3HOWI

Complete rna polymerase ii elongation complex iii with a t-u mismatch and a frayed rna 3'-uridine
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3howI02
3HOZI 3M3YI 3U50C 3H3VJ 1TWGI 3I07A 4A3MI 3HOWI 4BBSI 4QTUA 1VLAA 1QYPA 2JR6A 1TWHI 2BJOA 2E2JI 2JA5I 3RZDI 2F4MA 4NBCA 1NUIA 2NVYI 5IP9I 3S1MI 3PO3S 1ZB9A 3Q87A 1ZB8A 2VUMI 5C4XI 1TWAI 3I4MI 2J6AA 5FLMI 4NB9A 4NBFA 3GTKI 1DL6A 4NBGA 2JNYA 1ML8A 3CQZI 5C44I 4Y52I 2K5RA 1LQLA 1YUAA 4NBHA 4BBRI 4Y7NI 3S16I 4A3CI 2JA8I 2P3YA 3EERA 2B63I 3GTGI 1TWCI 3FKII 2RBLA 3HOXI 4A3FI 3S17I 1USPB 3VB9A 3HOVI 3M4OI 2JA7I 1WW9A 3GTJI 4NB8A 1I6HI 1I50I 1Y1VI 2AKLA 3HOUI 1RO4A 3I4NI 1N2FA 1RLYA 1TWFI 3ESWA 1SFOI 3HOYI 4A3LI 4NBDA 3D6WA 4NBAA 4A3JI 3GTMS 4BY1I 1USPA 3VMIA 3VMGA 4A3KI 4NOZA 1K83I 4BY7I 2E2II 3S1NI 1X3WA 1Y1VS 1WCMI 3S1RI 2YU9I 5CM2M 4X6AI 1Y1WI 3K7AI 3GTQI 3S2DI 2E2HI 2DE7A 4A3EI 1L1OC 4A3II 4MH4A 4NBBA 3S15I 5IP7I 3GTLI 2NVTI 2JA6I 4A3DI 2DE5A 5C3EI 3GTPI 3LUSA 2F4OA 3PO2I 3S1QI 4A3GI 3S2HI 3VMHA 3H0GI 3S14I 3GCFA 3PO3I 2R7ZI 1X3ZA 4XX2A 1I3QI 2HF1A 3GTOI 1PFTA 3GKQA 3GTMI 4BXXI 4A3BI 2DE6A 4A93I 2R93I 2PK7A 3RZOI 2R92I 2NVQI 2KPIA 4NBEA 5C4JI 4QTTA 2JS4A 1R9TI 1TFIA 2NVXI
chains in the Genus database with same CATH superfamily
3CPWY 3HOZI 4MD7A 3U50C 1KC82 3CCSZ 2E7ZA 2QKDA 4DQYB 3G4S1 1VQ9Z 5D1OA 1Q7Y2 3CXCY 2BJOA 3CD61 1VQL1 1ZH1A 2IZ4A 1JJ2Y 3CCQ1 5IP9I 3S1MI 3NDJA 3KIFA 3PO3S 3Q87A 1KRLA 3CCU1 1RO0A 2KI7B 1TWAI 5FLXf 4NB9A 2RPRA 1M1K1 4NBGA 3VTNA 2QA4Z 1AA6A 4MD8A 2WB1A 1YIT1 1VQNZ 4NBHA 4Y7NI 3CC41 1KD11 1RO2A 2JUBA 5T67A 3FKII 3P5JB 1USPB 3NFZA 1VQOZ 1Q862 5T6BA 1N8R2 3J80f 1I6HI 4NB8A 1Z03A 3HOUI 1RLYA 3ESWA 1Q811 4NBDA 2QLVB 4RVGA 1YJ91 3IFUA 4A3JI 1JWHC 3CXCZ 1YJN1 1QVGY 1USPA 2RIQA 1VQN1 2JIMA 4NOZA 2QR1B 4BY7I 5T64A 1WCMI 3S1RI 2YU9I 4X6AI 1YHQ1 2V45A 3QWUA 2DE7A 4A3EI 3EEDA 4MH4A 1VQK1 4RVHA 1VQ91 1VQ8Z 3S15I 2QEXZ 5IP7I 3GTLI 2JA6I 5LL6f 3CCJZ 4A3DI 2OZKA 4E2XA 2P28A 4A3GI 3PO2I 1Z01A 4MRIA 3H0GI 3GCFA 4XX2A 2JIRA 1KD12 1PFTA 2I3CA 1RQFA 3GKQA 2RHBA 3RZOI 2OTL1 1W2BY 1KQSY 3IR7A 2H85A 3H3VJ 3NH8A 4E2YA 1KC81 4QTUA 1Q821 2M6NA 2JA5I 1QVFY 1Q7Y1 2QRDB 2F4MA 4NBCA 1FDOA 4TNUA 1VQPZ 1ZB8A 2VUMI 2V8KA 4E31A 3CCE1 2J6AA 5FLMI 4RS4A 5IT9f 1VQ7Z 1QVFZ 2JNYA 1ML8A 1YJ9Z 1S7MA 4A3CI 2JA8I 3J80b 2P3YA 2V8IA 3EERA 2RBLA 2QEX1 2VPWA 3HOVI 2JA7I 1S721 1Y1VI 4E30A 3D9XA 3HOYI 3D6WA 3KIHA 1M901 3JAMf 1KQSZ 1YJW1 4RV9A 1VQM1 3MZKB 1VQMZ 2EGTA 2OTLZ 1Y1VS 5IT9b 1JJ2Z 2JIOA 3FQQA 3T4NB 1Q822 3K7AI 3GTQI 2VPZA 2O4HA 3G4SZ 3IX0A 2JIPA 3CCJ1 2NVTI 2DE5A 5C3EI 2F4OA 1RNIA 4NFRA 2GTIA 3VMHA 3J81f 1K732 3S2HI 2R7ZI 2VPYA 2Y0SA 4E2WA 3GTMI 2QA41 1Q16A 2QREB 1YJNZ 1NJI1 4A3BI 2R92I 5A2Qf 3F3PC 4QTTA 2JS4A 1R9TI 2HU9A 2NVXI 3M3YI 1VQP1 1TWGI 3CCEZ 4A3MI 3HOWI 3CMEZ 3IF8A 4BBSI 3I551 4RVFA 2JR6A 4MXUA 3BG1B 3CCQZ 5D1OB 2NVYI 2VUGA 5FLXb 2OOXB 2W03A 1ZB9A 5C4XI 4DK1A 3I4MI 3NH4A 5D1PA 3CQZI 5C44I 2K5RA 3HKZA 2V3VA 2OOYB 4BBRI 3S16I 4HH4A 3S17I 1WIIA 3CCLZ 1N8R1 1WW9A 1S72Z 1Q861 2O53A 1RO4A 3J81b 1SFOI 1VQ5Z 3G6E1 1Y8CA 4HGZA 2OTJZ 1P9NA 1YJWZ 2RT9A 3GTMS 2PMZA 2LFUA 2YADA 1K83I 2E2II 1K9M2 3S1NI 1QXFA 4HGYA 3NDIA 5A2Qb 4E2ZA 3MZLB 3J7A4 4EWCA 5CM2M 1K8A1 1VQ61 3G71Z 3F3FC 3S2DI 1W2BZ 1L1OC 4A3II 4NBBA 2E9HA 1SIWA 2IV2X 3CCVZ 3TE5B 3GTPI 4S1TA 1VQO1 4MONA 3S1QI 1NP6A 2VPXA 1QF8A 3S14I 1K731 1Z02A 1X3ZA 2JMOA 3MONA 2Q51A 2JIQA 2HF1A 1WJ2A 3GTOI 4MD9A 1YI21 2DE6A 4A93I 3CC4Z 2R93I 3CD6Z 1VQKZ 3I561 1VQLZ 2NVQI 2AYDA 2ZAEB 1YIJ1 2V8JA 1YHQZ 3CMAZ 2W04A 3I07A 2PM9A 2OTJ1 1K9M1 1VLAA 1QYPA 1TWHI 1VQ81 3CC7Z 2E2JI 1QVGZ 3RZDI 1NUIA 4DGLA 3TDHB 2NAPA 3GTKI 4NBFA 3CCS1 1DL6A 4E33A 3D2LA 3CME1 2VF1A 1VQ71 4Y52I 1LQLA 3FQMA 2LIYA 1YUAA 1YITZ 2B63I 3GTGI 1TWCI 2G2KA 3NH5A 2QRCB 4A3FI 3HOXI 2Q4ZA 1NJI2 3VB9A 3CCL1 3M4OI 1VQ41 3GTJI 1I50I 2GU2A 2AKLA 3BG0B 1Q812 3CCRZ 3I4NI 1N2FA 1TWFI 3I55Z 4A3LI 4AYBA 4NH1C 1WZNA 4NBAA 1YI2Z 4BY1I 3VMIA 3VMGA 2WAQA 3CC21 4A3KI 3CC2Z 1X3WA 2LEXA 1VQ4Z 3CCUZ 1Y1WI 3CPWZ 1K8A2 3G711 3CCR1 2R6MA 2E2HI 2GTHA 1FDIA 2IZ3A 1M1K2 3CCV1 3CC71 4RVDA 3OW2Z 3LUSA 3CCMZ 4CL1A 3PO3I 3G6EZ 1X0TA 1I3QI 3CMA1 1VQ6Z 2M48A 1VQ51 3OW2Y 2K3RA 4E32A 4BXXI 2PK7A 1M902 3I56Z 2KPIA 4NBEA 5C4JI 5AN9F 1TFIA 1YUKA 3CCM1 1YIJZ 3JAMb
chains in the Genus database with same CATH topology
3CPWY 3HOZI 4MD7A 3U50C 1KC82 3CCSZ 2QKDA 4DQYB 3G4S1 1VQ9Z 5D1OA 1Q7Y2 3CXCY 2BJOA 3CD61 1VQL1 1ZH1A 2IZ4A 1JJ2Y 3CCQ1 5IP9I 3S1MI 3NDJA 3KIFA 3PO3S 3Q87A 1KRLA 3CCU1 1RO0A 2KI7B 1TWAI 5FLXf 4NB9A 2RPRA 1M1K1 4NBGA 3VTNA 2QA4Z 4MD8A 2WB1A 1YIT1 1VQNZ 4NBHA 4Y7NI 3CC41 1KD11 1RO2A 2JUBA 5T67A 3FKII 3P5JB 1USPB 3NFZA 1VQOZ 1Q862 5T6BA 1N8R2 3J80f 1I6HI 4NB8A 1Z03A 3HOUI 1RLYA 3ESWA 1Q811 4NBDA 2QLVB 4RVGA 1YJ91 3IFUA 4A3JI 1JWHC 3CXCZ 1YJN1 1QVGY 1USPA 2RIQA 1VQN1 4NOZA 2QR1B 4BY7I 5T64A 1WCMI 3S1RI 2YU9I 4X6AI 1YHQ1 3QWUA 2DE7A 4A3EI 3EEDA 4MH4A 1VQK1 4RVHA 1VQ91 1VQ8Z 3S15I 2QEXZ 5IP7I 3GTLI 2JA6I 5LL6f 3CCJZ 4A3DI 2OZKA 4E2XA 2P28A 4A3GI 3PO2I 1Z01A 4MRIA 3H0GI 3GCFA 4XX2A 1KD12 1PFTA 2I3CA 1RQFA 3GKQA 2RHBA 3RZOI 2OTL1 1W2BY 1KQSY 2H85A 3H3VJ 3NH8A 4E2YA 1KC81 4QTUA 1Q821 2M6NA 2JA5I 1QVFY 1Q7Y1 2QRDB 2F4MA 4NBCA 4TNUA 1VQPZ 1ZB8A 2VUMI 2V8KA 4E31A 3CCE1 2J6AA 5FLMI 4RS4A 5IT9f 1VQ7Z 1QVFZ 2JNYA 1ML8A 1YJ9Z 1S7MA 4A3CI 2JA8I 3J80b 2P3YA 2V8IA 3EERA 2RBLA 2QEX1 3HOVI 2JA7I 1S721 1Y1VI 4E30A 3D9XA 3HOYI 3D6WA 3KIHA 1M901 3JAMf 1KQSZ 1YJW1 4RV9A 1VQM1 3MZKB 1VQMZ 2EGTA 2OTLZ 1Y1VS 5IT9b 1JJ2Z 3FQQA 3T4NB 1Q822 3K7AI 3GTQI 2O4HA 3G4SZ 3IX0A 3CCJ1 2NVTI 2DE5A 5C3EI 2F4OA 1RNIA 4NFRA 1K732 2GTIA 3VMHA 3J81f 3S2HI 2R7ZI 2Y0SA 4E2WA 3GTMI 2QA41 2QREB 1YJNZ 1NJI1 4A3BI 2R92I 5A2Qf 3F3PC 4QTTA 2JS4A 1R9TI 2HU9A 2NVXI 3M3YI 1VQP1 1TWGI 3CCEZ 4A3MI 3HOWI 3CMEZ 3IF8A 4BBSI 3I551 4RVFA 2JR6A 4MXUA 3BG1B 3CCQZ 5D1OB 2NVYI 2VUGA 5FLXb 2OOXB 2W03A 1ZB9A 5C4XI 4DK1A 3I4MI 3NH4A 5D1PA 3CQZI 5C44I 2K5RA 3HKZA 2OOYB 4BBRI 3S16I 4HH4A 3S17I 1WIIA 3CCLZ 1N8R1 1WW9A 1S72Z 1Q861 2O53A 1RO4A 3J81b 1SFOI 1VQ5Z 3G6E1 4HGZA 2OTJZ 1P9NA 1YJWZ 2RT9A 3GTMS 2PMZA 2LFUA 2YADA 1K83I 2E2II 1K9M2 3S1NI 4HGYA 3NDIA 5A2Qb 4E2ZA 3MZLB 3J7A4 4EWCA 5CM2M 1K8A1 1VQ61 3G71Z 3F3FC 3S2DI 1W2BZ 1L1OC 4A3II 4NBBA 2E9HA 3CCVZ 3TE5B 3GTPI 4S1TA 1VQO1 4MONA 3S1QI 1NP6A 1QF8A 3S14I 1K731 1Z02A 1X3ZA 2JMOA 3MONA 2Q51A 2HF1A 3GTOI 4MD9A 1YI21 2DE6A 4A93I 3CC4Z 2R93I 3CD6Z 1VQKZ 3I561 1VQLZ 2NVQI 2ZAEB 1YIJ1 2V8JA 1YHQZ 3CMAZ 2W04A 3I07A 2PM9A 2OTJ1 1K9M1 1VLAA 1QYPA 1TWHI 1VQ81 3CC7Z 2E2JI 1QVGZ 3RZDI 1NUIA 4DGLA 3TDHB 3GTKI 4NBFA 3CCS1 1DL6A 4E33A 3CME1 2VF1A 1VQ71 4Y52I 1LQLA 3FQMA 2LIYA 1YUAA 1YITZ 2B63I 3GTGI 1TWCI 2G2KA 3NH5A 2QRCB 4A3FI 3HOXI 2Q4ZA 1NJI2 3VB9A 3CCL1 3M4OI 1VQ41 3GTJI 1I50I 2GU2A 2AKLA 3BG0B 1Q812 3CCRZ 3I4NI 1N2FA 1TWFI 3I55Z 4A3LI 4AYBA 4NH1C 4NBAA 1YI2Z 4BY1I 3VMIA 3VMGA 2WAQA 3CC21 4A3KI 3CC2Z 1X3WA 1VQ4Z 3CCUZ 1Y1WI 3CPWZ 1K8A2 3G711 3CCR1 2R6MA 2E2HI 2GTHA 2IZ3A 1M1K2 3CCV1 3CC71 4RVDA 3OW2Z 3LUSA 3CCMZ 4CL1A 3PO3I 3G6EZ 1X0TA 1I3QI 3CMA1 1VQ6Z 2M48A 1VQ51 3OW2Y 2K3RA 4E32A 4BXXI 2PK7A 1M902 3I56Z 2KPIA 4NBEA 5C4JI 5AN9F 1TFIA 1YUKA 3CCM1 1YIJZ 3JAMb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ I;  3M3Y I;  3U50 C;  3H3V J;  1TWG I;  3I07 A;  4A3M I;  3HOW I;  4BBS I;  4QTU A;  1VLA A;  1QYP A;  2JR6 A;  1TWH I;  2BJO A;  2E2J I;  2JA5 I;  3RZD I;  2F4M A;  4NBC A;  1NUI A;  2NVY I;  5IP9 I;  3S1M I;  3PO3 S;  1ZB9 A;  3Q87 A;  1ZB8 A;  2VUM I;  5C4X I;  1TWA I;  3I4M I;  2J6A A;  5FLM I;  4NB9 A;  4NBF A;  3GTK I;  1DL6 A;  4NBG A;  2JNY A;  1ML8 A;  3CQZ I;  5C44 I;  4Y52 I;  2K5R A;  1LQL A;  1YUA A;  4NBH A;  4BBR I;  4Y7N I;  3S16 I;  4A3C I;  2JA8 I;  2P3Y A;  3EER A;  2B63 I;  3GTG I;  1TWC I;  3FKI I;  2RBL A;  3HOX I;  4A3F I;  3S17 I;  1USP B;  3VB9 A;  3HOV I;  3M4O I;  2JA7 I;  1WW9 A;  3GTJ I;  4NB8 A;  1I6H I;  1I50 I;  1Y1V I;  2AKL A;  3HOU I;  1RO4 A;  3I4N I;  1N2F A;  1RLY A;  1TWF I;  3ESW A;  1SFO I;  3HOY I;  4A3L I;  4NBD A;  3D6W A;  4NBA A;  4A3J I;  3GTM S;  4BY1 I;  1USP A;  3VMI A;  3VMG A;  4A3K I;  4NOZ A;  1K83 I;  4BY7 I;  2E2I I;  3S1N I;  1X3W A;  1Y1V S;  1WCM I;  3S1R I;  2YU9 I;  5CM2 M;  4X6A I;  1Y1W I;  3K7A I;  3GTQ I;  3S2D I;  2E2H I;  2DE7 A;  4A3E I;  1L1O C;  4A3I I;  4MH4 A;  4NBB A;  3S15 I;  5IP7 I;  3GTL I;  2NVT I;  2JA6 I;  4A3D I;  2DE5 A;  5C3E I;  3GTP I;  3LUS A;  2F4O A;  3PO2 I;  3S1Q I;  4A3G I;  3S2H I;  3VMH A;  3H0G I;  3S14 I;  3GCF A;  3PO3 I;  2R7Z I;  1X3Z A;  4XX2 A;  1I3Q I;  2HF1 A;  3GTO I;  1PFT A;  3GKQ A;  3GTM I;  4BXX I;  4A3B I;  2DE6 A;  4A93 I;  2R93 I;  2PK7 A;  3RZO I;  2R92 I;  2NVQ I;  2KPI A;  4NBE A;  5C4J I;  4QTT A;  2JS4 A;  1R9T I;  1TFI A;  2NVX I; 
#chains in the Genus database with same CATH topology
 3CPW Y;  3HOZ I;  4MD7 A;  3U50 C;  1KC8 2;  3CCS Z;  2E7Z A;  2QKD A;  4DQY B;  3G4S 1;  1VQ9 Z;  5D1O A;  1Q7Y 2;  3CXC Y;  2BJO A;  3CD6 1;  1VQL 1;  1ZH1 A;  2IZ4 A;  1JJ2 Y;  3CCQ 1;  5IP9 I;  3S1M I;  3NDJ A;  3KIF A;  3PO3 S;  3Q87 A;  1KRL A;  3CCU 1;  1RO0 A;  2KI7 B;  1TWA I;  5FLX f;  4NB9 A;  2RPR A;  1M1K 1;  4NBG A;  3VTN A;  2QA4 Z;  1AA6 A;  4MD8 A;  2WB1 A;  1YIT 1;  1VQN Z;  4NBH A;  4Y7N I;  3CC4 1;  1KD1 1;  1RO2 A;  2JUB A;  5T67 A;  3FKI I;  3P5J B;  1USP B;  3NFZ A;  1VQO Z;  1Q86 2;  5T6B A;  1N8R 2;  3J80 f;  1I6H I;  4NB8 A;  1Z03 A;  3HOU I;  1RLY A;  3ESW A;  1Q81 1;  4NBD A;  2QLV B;  4RVG A;  1YJ9 1;  3IFU A;  4A3J I;  1JWH C;  3CXC Z;  1YJN 1;  1QVG Y;  1USP A;  2RIQ A;  1VQN 1;  2JIM A;  4NOZ A;  2QR1 B;  4BY7 I;  5T64 A;  1WCM I;  3S1R I;  2YU9 I;  4X6A I;  1YHQ 1;  2V45 A;  3QWU A;  2DE7 A;  4A3E I;  3EED A;  4MH4 A;  1VQK 1;  4RVH A;  1VQ9 1;  1VQ8 Z;  3S15 I;  2QEX Z;  5IP7 I;  3GTL I;  2JA6 I;  5LL6 f;  3CCJ Z;  4A3D I;  2OZK A;  4E2X A;  2P28 A;  4A3G I;  3PO2 I;  1Z01 A;  4MRI A;  3H0G I;  3GCF A;  4XX2 A;  2JIR A;  1KD1 2;  1PFT A;  2I3C A;  1RQF A;  3GKQ A;  2RHB A;  3RZO I;  2OTL 1;  1W2B Y;  1KQS Y;  3IR7 A;  2H85 A;  3H3V J;  3NH8 A;  4E2Y A;  1KC8 1;  4QTU A;  1Q82 1;  2M6N A;  2JA5 I;  1QVF Y;  1Q7Y 1;  2QRD B;  2F4M A;  4NBC A;  1FDO A;  4TNU A;  1VQP Z;  1ZB8 A;  2VUM I;  2V8K A;  4E31 A;  3CCE 1;  2J6A A;  5FLM I;  4RS4 A;  5IT9 f;  1VQ7 Z;  1QVF Z;  2JNY A;  1ML8 A;  1YJ9 Z;  1S7M A;  4A3C I;  2JA8 I;  3J80 b;  2P3Y A;  2V8I A;  3EER A;  2RBL A;  2QEX 1;  2VPW A;  3HOV I;  2JA7 I;  1S72 1;  1Y1V I;  4E30 A;  3D9X A;  3HOY I;  3D6W A;  3KIH A;  1M90 1;  3JAM f;  1KQS Z;  1YJW 1;  4RV9 A;  1VQM 1;  3MZK B;  1VQM Z;  2EGT A;  2OTL Z;  1Y1V S;  5IT9 b;  1JJ2 Z;  2JIO A;  3FQQ A;  3T4N B;  1Q82 2;  3K7A I;  3GTQ I;  2VPZ A;  2O4H A;  3G4S Z;  3IX0 A;  2JIP A;  3CCJ 1;  2NVT I;  2DE5 A;  5C3E I;  2F4O A;  1RNI A;  4NFR A;  2GTI A;  3VMH A;  3J81 f;  1K73 2;  3S2H I;  2R7Z I;  2VPY A;  2Y0S A;  4E2W A;  3GTM I;  2QA4 1;  1Q16 A;  2QRE B;  1YJN Z;  1NJI 1;  4A3B I;  2R92 I;  5A2Q f;  3F3P C;  4QTT A;  2JS4 A;  1R9T I;  2HU9 A;  2NVX I;  3M3Y I;  1VQP 1;  1TWG I;  3CCE Z;  4A3M I;  3HOW I;  3CME Z;  3IF8 A;  4BBS I;  3I55 1;  4RVF A;  2JR6 A;  4MXU A;  3BG1 B;  3CCQ Z;  5D1O B;  2NVY I;  2VUG A;  5FLX b;  2OOX B;  2W03 A;  1ZB9 A;  5C4X I;  4DK1 A;  3I4M I;  3NH4 A;  5D1P A;  3CQZ I;  5C44 I;  2K5R A;  3HKZ A;  2V3V A;  2OOY B;  4BBR I;  3S16 I;  4HH4 A;  3S17 I;  1WII A;  3CCL Z;  1N8R 1;  1WW9 A;  1S72 Z;  1Q86 1;  2O53 A;  1RO4 A;  3J81 b;  1SFO I;  1VQ5 Z;  3G6E 1;  1Y8C A;  4HGZ A;  2OTJ Z;  1P9N A;  1YJW Z;  2RT9 A;  3GTM S;  2PMZ A;  2LFU A;  2YAD A;  1K83 I;  2E2I I;  1K9M 2;  3S1N I;  1QXF A;  4HGY A;  3NDI A;  5A2Q b;  4E2Z A;  3MZL B;  3J7A 4;  4EWC A;  5CM2 M;  1K8A 1;  1VQ6 1;  3G71 Z;  3F3F C;  3S2D I;  1W2B Z;  1L1O C;  4A3I I;  4NBB A;  2E9H A;  1SIW A;  2IV2 X;  3CCV Z;  3TE5 B;  3GTP I;  4S1T A;  1VQO 1;  4MON A;  3S1Q I;  1NP6 A;  2VPX A;  1QF8 A;  3S14 I;  1K73 1;  1Z02 A;  1X3Z A;  2JMO A;  3MON A;  2Q51 A;  2JIQ A;  2HF1 A;  1WJ2 A;  3GTO I;  4MD9 A;  1YI2 1;  2DE6 A;  4A93 I;  3CC4 Z;  2R93 I;  3CD6 Z;  1VQK Z;  3I56 1;  1VQL Z;  2NVQ I;  2AYD A;  2ZAE B;  1YIJ 1;  2V8J A;  1YHQ Z;  3CMA Z;  2W04 A;  3I07 A;  2PM9 A;  2OTJ 1;  1K9M 1;  1VLA A;  1QYP A;  1TWH I;  1VQ8 1;  3CC7 Z;  2E2J I;  1QVG Z;  3RZD I;  1NUI A;  4DGL A;  3TDH B;  2NAP A;  3GTK I;  4NBF A;  3CCS 1;  1DL6 A;  4E33 A;  3D2L A;  3CME 1;  2VF1 A;  1VQ7 1;  4Y52 I;  1LQL A;  3FQM A;  2LIY A;  1YUA A;  1YIT Z;  2B63 I;  3GTG I;  1TWC I;  2G2K A;  3NH5 A;  2QRC B;  4A3F I;  3HOX I;  2Q4Z A;  1NJI 2;  3VB9 A;  3CCL 1;  3M4O I;  1VQ4 1;  3GTJ I;  1I50 I;  2GU2 A;  2AKL A;  3BG0 B;  1Q81 2;  3CCR Z;  3I4N I;  1N2F A;  1TWF I;  3I55 Z;  4A3L I;  4AYB A;  4NH1 C;  1WZN A;  4NBA A;  1YI2 Z;  4BY1 I;  3VMI A;  3VMG A;  2WAQ A;  3CC2 1;  4A3K I;  3CC2 Z;  1X3W A;  2LEX A;  1VQ4 Z;  3CCU Z;  1Y1W I;  3CPW Z;  1K8A 2;  3G71 1;  3CCR 1;  2R6M A;  2E2H I;  2GTH A;  1FDI A;  2IZ3 A;  1M1K 2;  3CCV 1;  3CC7 1;  4RVD A;  3OW2 Z;  3LUS A;  3CCM Z;  4CL1 A;  3PO3 I;  3G6E Z;  1X0T A;  1I3Q I;  3CMA 1;  1VQ6 Z;  2M48 A;  1VQ5 1;  3OW2 Y;  2K3R A;  4E32 A;  4BXX I;  2PK7 A;  1M90 2;  3I56 Z;  2KPI A;  4NBE A;  5C4J I;  5AN9 F;  1TFI A;  1YUK A;  3CCM 1;  1YIJ Z;  3JAM b; 
#chains in the Genus database with same CATH homology
 3CPW Y;  3HOZ I;  4MD7 A;  3U50 C;  1KC8 2;  3CCS Z;  2QKD A;  4DQY B;  3G4S 1;  1VQ9 Z;  5D1O A;  1Q7Y 2;  3CXC Y;  2BJO A;  3CD6 1;  1VQL 1;  1ZH1 A;  2IZ4 A;  1JJ2 Y;  3CCQ 1;  5IP9 I;  3S1M I;  3NDJ A;  3KIF A;  3PO3 S;  3Q87 A;  1KRL A;  3CCU 1;  1RO0 A;  2KI7 B;  1TWA I;  5FLX f;  4NB9 A;  2RPR A;  1M1K 1;  4NBG A;  3VTN A;  2QA4 Z;  4MD8 A;  2WB1 A;  1YIT 1;  1VQN Z;  4NBH A;  4Y7N I;  3CC4 1;  1KD1 1;  1RO2 A;  2JUB A;  5T67 A;  3FKI I;  3P5J B;  1USP B;  3NFZ A;  1VQO Z;  1Q86 2;  5T6B A;  1N8R 2;  3J80 f;  1I6H I;  4NB8 A;  1Z03 A;  3HOU I;  1RLY A;  3ESW A;  1Q81 1;  4NBD A;  2QLV B;  4RVG A;  1YJ9 1;  3IFU A;  4A3J I;  1JWH C;  3CXC Z;  1YJN 1;  1QVG Y;  1USP A;  2RIQ A;  1VQN 1;  4NOZ A;  2QR1 B;  4BY7 I;  5T64 A;  1WCM I;  3S1R I;  2YU9 I;  4X6A I;  1YHQ 1;  3QWU A;  2DE7 A;  4A3E I;  3EED A;  4MH4 A;  1VQK 1;  4RVH A;  1VQ9 1;  1VQ8 Z;  3S15 I;  2QEX Z;  5IP7 I;  3GTL I;  2JA6 I;  5LL6 f;  3CCJ Z;  4A3D I;  2OZK A;  4E2X A;  2P28 A;  4A3G I;  3PO2 I;  1Z01 A;  4MRI A;  3H0G I;  3GCF A;  4XX2 A;  1KD1 2;  1PFT A;  2I3C A;  1RQF A;  3GKQ A;  2RHB A;  3RZO I;  2OTL 1;  1W2B Y;  1KQS Y;  2H85 A;  3H3V J;  3NH8 A;  4E2Y A;  1KC8 1;  4QTU A;  1Q82 1;  2M6N A;  2JA5 I;  1QVF Y;  1Q7Y 1;  2QRD B;  2F4M A;  4NBC A;  4TNU A;  1VQP Z;  1ZB8 A;  2VUM I;  2V8K A;  4E31 A;  3CCE 1;  2J6A A;  5FLM I;  4RS4 A;  5IT9 f;  1VQ7 Z;  1QVF Z;  2JNY A;  1ML8 A;  1YJ9 Z;  1S7M A;  4A3C I;  2JA8 I;  3J80 b;  2P3Y A;  2V8I A;  3EER A;  2RBL A;  2QEX 1;  3HOV I;  2JA7 I;  1S72 1;  1Y1V I;  4E30 A;  3D9X A;  3HOY I;  3D6W A;  3KIH A;  1M90 1;  3JAM f;  1KQS Z;  1YJW 1;  4RV9 A;  1VQM 1;  3MZK B;  1VQM Z;  2EGT A;  2OTL Z;  1Y1V S;  5IT9 b;  1JJ2 Z;  3FQQ A;  3T4N B;  1Q82 2;  3K7A I;  3GTQ I;  2O4H A;  3G4S Z;  3IX0 A;  3CCJ 1;  2NVT I;  2DE5 A;  5C3E I;  2F4O A;  1RNI A;  4NFR A;  1K73 2;  2GTI A;  3VMH A;  3J81 f;  3S2H I;  2R7Z I;  2Y0S A;  4E2W A;  3GTM I;  2QA4 1;  2QRE B;  1YJN Z;  1NJI 1;  4A3B I;  2R92 I;  5A2Q f;  3F3P C;  4QTT A;  2JS4 A;  1R9T I;  2HU9 A;  2NVX I;  3M3Y I;  1VQP 1;  1TWG I;  3CCE Z;  4A3M I;  3HOW I;  3CME Z;  3IF8 A;  4BBS I;  3I55 1;  4RVF A;  2JR6 A;  4MXU A;  3BG1 B;  3CCQ Z;  5D1O B;  2NVY I;  2VUG A;  5FLX b;  2OOX B;  2W03 A;  1ZB9 A;  5C4X I;  4DK1 A;  3I4M I;  3NH4 A;  5D1P A;  3CQZ I;  5C44 I;  2K5R A;  3HKZ A;  2OOY B;  4BBR I;  3S16 I;  4HH4 A;  3S17 I;  1WII A;  3CCL Z;  1N8R 1;  1WW9 A;  1S72 Z;  1Q86 1;  2O53 A;  1RO4 A;  3J81 b;  1SFO I;  1VQ5 Z;  3G6E 1;  4HGZ A;  2OTJ Z;  1P9N A;  1YJW Z;  2RT9 A;  3GTM S;  2PMZ A;  2LFU A;  2YAD A;  1K83 I;  2E2I I;  1K9M 2;  3S1N I;  4HGY A;  3NDI A;  5A2Q b;  4E2Z A;  3MZL B;  3J7A 4;  4EWC A;  5CM2 M;  1K8A 1;  1VQ6 1;  3G71 Z;  3F3F C;  3S2D I;  1W2B Z;  1L1O C;  4A3I I;  4NBB A;  2E9H A;  3CCV Z;  3TE5 B;  3GTP I;  4S1T A;  1VQO 1;  4MON A;  3S1Q I;  1NP6 A;  1QF8 A;  3S14 I;  1K73 1;  1Z02 A;  1X3Z A;  2JMO A;  3MON A;  2Q51 A;  2HF1 A;  3GTO I;  4MD9 A;  1YI2 1;  2DE6 A;  4A93 I;  3CC4 Z;  2R93 I;  3CD6 Z;  1VQK Z;  3I56 1;  1VQL Z;  2NVQ I;  2ZAE B;  1YIJ 1;  2V8J A;  1YHQ Z;  3CMA Z;  2W04 A;  3I07 A;  2PM9 A;  2OTJ 1;  1K9M 1;  1VLA A;  1QYP A;  1TWH I;  1VQ8 1;  3CC7 Z;  2E2J I;  1QVG Z;  3RZD I;  1NUI A;  4DGL A;  3TDH B;  3GTK I;  4NBF A;  3CCS 1;  1DL6 A;  4E33 A;  3CME 1;  2VF1 A;  1VQ7 1;  4Y52 I;  1LQL A;  3FQM A;  2LIY A;  1YUA A;  1YIT Z;  2B63 I;  3GTG I;  1TWC I;  2G2K A;  3NH5 A;  2QRC B;  4A3F I;  3HOX I;  2Q4Z A;  1NJI 2;  3VB9 A;  3CCL 1;  3M4O I;  1VQ4 1;  3GTJ I;  1I50 I;  2GU2 A;  2AKL A;  3BG0 B;  1Q81 2;  3CCR Z;  3I4N I;  1N2F A;  1TWF I;  3I55 Z;  4A3L I;  4AYB A;  4NH1 C;  4NBA A;  1YI2 Z;  4BY1 I;  3VMI A;  3VMG A;  2WAQ A;  3CC2 1;  4A3K I;  3CC2 Z;  1X3W A;  1VQ4 Z;  3CCU Z;  1Y1W I;  3CPW Z;  1K8A 2;  3G71 1;  3CCR 1;  2R6M A;  2E2H I;  2GTH A;  2IZ3 A;  1M1K 2;  3CCV 1;  3CC7 1;  4RVD A;  3OW2 Z;  3LUS A;  3CCM Z;  4CL1 A;  3PO3 I;  3G6E Z;  1X0T A;  1I3Q I;  3CMA 1;  1VQ6 Z;  2M48 A;  1VQ5 1;  3OW2 Y;  2K3R A;  4E32 A;  4BXX I;  2PK7 A;  1M90 2;  3I56 Z;  2KPI A;  4NBE A;  5C4J I;  5AN9 F;  1TFI A;  1YUK A;  3CCM 1;  1YIJ Z;  3JAM b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...