3HOWI

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI02
3S16I 4A3LI 3I4NI 1L1OC 4BY7I 1N2FA 3GTMI 2VUMI 3GTGI 1TWFI 3I07A 3S15I 4NBDA 3S2HI 2NVQI 2F4MA 3U50C 1K83I 2K5RA 4A3FI 3GTMS 3HOYI 5C3EI 2NVXI 3EERA 1ZB8A 4A3DI 1I6HI 5C4JI 4NB8A 2F4OA 3H0GI 4A3KI 2R93I 4NBHA 2E2JI 4NOZA 2J6AA 2P3YA 3GTKI 3RZOI 2JR6A 1RO4A 3HOZI 1TWHI 2NVYI 3S2DI 3HOUI 1USPB 1TWAI 1VLAA 2AKLA 3D6WA 3FKII 4QTUA 3HOVI 2E2II 5IP7I 3GTJI 2JA7I 3LUSA 3M3YI 2NVTI 3S1RI 4XX2A 4Y52I 2JA6I 2DE6A 4A3CI 2BJOA 2B63I 3H3VJ 4Y7NI 4MH4A 3GCFA 4A3BI 1DL6A 1YUAA 1WW9A 5IP9I 5FLMI 3S1QI 3HOXI 3K7AI 4NBCA 3GTPI 3GTLI 1SFOI 3GKQA 3HOWI 1QYPA 2PK7A 1ML8A 3GTQI 2DE7A 4QTTA 3Q87A 1TWCI 3I4MI 3VB9A 3S1NI 4NBAA 1I50I 3PO3I 3VMHA 1Y1VI 2JS4A 4NBGA 4NBEA 1PFTA 2RBLA 4BBRI 4BY1I 1TWGI 4A3II 2E2HI 3S14I 4BBSI 5C44I 1RLYA 4A3MI 4NBFA 1I3QI 2YU9I 3CQZI 2R92I 4NB9A 3RZDI 4X6AI 1X3WA 3PO3S 1NUIA 1Y1VS 3ESWA 2DE5A 3GTOI 1USPA 2HF1A 5CM2M 2JA5I 3VMIA 1TFIA 4A3JI 5C4XI 2JA8I 1WCMI 3M4OI 2JNYA 3PO2I 1LQLA 3S17I 3S1MI 4NBBA 1R9TI 1Y1WI 4A3GI 4A3EI 1ZB9A 2R7ZI 4A93I 3VMGA 1X3ZA 2KPIA 4BXXI
chains in the Genus database with same CATH superfamily
3S16I 4MD9A 1TWFI 3I07A 4E2YA 1K731 2LEXA 4NBDA 3IFUA 3S2HI 3KIFA 1YITZ 1N8R2 3IX0A 2K5RA 1VQ4Z 5C3EI 3CD6Z 2NVXI 3I55Z 5C4JI 2QRDB 4A3KI 2R93I 2PMZA 3G711 2P3YA 2JR6A 3HOZI 1TWHI 2QA4Z 1K9M1 2O4HA 1FDIA 1VQKZ 2AKLA 3D6WA 1YUKA 3HOVI 3T4NB 2WAQA 5IP7I 2JA7I 3LUSA 3M3YI 4E33A 3NH5A 3CPWY 1WIIA 3OW2Z 3J80f 2IZ3A 3TE5B 1M901 1VQ71 1DL6A 5IP9I 5FLMI 3GTPI 3BG1B 3J81f 3VTNA 3NH8A 3GTQI 4EWCA 1TWCI 3S1NI 3VB9A 4NBAA 3CXCZ 1K9M2 4S1TA 3S14I 4BBSI 1M1K2 2QEX1 4A3MI 2R92I 1QVGZ 1QVFY 1P9NA 3G71Z 4NB9A 4X6AI 1KQSZ 1YI21 5T6BA 1M902 1RQFA 2QR1B 3J80b 5FLXf 3VMIA 2E9HA 1SIWA 1NJI1 2JA8I 2JNYA 4HH4A 3S17I 3S1MI 2VPXA 2O53A 4RVFA 3CCV1 3J81b 1R9TI 1Q811 2IV2X 1VQ7Z 1ZB9A 2I3CA 1W2BZ 4BXXI 4A3LI 4MD7A 4BY7I 1N2FA 3QWUA 3JAMb 3NFZA 3CCE1 3MZLB 4RS4A 2ZAEB 3CCQ1 1KC81 3J7A4 3MONA 2V8JA 2QEXZ 1NJI2 4A3DI 2WB1A 2JIPA 1I6HI 1Z01A 1Z02A 2F4OA 1YIJ1 2VPZA 1YI2Z 4DK1A 5FLXb 1Q812 3CC41 2OTL1 2OTJ1 2JIQA 3CCJ1 5IT9b 1S7MA 1YJW1 1AA6A 1USPB 1VLAA 1VQL1 1FDOA 4HGYA 4Y52I 2JIOA 2VF1A 3G6E1 2DE6A 1Q7Y2 2BJOA 2M48A 1QXFA 3GCFA 4AYBA 4A3BI 2QLVB 3K7AI 3GTLI 3NH4A 2QREB 1SFOI 3GKQA 3HOWI 3CCEZ 2VPYA 1Q822 2G2KA 2KI7B 3Q87A 3I4MI 2QRCB 3CCQZ 5LL6f 1PFTA 4BBRI 2RPRA 1K732 1TWGI 2M6NA 4A3II 1VQN1 3CCS1 1YIJZ 4NBFA 1I3QI 5AN9F 3CC4Z 4E30A 2OTLZ 2OTJZ 1NUIA 2OZKA 4DQYB 4E2XA 2DE5A 3CCJZ 5CM2M 1YJWZ 2HU9A 1VQLZ 4DGLA 2JA5I 1VQ61 4HGZA 5C4XI 1S721 4NFRA 3OW2Y 1Q16A 3G6EZ 3JAMf 2EGTA 4A3GI 2AYDA 1VQP1 4A3EI 2YADA 4BY1I 1WZNA 2P28A 3I4NI 1L1OC 1Q861 2VUMI 2RT9A 2JUBA 4E2ZA 1KD11 3CXCY 3CCU1 2NVQI 2VUGA 1K83I 3P5JB 3KIHA 1VQNZ 5IT9f 2Q4ZA 3CCSZ 4A3FI 1QVGY 1ZH1A 3H0GI 1KQSY 5D1OA 4NBHA 2E2JI 2J6AA 3FQMA 1VQ51 3RZOI 1X0TA 5D1PA 1JJ2Z 1VQ6Z 1TWAI 1Q862 1S72Z 4QTUA 3I561 3IR7A 3GTJI 1VQ91 2NVTI 3S1RI 2LIYA 1JWHC 4XX2A 3CCM1 3EEDA 1VQPZ 4TNUA 2GU2A 4MD8A 3HOXI 2W03A 1KRLA 1QF8A 3D2LA 5A2Qf 1QYPA 2PK7A 1ML8A 1N8R1 3CCUZ 2DE7A 4QTTA 3PO3I 1I50I 1Y1VI 4NBGA 2RBLA 2E2HI 2E7ZA 3CCVZ 5C44I 2OOXB 1RLYA 1KC82 3CQZI 2QKDA 1X3WA 4NH1C 4RV9A 1VQ5Z 3PO3S 1Y1VS 3ESWA 2HF1A 3D9XA 2OOYB 1TFIA 3CME1 3FQQA 3I56Z 1VQ9Z 2PM9A 4E2WA 1YJ91 1K8A1 1VQ81 1YJN1 1WCMI 3CCMZ 3M4OI 2Y0SA 3F3PC 3CPWZ 1Y1WI 5A2Qb 3CCL1 4A93I 3VMGA 2KPIA 1YHQ1 2R6MA 3CC21 1VQM1 3GTMI 3GTGI 2JIMA 3S15I 1RO0A 1M1K1 2W04A 4MONA 2V8KA 2F4MA 3U50C 2RIQA 1RNIA 1K8A2 3GTMS 3HOYI 3EERA 1ZB8A 2K3RA 4NB8A 2V3VA 3CMA1 1QVFZ 4E31A 4NOZA 3GTKI 1RO4A 3CMEZ 2NVYI 2VPWA 1YJ9Z 3S2DI 3HOUI 2LFUA 1VQ8Z 1YJNZ 3FKII 2E2II 2GTIA 1VQO1 2JA6I 5T64A 3CC71 4A3CI 3CCLZ 4RVDA 3CCR1 2B63I 3H3VJ 4Y7NI 3NDJA 4MH4A 3G4S1 1YHQZ 2GTHA 1YUAA 1WW9A 2JIRA 3CC2Z 3S1QI 1VQMZ 4NBCA 5T67A 2V45A 3MZKB 4CL1A 4E32A 2JMOA 2RHBA 2H85A 1Y8CA 3HKZA 3VMHA 2JS4A 2NAPA 4NBEA 2IZ4A 3NDIA 4MXUA 1YIT1 3TDHB 4RVHA 1KD12 1VQ41 3BG0B 4MRIA 3IF8A 3CMAZ 2YU9I 3CD61 3I551 3F3FC 3RZDI 1W2BY 1NP6A 3GTOI 5D1OB 1USPA 1JJ2Y 1WJ2A 4A3JI 2QA41 2Q51A 1VQK1 1Q7Y1 1VQOZ 4RVGA 3PO2I 1LQLA 3CC7Z 4NBBA 3CCRZ 1RO2A 3G4SZ 1Z03A 2V8IA 2R7ZI 1X3ZA 1Q821
chains in the Genus database with same CATH topology
3S16I 4MD9A 1TWFI 3I07A 4E2YA 1K731 4NBDA 3IFUA 3S2HI 3KIFA 1YITZ 1N8R2 3IX0A 2K5RA 1VQ4Z 5C3EI 3CD6Z 2NVXI 3I55Z 5C4JI 2QRDB 4A3KI 2R93I 2PMZA 3G711 2P3YA 2JR6A 3HOZI 1TWHI 2QA4Z 1K9M1 2O4HA 1VQKZ 2AKLA 3D6WA 1YUKA 3HOVI 3T4NB 2WAQA 5IP7I 2JA7I 3LUSA 3M3YI 4E33A 3NH5A 3CPWY 1WIIA 3OW2Z 3J80f 2IZ3A 3TE5B 1M901 1VQ71 1DL6A 5IP9I 5FLMI 3GTPI 3BG1B 3J81f 3VTNA 3NH8A 3GTQI 4EWCA 1TWCI 3S1NI 3VB9A 4NBAA 3CXCZ 1K9M2 4S1TA 3S14I 4BBSI 1M1K2 2QEX1 4A3MI 2R92I 1QVGZ 1QVFY 1P9NA 3G71Z 4NB9A 4X6AI 1KQSZ 1YI21 5T6BA 1M902 1RQFA 2QR1B 3J80b 5FLXf 3VMIA 2E9HA 1NJI1 2JA8I 2JNYA 4HH4A 3S17I 3S1MI 2O53A 4RVFA 3CCV1 3J81b 1R9TI 1Q811 1VQ7Z 1ZB9A 2I3CA 1W2BZ 4BXXI 4A3LI 4MD7A 4BY7I 1N2FA 3QWUA 3JAMb 3NFZA 3CCE1 3MZLB 4RS4A 2ZAEB 3CCQ1 1KC81 3J7A4 3MONA 2V8JA 2QEXZ 1NJI2 4A3DI 2WB1A 1I6HI 1Z01A 1Z02A 2F4OA 1YIJ1 1YI2Z 4DK1A 5FLXb 1Q812 3CC41 2OTL1 2OTJ1 3CCJ1 5IT9b 1S7MA 1YJW1 1USPB 1VLAA 1VQL1 4HGYA 4Y52I 2VF1A 3G6E1 2DE6A 1Q7Y2 2BJOA 2M48A 3GCFA 4AYBA 4A3BI 2QLVB 3K7AI 3GTLI 3NH4A 2QREB 1SFOI 3GKQA 3HOWI 3CCEZ 1Q822 2G2KA 2KI7B 3Q87A 3I4MI 2QRCB 5LL6f 3CCQZ 1PFTA 4BBRI 2RPRA 1K732 1TWGI 2M6NA 4A3II 1VQN1 3CCS1 1YIJZ 4NBFA 1I3QI 5AN9F 3CC4Z 4E30A 2OTLZ 2OTJZ 1NUIA 2OZKA 4DQYB 4E2XA 2DE5A 3CCJZ 5CM2M 1YJWZ 2HU9A 1VQLZ 4DGLA 2JA5I 1VQ61 4HGZA 5C4XI 1S721 4NFRA 3OW2Y 3G6EZ 3JAMf 2EGTA 4A3GI 1VQP1 4A3EI 2YADA 4BY1I 2P28A 3I4NI 1L1OC 1Q861 2VUMI 2RT9A 2JUBA 4E2ZA 1KD11 3CXCY 3CCU1 2NVQI 2VUGA 1K83I 3P5JB 3KIHA 1VQNZ 5IT9f 2Q4ZA 3CCSZ 4A3FI 1QVGY 1ZH1A 3H0GI 1KQSY 5D1OA 4NBHA 2E2JI 2J6AA 3FQMA 1VQ51 3RZOI 1X0TA 5D1PA 1JJ2Z 1VQ6Z 1TWAI 1Q862 1S72Z 4QTUA 3I561 3GTJI 1VQ91 2NVTI 3S1RI 2LIYA 1JWHC 4XX2A 3CCM1 3EEDA 1VQPZ 4TNUA 2GU2A 4MD8A 3HOXI 2W03A 1KRLA 1QF8A 5A2Qf 1QYPA 2PK7A 1ML8A 1N8R1 3CCUZ 2DE7A 4QTTA 3PO3I 1I50I 1Y1VI 4NBGA 2RBLA 2E2HI 3CCVZ 5C44I 2OOXB 1RLYA 1KC82 3CQZI 2QKDA 1X3WA 4NH1C 4RV9A 1VQ5Z 3PO3S 1Y1VS 3ESWA 2HF1A 3D9XA 2OOYB 1TFIA 3CME1 3FQQA 3I56Z 1VQ9Z 2PM9A 4E2WA 1YJ91 1K8A1 1VQ81 1YJN1 1WCMI 3CCMZ 3M4OI 2Y0SA 3F3PC 3CPWZ 1Y1WI 5A2Qb 3CCL1 4A93I 3VMGA 1YHQ1 2KPIA 2R6MA 3CC21 1VQM1 3GTMI 3GTGI 3S15I 1RO0A 1M1K1 2W04A 4MONA 2V8KA 2F4MA 3U50C 2RIQA 1RNIA 1K8A2 3GTMS 3HOYI 3EERA 1ZB8A 2K3RA 4NB8A 3CMA1 1QVFZ 4E31A 4NOZA 3GTKI 1RO4A 3CMEZ 2NVYI 3S2DI 1YJ9Z 3HOUI 2LFUA 1VQ8Z 1YJNZ 3FKII 2E2II 2GTIA 1VQO1 2JA6I 5T64A 3CC71 4A3CI 3CCLZ 4RVDA 3CCR1 2B63I 3H3VJ 4Y7NI 3NDJA 4MH4A 3G4S1 1YHQZ 2GTHA 1YUAA 1WW9A 3S1QI 3CC2Z 1VQMZ 4NBCA 5T67A 3MZKB 4CL1A 4E32A 2JMOA 2RHBA 2H85A 3HKZA 3VMHA 2JS4A 4NBEA 2IZ4A 3NDIA 4MXUA 1YIT1 3TDHB 4RVHA 1KD12 1VQ41 3BG0B 4MRIA 3IF8A 3CMAZ 2YU9I 3CD61 3I551 3F3FC 3RZDI 1W2BY 1NP6A 3GTOI 5D1OB 1USPA 1JJ2Y 4A3JI 2QA41 2Q51A 1VQK1 1Q7Y1 1VQOZ 4RVGA 3PO2I 1LQLA 3CC7Z 4NBBA 3CCRZ 1RO2A 3G4SZ 1Z03A 2V8IA 2R7ZI 1X3ZA 1Q821
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 I;  4A3L I;  3I4N I;  1L1O C;  4BY7 I;  1N2F A;  3GTM I;  2VUM I;  3GTG I;  1TWF I;  3I07 A;  3S15 I;  4NBD A;  3S2H I;  2NVQ I;  2F4M A;  3U50 C;  1K83 I;  2K5R A;  4A3F I;  3GTM S;  3HOY I;  5C3E I;  2NVX I;  3EER A;  1ZB8 A;  4A3D I;  1I6H I;  5C4J I;  4NB8 A;  2F4O A;  3H0G I;  4A3K I;  2R93 I;  4NBH A;  2E2J I;  4NOZ A;  2J6A A;  2P3Y A;  3GTK I;  3RZO I;  2JR6 A;  1RO4 A;  3HOZ I;  1TWH I;  2NVY I;  3S2D I;  3HOU I;  1USP B;  1TWA I;  1VLA A;  2AKL A;  3D6W A;  3FKI I;  4QTU A;  3HOV I;  2E2I I;  5IP7 I;  3GTJ I;  2JA7 I;  3LUS A;  3M3Y I;  2NVT I;  3S1R I;  4XX2 A;  4Y52 I;  2JA6 I;  2DE6 A;  4A3C I;  2BJO A;  2B63 I;  3H3V J;  4Y7N I;  4MH4 A;  3GCF A;  4A3B I;  1DL6 A;  1YUA A;  1WW9 A;  5IP9 I;  5FLM I;  3S1Q I;  3HOX I;  3K7A I;  4NBC A;  3GTP I;  3GTL I;  1SFO I;  3GKQ A;  3HOW I;  1QYP A;  2PK7 A;  1ML8 A;  3GTQ I;  2DE7 A;  4QTT A;  3Q87 A;  1TWC I;  3I4M I;  3VB9 A;  3S1N I;  4NBA A;  1I50 I;  3PO3 I;  3VMH A;  1Y1V I;  2JS4 A;  4NBG A;  4NBE A;  1PFT A;  2RBL A;  4BBR I;  4BY1 I;  1TWG I;  4A3I I;  2E2H I;  3S14 I;  4BBS I;  5C44 I;  1RLY A;  4A3M I;  4NBF A;  1I3Q I;  2YU9 I;  3CQZ I;  2R92 I;  4NB9 A;  3RZD I;  4X6A I;  1X3W A;  3PO3 S;  1NUI A;  1Y1V S;  3ESW A;  2DE5 A;  3GTO I;  1USP A;  2HF1 A;  5CM2 M;  2JA5 I;  3VMI A;  1TFI A;  4A3J I;  5C4X I;  2JA8 I;  1WCM I;  3M4O I;  2JNY A;  3PO2 I;  1LQL A;  3S17 I;  3S1M I;  4NBB A;  1R9T I;  1Y1W I;  4A3G I;  4A3E I;  1ZB9 A;  2R7Z I;  4A93 I;  3VMG A;  1X3Z A;  2KPI A;  4BXX I; 
#chains in the Genus database with same CATH topology
 3S16 I;  4MD9 A;  1TWF I;  3I07 A;  4E2Y A;  1K73 1;  2LEX A;  4NBD A;  3IFU A;  3S2H I;  3KIF A;  1YIT Z;  1N8R 2;  3IX0 A;  2K5R A;  1VQ4 Z;  5C3E I;  3CD6 Z;  2NVX I;  3I55 Z;  5C4J I;  2QRD B;  4A3K I;  2R93 I;  2PMZ A;  3G71 1;  2P3Y A;  2JR6 A;  3HOZ I;  1TWH I;  2QA4 Z;  1K9M 1;  2O4H A;  1FDI A;  1VQK Z;  2AKL A;  3D6W A;  1YUK A;  3HOV I;  3T4N B;  2WAQ A;  5IP7 I;  2JA7 I;  3LUS A;  3M3Y I;  4E33 A;  3NH5 A;  3CPW Y;  1WII A;  3OW2 Z;  3J80 f;  2IZ3 A;  3TE5 B;  1M90 1;  1VQ7 1;  1DL6 A;  5IP9 I;  5FLM I;  3GTP I;  3BG1 B;  3J81 f;  3VTN A;  3NH8 A;  3GTQ I;  4EWC A;  1TWC I;  3S1N I;  3VB9 A;  4NBA A;  3CXC Z;  1K9M 2;  4S1T A;  3S14 I;  4BBS I;  1M1K 2;  2QEX 1;  4A3M I;  2R92 I;  1QVG Z;  1QVF Y;  1P9N A;  3G71 Z;  4NB9 A;  4X6A I;  1KQS Z;  1YI2 1;  5T6B A;  1M90 2;  1RQF A;  2QR1 B;  3J80 b;  5FLX f;  3VMI A;  2E9H A;  1SIW A;  1NJI 1;  2JA8 I;  2JNY A;  4HH4 A;  3S17 I;  3S1M I;  2VPX A;  2O53 A;  4RVF A;  3CCV 1;  3J81 b;  1R9T I;  1Q81 1;  2IV2 X;  1VQ7 Z;  1ZB9 A;  2I3C A;  1W2B Z;  4BXX I;  4A3L I;  4MD7 A;  4BY7 I;  1N2F A;  3QWU A;  3JAM b;  3NFZ A;  3CCE 1;  3MZL B;  4RS4 A;  2ZAE B;  3CCQ 1;  1KC8 1;  3J7A 4;  3MON A;  2V8J A;  2QEX Z;  1NJI 2;  4A3D I;  2WB1 A;  2JIP A;  1I6H I;  1Z01 A;  1Z02 A;  2F4O A;  1YIJ 1;  2VPZ A;  1YI2 Z;  4DK1 A;  5FLX b;  1Q81 2;  3CC4 1;  2OTL 1;  2OTJ 1;  2JIQ A;  3CCJ 1;  5IT9 b;  1S7M A;  1YJW 1;  1AA6 A;  1USP B;  1VLA A;  1VQL 1;  1FDO A;  4HGY A;  4Y52 I;  2JIO A;  2VF1 A;  3G6E 1;  2DE6 A;  1Q7Y 2;  2BJO A;  2M48 A;  1QXF A;  3GCF A;  4AYB A;  4A3B I;  2QLV B;  3K7A I;  3GTL I;  3NH4 A;  2QRE B;  1SFO I;  3GKQ A;  3HOW I;  3CCE Z;  2VPY A;  1Q82 2;  2G2K A;  2KI7 B;  3Q87 A;  3I4M I;  2QRC B;  3CCQ Z;  5LL6 f;  1PFT A;  4BBR I;  2RPR A;  1K73 2;  1TWG I;  2M6N A;  4A3I I;  1VQN 1;  3CCS 1;  1YIJ Z;  4NBF A;  1I3Q I;  5AN9 F;  3CC4 Z;  4E30 A;  2OTL Z;  2OTJ Z;  1NUI A;  2OZK A;  4DQY B;  4E2X A;  2DE5 A;  3CCJ Z;  5CM2 M;  1YJW Z;  2HU9 A;  1VQL Z;  4DGL A;  2JA5 I;  1VQ6 1;  4HGZ A;  5C4X I;  1S72 1;  4NFR A;  3OW2 Y;  1Q16 A;  3G6E Z;  3JAM f;  2EGT A;  4A3G I;  2AYD A;  1VQP 1;  4A3E I;  2YAD A;  4BY1 I;  1WZN A;  2P28 A;  3I4N I;  1L1O C;  1Q86 1;  2VUM I;  2RT9 A;  2JUB A;  4E2Z A;  1KD1 1;  3CXC Y;  3CCU 1;  2NVQ I;  2VUG A;  1K83 I;  3P5J B;  3KIH A;  1VQN Z;  5IT9 f;  2Q4Z A;  3CCS Z;  4A3F I;  1QVG Y;  1ZH1 A;  3H0G I;  1KQS Y;  5D1O A;  4NBH A;  2E2J I;  2J6A A;  3FQM A;  1VQ5 1;  3RZO I;  1X0T A;  5D1P A;  1JJ2 Z;  1VQ6 Z;  1TWA I;  1Q86 2;  1S72 Z;  4QTU A;  3I56 1;  3IR7 A;  3GTJ I;  1VQ9 1;  2NVT I;  3S1R I;  2LIY A;  1JWH C;  4XX2 A;  3CCM 1;  3EED A;  1VQP Z;  4TNU A;  2GU2 A;  4MD8 A;  3HOX I;  2W03 A;  1KRL A;  1QF8 A;  3D2L A;  5A2Q f;  1QYP A;  2PK7 A;  1ML8 A;  1N8R 1;  3CCU Z;  2DE7 A;  4QTT A;  3PO3 I;  1I50 I;  1Y1V I;  4NBG A;  2RBL A;  2E2H I;  2E7Z A;  3CCV Z;  5C44 I;  2OOX B;  1RLY A;  1KC8 2;  3CQZ I;  2QKD A;  1X3W A;  4NH1 C;  4RV9 A;  1VQ5 Z;  3PO3 S;  1Y1V S;  3ESW A;  2HF1 A;  3D9X A;  2OOY B;  1TFI A;  3CME 1;  3FQQ A;  3I56 Z;  1VQ9 Z;  2PM9 A;  4E2W A;  1YJ9 1;  1K8A 1;  1VQ8 1;  1YJN 1;  1WCM I;  3CCM Z;  3M4O I;  2Y0S A;  3F3P C;  3CPW Z;  1Y1W I;  5A2Q b;  3CCL 1;  4A93 I;  3VMG A;  2KPI A;  1YHQ 1;  2R6M A;  3CC2 1;  1VQM 1;  3GTM I;  3GTG I;  2JIM A;  3S15 I;  1RO0 A;  1M1K 1;  2W04 A;  4MON A;  2V8K A;  2F4M A;  3U50 C;  2RIQ A;  1RNI A;  1K8A 2;  3GTM S;  3HOY I;  3EER A;  1ZB8 A;  2K3R A;  4NB8 A;  2V3V A;  3CMA 1;  1QVF Z;  4E31 A;  4NOZ A;  3GTK I;  1RO4 A;  3CME Z;  2NVY I;  2VPW A;  1YJ9 Z;  3S2D I;  3HOU I;  2LFU A;  1VQ8 Z;  1YJN Z;  3FKI I;  2E2I I;  2GTI A;  1VQO 1;  2JA6 I;  5T64 A;  3CC7 1;  4A3C I;  3CCL Z;  4RVD A;  3CCR 1;  2B63 I;  3H3V J;  4Y7N I;  3NDJ A;  4MH4 A;  3G4S 1;  1YHQ Z;  2GTH A;  1YUA A;  1WW9 A;  2JIR A;  3CC2 Z;  3S1Q I;  1VQM Z;  4NBC A;  5T67 A;  2V45 A;  3MZK B;  4CL1 A;  4E32 A;  2JMO A;  2RHB A;  2H85 A;  1Y8C A;  3HKZ A;  3VMH A;  2JS4 A;  2NAP A;  4NBE A;  2IZ4 A;  3NDI A;  4MXU A;  1YIT 1;  3TDH B;  4RVH A;  1KD1 2;  1VQ4 1;  3BG0 B;  4MRI A;  3IF8 A;  3CMA Z;  2YU9 I;  3CD6 1;  3I55 1;  3F3F C;  3RZD I;  1W2B Y;  1NP6 A;  3GTO I;  5D1O B;  1USP A;  1JJ2 Y;  1WJ2 A;  4A3J I;  2QA4 1;  2Q51 A;  1VQK 1;  1Q7Y 1;  1VQO Z;  4RVG A;  3PO2 I;  1LQL A;  3CC7 Z;  4NBB A;  3CCR Z;  1RO2 A;  3G4S Z;  1Z03 A;  2V8I A;  2R7Z I;  1X3Z A;  1Q82 1; 
#chains in the Genus database with same CATH homology
 3S16 I;  4MD9 A;  1TWF I;  3I07 A;  4E2Y A;  1K73 1;  4NBD A;  3IFU A;  3S2H I;  3KIF A;  1YIT Z;  1N8R 2;  3IX0 A;  2K5R A;  1VQ4 Z;  5C3E I;  3CD6 Z;  2NVX I;  3I55 Z;  5C4J I;  2QRD B;  4A3K I;  2R93 I;  2PMZ A;  3G71 1;  2P3Y A;  2JR6 A;  3HOZ I;  1TWH I;  2QA4 Z;  1K9M 1;  2O4H A;  1VQK Z;  2AKL A;  3D6W A;  1YUK A;  3HOV I;  3T4N B;  2WAQ A;  5IP7 I;  2JA7 I;  3LUS A;  3M3Y I;  4E33 A;  3NH5 A;  3CPW Y;  1WII A;  3OW2 Z;  3J80 f;  2IZ3 A;  3TE5 B;  1M90 1;  1VQ7 1;  1DL6 A;  5IP9 I;  5FLM I;  3GTP I;  3BG1 B;  3J81 f;  3VTN A;  3NH8 A;  3GTQ I;  4EWC A;  1TWC I;  3S1N I;  3VB9 A;  4NBA A;  3CXC Z;  1K9M 2;  4S1T A;  3S14 I;  4BBS I;  1M1K 2;  2QEX 1;  4A3M I;  2R92 I;  1QVG Z;  1QVF Y;  1P9N A;  3G71 Z;  4NB9 A;  4X6A I;  1KQS Z;  1YI2 1;  5T6B A;  1M90 2;  1RQF A;  2QR1 B;  3J80 b;  5FLX f;  3VMI A;  2E9H A;  1NJI 1;  2JA8 I;  2JNY A;  4HH4 A;  3S17 I;  3S1M I;  2O53 A;  4RVF A;  3CCV 1;  3J81 b;  1R9T I;  1Q81 1;  1VQ7 Z;  1ZB9 A;  2I3C A;  1W2B Z;  4BXX I;  4A3L I;  4MD7 A;  4BY7 I;  1N2F A;  3QWU A;  3JAM b;  3NFZ A;  3CCE 1;  3MZL B;  4RS4 A;  2ZAE B;  3CCQ 1;  1KC8 1;  3J7A 4;  3MON A;  2V8J A;  2QEX Z;  1NJI 2;  4A3D I;  2WB1 A;  1I6H I;  1Z01 A;  1Z02 A;  2F4O A;  1YIJ 1;  1YI2 Z;  4DK1 A;  5FLX b;  1Q81 2;  3CC4 1;  2OTL 1;  2OTJ 1;  3CCJ 1;  5IT9 b;  1S7M A;  1YJW 1;  1USP B;  1VLA A;  1VQL 1;  4HGY A;  4Y52 I;  2VF1 A;  3G6E 1;  2DE6 A;  1Q7Y 2;  2BJO A;  2M48 A;  3GCF A;  4AYB A;  4A3B I;  2QLV B;  3K7A I;  3GTL I;  3NH4 A;  2QRE B;  1SFO I;  3GKQ A;  3HOW I;  3CCE Z;  1Q82 2;  2G2K A;  2KI7 B;  3Q87 A;  3I4M I;  2QRC B;  5LL6 f;  3CCQ Z;  1PFT A;  4BBR I;  2RPR A;  1K73 2;  1TWG I;  2M6N A;  4A3I I;  1VQN 1;  3CCS 1;  1YIJ Z;  4NBF A;  1I3Q I;  5AN9 F;  3CC4 Z;  4E30 A;  2OTL Z;  2OTJ Z;  1NUI A;  2OZK A;  4DQY B;  4E2X A;  2DE5 A;  3CCJ Z;  5CM2 M;  1YJW Z;  2HU9 A;  1VQL Z;  4DGL A;  2JA5 I;  1VQ6 1;  4HGZ A;  5C4X I;  1S72 1;  4NFR A;  3OW2 Y;  3G6E Z;  3JAM f;  2EGT A;  4A3G I;  1VQP 1;  4A3E I;  2YAD A;  4BY1 I;  2P28 A;  3I4N I;  1L1O C;  1Q86 1;  2VUM I;  2RT9 A;  2JUB A;  4E2Z A;  1KD1 1;  3CXC Y;  3CCU 1;  2NVQ I;  2VUG A;  1K83 I;  3P5J B;  3KIH A;  1VQN Z;  5IT9 f;  2Q4Z A;  3CCS Z;  4A3F I;  1QVG Y;  1ZH1 A;  3H0G I;  1KQS Y;  5D1O A;  4NBH A;  2E2J I;  2J6A A;  3FQM A;  1VQ5 1;  3RZO I;  1X0T A;  5D1P A;  1JJ2 Z;  1VQ6 Z;  1TWA I;  1Q86 2;  1S72 Z;  4QTU A;  3I56 1;  3GTJ I;  1VQ9 1;  2NVT I;  3S1R I;  2LIY A;  1JWH C;  4XX2 A;  3CCM 1;  3EED A;  1VQP Z;  4TNU A;  2GU2 A;  4MD8 A;  3HOX I;  2W03 A;  1KRL A;  1QF8 A;  5A2Q f;  1QYP A;  2PK7 A;  1ML8 A;  1N8R 1;  3CCU Z;  2DE7 A;  4QTT A;  3PO3 I;  1I50 I;  1Y1V I;  4NBG A;  2RBL A;  2E2H I;  3CCV Z;  5C44 I;  2OOX B;  1RLY A;  1KC8 2;  3CQZ I;  2QKD A;  1X3W A;  4NH1 C;  4RV9 A;  1VQ5 Z;  3PO3 S;  1Y1V S;  3ESW A;  2HF1 A;  3D9X A;  2OOY B;  1TFI A;  3CME 1;  3FQQ A;  3I56 Z;  1VQ9 Z;  2PM9 A;  4E2W A;  1YJ9 1;  1K8A 1;  1VQ8 1;  1YJN 1;  1WCM I;  3CCM Z;  3M4O I;  2Y0S A;  3F3P C;  3CPW Z;  1Y1W I;  5A2Q b;  3CCL 1;  4A93 I;  3VMG A;  1YHQ 1;  2KPI A;  2R6M A;  3CC2 1;  1VQM 1;  3GTM I;  3GTG I;  3S15 I;  1RO0 A;  1M1K 1;  2W04 A;  4MON A;  2V8K A;  2F4M A;  3U50 C;  2RIQ A;  1RNI A;  1K8A 2;  3GTM S;  3HOY I;  3EER A;  1ZB8 A;  2K3R A;  4NB8 A;  3CMA 1;  1QVF Z;  4E31 A;  4NOZ A;  3GTK I;  1RO4 A;  3CME Z;  2NVY I;  3S2D I;  1YJ9 Z;  3HOU I;  2LFU A;  1VQ8 Z;  1YJN Z;  3FKI I;  2E2I I;  2GTI A;  1VQO 1;  2JA6 I;  5T64 A;  3CC7 1;  4A3C I;  3CCL Z;  4RVD A;  3CCR 1;  2B63 I;  3H3V J;  4Y7N I;  3NDJ A;  4MH4 A;  3G4S 1;  1YHQ Z;  2GTH A;  1YUA A;  1WW9 A;  3S1Q I;  3CC2 Z;  1VQM Z;  4NBC A;  5T67 A;  3MZK B;  4CL1 A;  4E32 A;  2JMO A;  2RHB A;  2H85 A;  3HKZ A;  3VMH A;  2JS4 A;  4NBE A;  2IZ4 A;  3NDI A;  4MXU A;  1YIT 1;  3TDH B;  4RVH A;  1KD1 2;  1VQ4 1;  3BG0 B;  4MRI A;  3IF8 A;  3CMA Z;  2YU9 I;  3CD6 1;  3I55 1;  3F3F C;  3RZD I;  1W2B Y;  1NP6 A;  3GTO I;  5D1O B;  1USP A;  1JJ2 Y;  4A3J I;  2QA4 1;  2Q51 A;  1VQK 1;  1Q7Y 1;  1VQO Z;  4RVG A;  3PO2 I;  1LQL A;  3CC7 Z;  4NBB A;  3CCR Z;  1RO2 A;  3G4S Z;  1Z03 A;  2V8I A;  2R7Z I;  1X3Z A;  1Q82 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...