z;  2JA6 I;  3MZK B;  1Q7Y 1;  5C4J I;  3QWU A;  1YJN Z;  2JA5 I;  2GTI A;  3TDH B;  3I56 Z;  3CC4 1;  4A3K I;  4Y7N I;  3HOY I;  1VQ4 1;  2R6M A;  1Q16 A;  4NBF A;  2JNY A;  1Z03 A;  3J81 b;  2JR6 A;  1WII A;  1RO4 A;  4NBG A;  1VQN 1;  3CCQ 1;  3NH8 A;  5IT9 b;  2JA8 I;  3GTQ I;  4E2W A;  3JAM b;  4CL1 A;  1JWH C;  3NH5 A;  2QLV B;  2OTJ Z;  4MD9 A;  1WW9 A;  4RS4 A;  2JA7 I;  3CC7 1;  2QRE B;  1TWH I;  4RVF A;  2GU2 A;  1Y1W I;  2OOX B;  3G71 1;  3G71 Z;  4E32 A;  1S7M A;  1X3Z A;  3CMA Z;  3H0G I;  3FKI I;  4BXX I;  4NBE A;  1VQP Z;  1NUI A;  2JIM A;  3I4N I;  2E9H A;  3HOZ I;  3OW2 Y;  3F3P C;  2Y0S A;  1VQ6 1;  2P28 A;  2JIO A;  2YAD A;  2IV2 X;  2JUB A;  1QVF Z;  4NOZ A;  1TWA I;  3GTL I;  3MZL B;  2NVY I;  3KIH A;  3GTJ I;  1K8A 2;  3NH4 A;  1VQK 1;  1RQF A;  1VQ5 Z;  2VF1 A;  3H3V J;  3EED A;  3CCE 1;  1VQ7 Z;  3S1N I;  2RPR A;  2O4H A;  2QKD A;  4RVH A;  1TWC I;  2GTH A;  4A3J I;  1VQ8 Z;  1I3Q I;  1S72 Z;  3J80 f;  4QTU A;  2JIQ A;  4NFR A;  1YIJ 1;  3GKQ A;  4BY1 I;  4TNU A;  1Y1V I;  1ZH1 A;  5A2Q f;  4A3F I;  2ZAE B;  2I3C A;  4HGY A;  1YIT 1;  4NB9 A;  3EER A;  2WAQ A;  1YI2 1;  2EGT A;  4A3D I;  5FLX b;  1YJ9 1;  3CD6 Z;  5T6B A;  1Z02 A;  1Q81 2;  3CCU Z;  3CCU 1;  5C4X I;  3OW2 Z;  2K3R A;  2R7Z I;  4XX2 A;  2H85 A;  1PFT A;  3I4M I;  2DE6 A;  1SFO I;  1I6H I;  4A3B I;  2VPZ A;  1SIW A;  3I56 1;  1VQO 1;  1YUA A;  1YI2 Z;  5D1O A;  1YJN 1;  3M3Y I;  3CXC Z;  3S1Q I;  2E2I I;  1USP B;  3I55 1;  3HOW I;  3IF8 A;  3J80 b;  3CCS Z;  3CMA 1;  2W03 A;  5LL6 f;  4RVD A;  2RIQ A;  2NVQ I;  2IZ4 A;  1WJ2 A;  2KPI A;  2QRD B;  2V3V A;  3CCV Z;  1W2B Y;  3NDJ A;  1K9M 1;  3HOX I;  3CPW Z;  1YIT Z;  3VMH A;  1KQS Y;  1VQ4 Z;  3HOV I;  3S2D I;  2E2J I;  4NB8 A;  3IFU A;  4EWC A;  2NAP A;  5A2Q b;  3PO3 I;  3HKZ A;  2K5R A;  3ESW A;  2LIY A;  2NVX I;  1VQN Z;  3CCR Z;  1W2B Z;  2V8J A;  4BBR I;  4A3I I;  1Q86 2;  2M6N A;  3CPW Y;  1VQM 1;  2QA4 Z;  1YIJ Z;  3CCQ Z;  1KRL A;  3GCF A;  2NVT I;  3K7A I;  4MXU A;  3BG1 B;  2F4M A;  1QF8 A;  4DQY B;  4NBD A;  3CC2 Z;  1RNI A;  2M48 A;  3NFZ A;  1VQK Z;  3S2H I;  3VMG A;  3GTO I;  1YJW 1;  3GTM I;  5FLX f;  3G4S 1;  4X6A I;  1Q82 2;  3S16 I;  1Z01 A;  1KC8 1;  1QVF Y;  1S72 1;  1QVG Z;  1VQ8 1;  1VQ9 1;  3T4N B;  4NBB A;  3D6W A;  4DK1 A;  3CCV 1;  3CCM Z;  1JJ2 Z;  3HOU I;  3U50 C;  5IP9 I;  3PO3 S;  3P5J B;  4MH4 A;  2B63 I;  2PMZ A;  2VUM I;  3VTN A;  3CME 1;  3GTG I;  4E31 A;  2J6A A;  3JAM f;  1X3W A;  3CME Z;  2JMO A;  2IZ3 A;  5D1P A;  1VQL Z;  3GTM S;  1Q7Y 2;  3CCJ Z;  4NBC A;  4A3L I;  3FQQ A;  2DE5 A;  1FDI A;  1Q81 1;  1USP A;  3S1M I;  3TE5 B;  2OZK A;  5C3E I;  2P3Y A;  3PO2 I;  4A93 I;  2BJO A;  3KIF A;  1AA6 A;  2V8I A;  3CC4 Z;  4MON A;  4A3G I;  4MD7 A;  3BG0 B;  1K83 I;  2OOY B;  4E33 A;  2E7Z A;  1Y1V S;  1YJW Z;  3IX0 A;  1LQL A;  1YJ9 Z;  1KD1 2;  3IR7 A;  4E2X A;  2W04 A;  3GTP I;  2QRC B;  3CCS 1;  4A3C I;  3G4S Z;  4AYB A;  3FQM A;  1N2F A;  1FDO A;  2RHB A;  1K73 1;  2QA4 1;  3G6E 1;  3G6E Z;  3GTK I;  1Q82 1;  2PM9 A;  1KC8 2;  2VPY A;  4NBA A;  2V45 A;  3M4O I;  2QR1 B;  2QEX Z;  1M1K 1;  1N8R 2;  1N8R 1;  5D1O B;  5C44 I;  3LUS A;  3CCE Z;  2LEX A;  1RO0 A;  3CCJ 1;  3CCR 1;  2JIR A;  3NDI A;  1VQL 1;  1WZN A;  2R92 I;  3VMI A;  2VUG A;  3CQZ I;  1VQP 1;  1RO2 A;  3RZD I;  1Q86 1;  1ZB9 A;  2HF1 A;  1YHQ Z;  1ZB8 A;  1X0T A;  1YHQ 1;  3Q87 A;  1R9T I;  5T67 A;  2JS4 A;  4NBH A;  2YU9 I;  1RLY A;  4HH4 A;  1QXF A;  1Y8C A;  2WB1 A;  3CCL 1;  4RV9 A;  3D2L A;  4S1T A;  3CXC Y;  3CC2 1;  5IP7 I;  3CC7 Z;  5CM2 M;  2Q4Z A;  1VQ5 1;  1K9M 2;  1M1K 2;  1JJ2 Y;  3MON A;  3S1R I;  1TWF I;  4Y52 I;  2LFU A;  2RBL A;  3S17 I;  1TFI A;  4E2Z A;  4A3E I;  1NJI 1; 
#chains in the Genus database with same CATH homology
 1VQ6 Z;  2Q51 A;  1WCM I;  4E30 A;  4DGL A;  2OTJ 1;  2R93 I;  3J7A 4;  5AN9 F;  3J81 f;  4RVG A;  3CCM 1;  3CCL Z;  4HGZ A;  1NP6 A;  2QEX 1;  2RT9 A;  2OTL Z;  1M90 1;  1YUK A;  1M90 2;  1QYP A;  5IT9 f;  2AKL A;  4MD8 A;  2V8K A;  3I55 Z;  3S15 I;  1L1O C;  2E2H I;  1ML8 A;  1K73 2;  1I50 I;  5FLM I;  1VLA A;  1DL6 A;  1NJI 2;  2G2K A;  5T64 A;  4MRI A;  3F3F C;  1KD1 1;  4A3M I;  3VB9 A;  4NH1 C;  3S14 I;  2F4O A;  1KQS Z;  4E2Y A;  1VQO Z;  2DE7 A;  2OTL 1;  1TWG I;  1K8A 1;  3CD6 1;  4BY7 I;  2PK7 A;  4QTT A;  2HU9 A;  1VQ7 1;  2KI7 B;  2O53 A;  1QVG Y;  1VQM Z;  3I07 A;  1P9N A;  3RZO I;  4BBS I;  3D9X A;  1VQ9 Z;  2JA6 I;  3MZK B;  1Q7Y 1;  5C4J I;  3QWU A;  1YJN Z;  2JA5 I;  2GTI A;  3TDH B;  3I56 Z;  3CC4 1;  4A3K I;  4Y7N I;  3HOY I;  1VQ4 1;  2R6M A;  4NBF A;  2JNY A;  1Z03 A;  3J81 b;  2JR6 A;  1WII A;  1RO4 A;  4NBG A;  1VQN 1;  3CCQ 1;  3NH8 A;  5IT9 b;  2JA8 I;  3GTQ I;  4E2W A;  3JAM b;  4CL1 A;  1JWH C;  3NH5 A;  2QLV B;  2OTJ Z;  4MD9 A;  1WW9 A;  4RS4 A;  2JA7 I;  3CC7 1;  2QRE B;  1TWH I;  4RVF A;  2GU2 A;  1Y1W I;  2OOX B;  3G71 1;  3G71 Z;  4E32 A;  1S7M A;  1X3Z A;  3CMA Z;  3H0G I;  3FKI I;  4BXX I;  4NBE A;  1VQP Z;  1NUI A;  3I4N I;  2E9H A;  3HOZ I;  3OW2 Y;  3F3P C;  2Y0S A;  1VQ6 1;  2P28 A;  2YAD A;  2JUB A;  1QVF Z;  4NOZ A;  1TWA I;  3GTL I;  3MZL B;  2NVY I;  3KIH A;  3GTJ I;  1K8A 2;  3NH4 A;  1VQK 1;  1RQF A;  1VQ5 Z;  2VF1 A;  3H3V J;  3EED A;  3CCE 1;  1VQ7 Z;  3S1N I;  2RPR A;  2O4H A;  2QKD A;  4RVH A;  1TWC I;  2GTH A;  4A3J I;  1VQ8 Z;  1I3Q I;  1S72 Z;  3J80 f;  4QTU A;  4NFR A;  4BY1 I;  1YIJ 1;  3GKQ A;  4TNU A;  1Y1V I;  1ZH1 A;  5A2Q f;  4A3F I;  2ZAE B;  2I3C A;  4HGY A;  1YIT 1;  4NB9 A;  3EER A;  2WAQ A;  1YI2 1;  2EGT A;  4A3D I;  5FLX b;  1YJ9 1;  3CD6 Z;  5T6B A;  1Z02 A;  1Q81 2;  3CCU Z;  3CCU 1;  5C4X I;  3OW2 Z;  2K3R A;  2R7Z I;  4XX2 A;  2H85 A;  1PFT A;  3I4M I;  2DE6 A;  1SFO I;  1I6H I;  4A3B I;  3I56 1;  1VQO 1;  1YUA A;  1YI2 Z;  5D1O A;  1YJN 1;  3M3Y I;  3CXC Z;  3S1Q I;  2E2I I;  1USP B;  3I55 1;  3HOW I;  3IF8 A;  3J80 b;  3CCS Z;  3CMA 1;  2W03 A;  5LL6 f;  4RVD A;  2RIQ A;  2NVQ I;  2IZ4 A;  2KPI A;  2QRD B;  3CCV Z;  1W2B Y;  3NDJ A;  1K9M 1;  3HOX I;  3CPW Z;  1YIT Z;  3VMH A;  1KQS Y;  1VQ4 Z;  3HOV I;  3S2D I;  2E2J I;  4NB8 A;  3IFU A;  4EWC A;  5A2Q b;  3PO3 I;  3HKZ A;  2K5R A;  3ESW A;  2LIY A;  2NVX I;  1VQN Z;  3CCR Z;  1W2B Z;  2V8J A;  4BBR I;  4A3I I;  1Q86 2;  2M6N A;  3CPW Y;  1VQM 1;  2QA4 Z;  1YIJ Z;  3CCQ Z;  1KRL A;  3GCF A;  2NVT I;  3K7A I;  4MXU A;  3BG1 B;  2F4M A;  1QF8 A;  4DQY B;  4NBD A;  3CC2 Z;  1RNI A;  2M48 A;  3NFZ A;  1VQK Z;  3S2H I;  3VMG A;  3GTO I;  1YJW 1;  3GTM I;  5FLX f;  3G4S 1;  4X6A I;  1Q82 2;  3S16 I;  1Z01 A;  1KC8 1;  1QVF Y;  1S72 1;  1QVG Z;  1VQ8 1;  1VQ9 1;  3T4N B;  4NBB A;  3D6W A;  4DK1 A;  3CCV 1;  3CCM Z;  1JJ2 Z;  3HOU I;  3U50 C;  5IP9 I;  3PO3 S;  3P5J B;  4MH4 A;  2B63 I;  2PMZ A;  2VUM I;  3VTN A;  3CME 1;  3GTG I;  4E31 A;  2J6A A;  3JAM f;  1X3W A;  3CME Z;  2JMO A;  2IZ3 A;  5D1P A;  1VQL Z;  3GTM S;  1Q7Y 2;  3CCJ Z;  4NBC A;  4A3L I;  3FQQ A;  2DE5 A;  1Q81 1;  1USP A;  3S1M I;  3TE5 B;  2OZK A;  5C3E I;  2P3Y A;  3PO2 I;  4A93 I;  2BJO A;  3KIF A;  2V8I A;  3CC4 Z;  4MON A;  4A3G I;  4MD7 A;  3BG0 B;  1K83 I;  2OOY B;  4E33 A;  1Y1V S;  1YJW Z;  3IX0 A;  1LQL A;  1YJ9 Z;  1KD1 2;  4E2X A;  2W04 A;  3GTP I;  2QRC B;  3CCS 1;  4A3C I;  3G4S Z;  4AYB A;  3FQM A;  1N2F A;  2RHB A;  1K73 1;  2QA4 1;  3G6E 1;  3G6E Z;  3GTK I;  1Q82 1;  2PM9 A;  1KC8 2;  4NBA A;  3M4O I;  2QR1 B;  2QEX Z;  1M1K 1;  1N8R 2;  1N8R 1;  5D1O B;  5C44 I;  3LUS A;  3CCE Z;  1RO0 A;  3CCJ 1;  3CCR 1;  3NDI A;  1VQL 1;  2R92 I;  3VMI A;  2VUG A;  3CQZ I;  1VQP 1;  1RO2 A;  3RZD I;  1Q86 1;  1ZB9 A;  2HF1 A;  1YHQ Z;  1ZB8 A;  1R9T I;  1X0T A;  3Q87 A;  1YHQ 1;  5T67 A;  2JS4 A;  4NBH A;  2YU9 I;  1RLY A;  4HH4 A;  2WB1 A;  3CCL 1;  4RV9 A;  4S1T A;  3CXC Y;  3CC2 1;  5IP7 I;  3CC7 Z;  5CM2 M;  2Q4Z A;  1VQ5 1;  1K9M 2;  1M1K 2;  1JJ2 Y;  3MON A;  3S1R I;  1TWF I;  4Y52 I;  2LFU A;  2RBL A;  3S17 I;  1TFI A;  4E2Z A;  4A3E I;  1NJI 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...