1NJI2

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nji200
1QVGZ 1JJ2Y 3CXCY 3I56Z 1VQ7Z 1VQ61 3OW2Y 2QA41 1S72Z 1NJI1 3CD6Z 1VQ91 2OTLZ 3CC71 1YJN1 3CC2Z 1KD11 3I551 2QEXZ 3CPWZ 1K732 3CC4Z 1QVFY 1Q7Y2 1M1K2 1YHQZ 1VQOZ 1VQMZ 3CCQZ 1KQSY 3CCE1 1K9M1 1YI21 1YIT1 1VQP1 1YJW1 1VQN1 1VQ41 3CCU1 1NJI2 3CCRZ 3CMA1 1YJ91 3CCJ1 1KC81 1KD12 3CCL1 3CD61 1VQ8Z 1VQKZ 3G4S1 1Q822 2OTL1 1K8A1 1W2BZ 3CCVZ 1M901 2QEX1 1K9M2 3G6EZ 3CME1 3G711 1JJ2Z 3CXCZ 1YHQ1 1VQ6Z 1VQ51 1N8R1 2QA4Z 1Q811 3CCQ1 1VQ9Z 1KC82 3CCM1 1YJNZ 3I55Z 3CCR1 1QVGY 1VQLZ 3I561 1VQ71 1QVFZ 1Q861 1K8A2 1S721 1M902 3CCSZ 2OTJZ 1YIJZ 1KQSZ 3CCEZ 1VQK1 1K731 1YI2Z 1YITZ 3CC21 1VQPZ 1YJWZ 1VQNZ 1VQ4Z 1N8R2 3CC41 3CPWY 3CCV1 1Q812 3CMAZ 1VQO1 3OW2Z 3CCJZ 1VQM1 3CCLZ 3CC7Z 1Q862 3G4SZ 1VQL1 3CMEZ 3G71Z 1Q821 1VQ81 3CCS1 1VQ5Z 2OTJ1 1YIJ1 1Q7Y1 3CCUZ 1M1K1 1W2BY 3CCMZ 3G6E1 1YJ9Z
chains in the Genus database with same CATH superfamily
2QRDB 1WZNA 2GTHA 3CXCY 2HF1A 1LQLA 2QKDA 1Y8CA 2O4HA 3GTQI 1P9NA 2NAPA 2NVTI 2VPXA 2JA6I 2OOYB 2PM9A 1L1OC 1VQOZ 3K7AI 5AN9F 3GTLI 3J80f 1VQP1 3U50C 3CCU1 3CMA1 3CCRZ 1VLAA 3CCJ1 2OOXB 5C4JI 3MONA 2HU9A 3FKII 2QLVB 4MH4A 3G4S1 1Q822 3H3VJ 2AKLA 1K8A1 4HH4A 1W2BZ 1M901 3P5JB 5D1PA 3G6EZ 3GTMI 2H85A 4X6AI 1VQ6Z 2GU2A 3GTOI 1I3QI 2JIQA 4A3CI 3CCM1 4MD7A 2EGTA 4RVGA 2RT9A 2VF1A 1VQLZ 3NH5A 4E32A 1K8A2 2JMOA 2O53A 2M48A 1M902 3S2DI 4TNUA 3I4NI 3TE5B 5CM2M 2OTJZ 3CCEZ 3M4OI 1K731 5IT9b 2GTIA 4DQYB 3KIFA 3CPWY 3CC41 3CCV1 2LFUA 1NP6A 2R7ZI 3QWUA 2K3RA 3F3FC 3HOUI 5D1OA 5IT9f 1Y1VI 5T6BA 3CCLZ 1FDOA 2QREB 3CC7Z 4NB9A 4A3MI 3IFUA 5LL6f 4BY7I 3CMEZ 4BBSI 2E2JI 1KRLA 2JUBA 5FLMI 1WW9A 1YIJ1 3NH8A 4E33A 4RVFA 4CL1A 4A3GI 1YJ9Z 3NH4A 1DL6A 1JJ2Y 3PO3S 2K5RA 3I56Z 3OW2Y 3D6WA 2LIYA 3S16I 1S72Z 1NJI1 1VQ91 4A3FI 5C4XI 2JIMA 3CC2Z 1QXFA 3J81b 3TDHB 2RIQA 1N2FA 2IZ4A 3HOWI 1S7MA 2PMZA 3JAMf 1VQMZ 2NVXI 1KQSY 2V45A 1Z01A 1K83I 1NJI2 4S1TA 2VPWA 1RO2A 4NB8A 1TWCI 3MZLB 1KC81 2E2HI 1I6HI 5T64A 3FQMA 1VQKZ 4A93I 5C3EI 2DE5A 4HGZA 3H0GI 3J80b 4MONA 1Q16A 4A3BI 2E9HA 3NDIA 3T4NB 3CXCZ 4MXUA 1TWFI 4QTTA 4RVHA 1N8R1 4RV9A 1Q811 3S14I 5C44I 1KC82 1Z03A 2RBLA 4NBCA 2F4OA 4E2XA 3CCR1 1QVGY 4BY1I 1VQ71 1Q861 1YUKA 3GCFA 2NVQI 4NBDA 1VQPZ 3GTPI 4NBFA 4MD8A 5IP7I 1N8R2 2WB1A 1Q812 3CMAZ 3LUSA 3NDJA 2VPYA 1ZH1A 3CCJZ 1TWGI 2DE6A 2BJOA 3PO2I 3I4MI 2R6MA 4RS4A 2WAQA 1Q862 3G4SZ 3EERA 1VQL1 4HGYA 3GKQA 4E2ZA 1VQ81 2OTJ1 2JA5I 3D9XA 2JA7I 1Q7Y1 1M1K1 3CCMZ 2DE7A 1QF8A 2QA41 4A3DI 3HOYI 2W04A 2QRCB 3CD6Z 2OTLZ 4MD9A 3CC71 2VUMI 4QTUA 1YJN1 1KD11 3I551 2JIOA 2QEXZ 3CPWZ 1K732 1TFIA 2Q4ZA 2YADA 3CC4Z 2B63I 1QVFY 1AA6A 1Q7Y2 4A3KI 1M1K2 1YHQZ 1ZB8A 4BBRI 1RO4A 1TWHI 3CCQZ 2JIPA 2KPIA 2V3VA 3HOZI 1YI21 1YIT1 1X3ZA 3RZOI 3D2LA 1YJW1 1VQN1 1VQ41 4BXXI 3RZDI 3I07A 1YJ91 2M6NA 4XX2A 1RLYA 2R92I 1KD12 4E31A 4E2WA 1SIWA 3JAMb 2JR6A 3ESWA 3NFZA 3S1NI 2VUGA 3G711 1JJ2Z 3GTMS 2IV2X 2KI7B 1VQ51 4AYBA 1I50I 1VQ9Z 5T67A 2IZ3A 2R93I 3HOVI 1R9TI 1RO0A 3S1MI 4Y52I 1NUIA 3CCSZ 4NFRA 1TWAI 4DGLA 1KQSZ 1VQK1 2JNYA 1ZB9A 1YUAA 3VMHA 1USPA 2ZAEB 3S1QI 5FLXb 2LEXA 1VQO1 4E30A 3CQZI 3J7A4 1Y1VS 4E2YA 1RQFA 1WCMI 4NBBA 5FLXf 4NBAA 3IR7A 5A2Qb 3GTKI 1Q821 2W03A 3S1RI 3FQQA 2G2KA 5A2Qf 3CCUZ 1W2BY 4NOZA 1X3WA 3G6E1 4NBHA 3PO3I 3S17I 2RPRA 1PFTA 1QVGZ 5IP9I 4A3LI 2VPZA 1VQ7Z 1VQ61 2Y0SA 4EWCA 5D1OB 2RHBA 1Y1WI 1X0TA 4RVDA 3CCE1 1K9M1 2JS4A 2E2II 3IX0A 3IF8A 4NH1C 3CCL1 3S15I 1WIIA 3CD61 1VQ8Z 2F4MA 3GTJI 2OZKA 2OTL1 4DK1A 2P3YA 3M3YI 4MRIA 4A3EI 3Q87A 2JIRA 2J6AA 3CCVZ 2QEX1 1K9M2 3VTNA 3CME1 3S2HI 1YHQ1 1WJ2A 3VB9A 2QA4Z 1Z02A 3CCQ1 2YU9I 2V8KA 1JWHC 4NBGA 3GTGI 1YJNZ 4Y7NI 3I55Z 3I561 1QVFZ 2Q51A 2V8JA 1S721 3VMGA 1YIJZ 4NBEA 1YI2Z 1YITZ 3CC21 2PK7A 2QR1B 1YJWZ 1VQNZ 3EEDA 2P28A 1VQ4Z 3HKZA 3HOXI 3OW2Z 1VQM1 1QYPA 1FDIA 1RNIA 2V8IA 3VMIA 4A3II 2AYDA 2E7ZA 1USPB 2I3CA 3KIHA 3BG0B 3BG1B 3MZKB 1SFOI 3G71Z 4A3JI 3CCS1 1VQ5Z 2NVYI 3F3PC 2JA8I 1ML8A 3J81f
chains in the Genus database with same CATH topology
2QRDB 2GTHA 3CXCY 2HF1A 1LQLA 2QKDA 2O4HA 3GTQI 1P9NA 2NVTI 2JA6I 2OOYB 2PM9A 1L1OC 1VQOZ 3K7AI 5AN9F 3GTLI 3J80f 1VQP1 3U50C 3CCU1 3CMA1 3CCRZ 1VLAA 3CCJ1 2OOXB 5C4JI 3MONA 2HU9A 3FKII 2QLVB 4MH4A 3G4S1 1Q822 3H3VJ 2AKLA 1K8A1 4HH4A 1W2BZ 1M901 3P5JB 5D1PA 3G6EZ 3GTMI 2H85A 4X6AI 1VQ6Z 2GU2A 3GTOI 1I3QI 4A3CI 3CCM1 4MD7A 2EGTA 4RVGA 2RT9A 2VF1A 1VQLZ 3NH5A 4E32A 1K8A2 2JMOA 2O53A 2M48A 1M902 3S2DI 4TNUA 3I4NI 3TE5B 5CM2M 2OTJZ 3CCEZ 3M4OI 1K731 5IT9b 2GTIA 4DQYB 3KIFA 3CPWY 3CC41 3CCV1 2LFUA 1NP6A 2R7ZI 3QWUA 2K3RA 3F3FC 3HOUI 5D1OA 5IT9f 1Y1VI 5T6BA 3CCLZ 2QREB 3CC7Z 4NB9A 4A3MI 3IFUA 5LL6f 4BY7I 3CMEZ 4BBSI 2E2JI 1KRLA 2JUBA 5FLMI 1WW9A 1YIJ1 3NH8A 4E33A 4RVFA 4CL1A 4A3GI 1YJ9Z 3NH4A 1DL6A 1JJ2Y 3PO3S 2K5RA 3I56Z 3OW2Y 3D6WA 2LIYA 3S16I 1S72Z 1NJI1 1VQ91 4A3FI 5C4XI 3CC2Z 3J81b 3TDHB 2RIQA 1N2FA 2IZ4A 3HOWI 1S7MA 2PMZA 3JAMf 1VQMZ 2NVXI 1KQSY 1Z01A 1K83I 1NJI2 4S1TA 1RO2A 4NB8A 1TWCI 3MZLB 1KC81 2E2HI 1I6HI 5T64A 3FQMA 1VQKZ 4A93I 5C3EI 2DE5A 4HGZA 3H0GI 4MONA 3J80b 4A3BI 2E9HA 3NDIA 3T4NB 3CXCZ 4MXUA 1TWFI 4QTTA 4RVHA 1N8R1 4RV9A 1Q811 3S14I 5C44I 1KC82 1Z03A 2RBLA 4NBCA 2F4OA 4E2XA 3CCR1 1QVGY 4BY1I 1VQ71 1Q861 1YUKA 3GCFA 2NVQI 4NBDA 1VQPZ 3GTPI 4NBFA 4MD8A 5IP7I 1N8R2 2WB1A 1Q812 3LUSA 3NDJA 3CMAZ 1ZH1A 3CCJZ 1TWGI 2DE6A 2BJOA 3PO2I 3I4MI 2R6MA 4RS4A 2WAQA 1Q862 3G4SZ 3EERA 1VQL1 4HGYA 3GKQA 4E2ZA 1VQ81 2OTJ1 2JA5I 3D9XA 2JA7I 1Q7Y1 1M1K1 3CCMZ 2DE7A 1QF8A 2QA41 4A3DI 3HOYI 2W04A 2QRCB 3CD6Z 2OTLZ 4MD9A 3CC71 2VUMI 4QTUA 1YJN1 1KD11 3I551 2QEXZ 3CPWZ 1K732 1TFIA 2Q4ZA 2YADA 3CC4Z 2B63I 1QVFY 1Q7Y2 4A3KI 1M1K2 1YHQZ 1ZB8A 4BBRI 1RO4A 1TWHI 3CCQZ 2KPIA 3HOZI 1YI21 1YIT1 1X3ZA 3RZOI 1YJW1 1VQN1 1VQ41 4BXXI 3RZDI 3I07A 1YJ91 2M6NA 4XX2A 1RLYA 2R92I 1KD12 4E31A 4E2WA 3JAMb 2JR6A 3ESWA 3NFZA 3S1NI 2VUGA 3G711 1JJ2Z 3GTMS 2KI7B 1VQ51 4AYBA 1I50I 1VQ9Z 5T67A 2IZ3A 2R93I 3HOVI 1R9TI 1RO0A 3S1MI 4Y52I 1NUIA 3CCSZ 4NFRA 1TWAI 4DGLA 1KQSZ 1VQK1 2JNYA 1ZB9A 1YUAA 3VMHA 1USPA 2ZAEB 3S1QI 5FLXb 1VQO1 4E30A 3CQZI 3J7A4 1Y1VS 4E2YA 1RQFA 1WCMI 4NBBA 5FLXf 4NBAA 5A2Qb 3GTKI 1Q821 2W03A 3S1RI 3FQQA 2G2KA 5A2Qf 3CCUZ 1W2BY 4NOZA 1X3WA 3G6E1 4NBHA 3PO3I 3S17I 2RPRA 1PFTA 1QVGZ 5IP9I 4A3LI 1VQ7Z 1VQ61 2Y0SA 4EWCA 5D1OB 2RHBA 1Y1WI 1X0TA 4RVDA 3CCE1 1K9M1 2JS4A 2E2II 3IX0A 3IF8A 4NH1C 3CCL1 3S15I 1WIIA 3CD61 1VQ8Z 2F4MA 3GTJI 2OZKA 2OTL1 4DK1A 2P3YA 3M3YI 4MRIA 4A3EI 3Q87A 2J6AA 3CCVZ 2QEX1 1K9M2 3VTNA 3CME1 3S2HI 1YHQ1 3VB9A 2QA4Z 1Z02A 3CCQ1 2YU9I 2V8KA 1JWHC 4NBGA 3GTGI 1YJNZ 4Y7NI 3I55Z 3I561 1QVFZ 2Q51A 2V8JA 1S721 3VMGA 1YIJZ 4NBEA 1YI2Z 1YITZ 3CC21 2PK7A 2QR1B 1YJWZ 1VQNZ 3EEDA 2P28A 1VQ4Z 3HKZA 3HOXI 3OW2Z 1VQM1 1QYPA 1RNIA 2V8IA 3VMIA 4A3II 1USPB 2I3CA 3KIHA 3BG0B 3BG1B 3MZKB 1SFOI 3G71Z 4A3JI 3CCS1 1VQ5Z 2NVYI 3F3PC 2JA8I 1ML8A 3J81f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Z;  1JJ2 Y;  3CXC Y;  3I56 Z;  1VQ7 Z;  1VQ6 1;  3OW2 Y;  2QA4 1;  1S72 Z;  1NJI 1;  3CD6 Z;  1VQ9 1;  2OTL Z;  3CC7 1;  1YJN 1;  3CC2 Z;  1KD1 1;  3I55 1;  2QEX Z;  3CPW Z;  1K73 2;  3CC4 Z;  1QVF Y;  1Q7Y 2;  1M1K 2;  1YHQ Z;  1VQO Z;  1VQM Z;  3CCQ Z;  1KQS Y;  3CCE 1;  1K9M 1;  1YI2 1;  1YIT 1;  1VQP 1;  1YJW 1;  1VQN 1;  1VQ4 1;  3CCU 1;  1NJI 2;  3CCR Z;  3CMA 1;  1YJ9 1;  3CCJ 1;  1KC8 1;  1KD1 2;  3CCL 1;  3CD6 1;  1VQ8 Z;  1VQK Z;  3G4S 1;  1Q82 2;  2OTL 1;  1K8A 1;  1W2B Z;  3CCV Z;  1M90 1;  2QEX 1;  1K9M 2;  3G6E Z;  3CME 1;  3G71 1;  1JJ2 Z;  3CXC Z;  1YHQ 1;  1VQ6 Z;  1VQ5 1;  1N8R 1;  2QA4 Z;  1Q81 1;  3CCQ 1;  1VQ9 Z;  1KC8 2;  3CCM 1;  1YJN Z;  3I55 Z;  3CCR 1;  1QVG Y;  1VQL Z;  3I56 1;  1VQ7 1;  1QVF Z;  1Q86 1;  1K8A 2;  1S72 1;  1M90 2;  3CCS Z;  2OTJ Z;  1YIJ Z;  1KQS Z;  3CCE Z;  1VQK 1;  1K73 1;  1YI2 Z;  1YIT Z;  3CC2 1;  1VQP Z;  1YJW Z;  1VQN Z;  1VQ4 Z;  1N8R 2;  3CC4 1;  3CPW Y;  3CCV 1;  1Q81 2;  3CMA Z;  1VQO 1;  3OW2 Z;  3CCJ Z;  1VQM 1;  3CCL Z;  3CC7 Z;  1Q86 2;  3G4S Z;  1VQL 1;  3CME Z;  3G71 Z;  1Q82 1;  1VQ8 1;  3CCS 1;  1VQ5 Z;  2OTJ 1;  1YIJ 1;  1Q7Y 1;  3CCU Z;  1M1K 1;  1W2B Y;  3CCM Z;  3G6E 1;  1YJ9 Z; 
#chains in the Genus database with same CATH topology
 2QRD B;  1WZN A;  2GTH A;  3CXC Y;  2HF1 A;  1LQL A;  2QKD A;  1Y8C A;  2O4H A;  3GTQ I;  1P9N A;  2NAP A;  2NVT I;  2VPX A;  2JA6 I;  2OOY B;  2PM9 A;  1L1O C;  1VQO Z;  3K7A I;  5AN9 F;  3GTL I;  3J80 f;  1VQP 1;  3U50 C;  3CCU 1;  3CMA 1;  3CCR Z;  1VLA A;  3CCJ 1;  2OOX B;  5C4J I;  3MON A;  2HU9 A;  3FKI I;  2QLV B;  4MH4 A;  3G4S 1;  1Q82 2;  3H3V J;  2AKL A;  1K8A 1;  4HH4 A;  1W2B Z;  1M90 1;  3P5J B;  5D1P A;  3G6E Z;  3GTM I;  2H85 A;  4X6A I;  1VQ6 Z;  2GU2 A;  3GTO I;  1I3Q I;  2JIQ A;  4A3C I;  3CCM 1;  4MD7 A;  2EGT A;  4RVG A;  2RT9 A;  2VF1 A;  1VQL Z;  3NH5 A;  4E32 A;  1K8A 2;  2JMO A;  2O53 A;  2M48 A;  1M90 2;  3S2D I;  4TNU A;  3I4N I;  3TE5 B;  5CM2 M;  2OTJ Z;  3CCE Z;  3M4O I;  1K73 1;  5IT9 b;  2GTI A;  4DQY B;  3KIF A;  3CPW Y;  3CC4 1;  3CCV 1;  2LFU A;  1NP6 A;  2R7Z I;  3QWU A;  2K3R A;  3F3F C;  3HOU I;  5D1O A;  5IT9 f;  1Y1V I;  5T6B A;  3CCL Z;  1FDO A;  2QRE B;  3CC7 Z;  4NB9 A;  4A3M I;  3IFU A;  5LL6 f;  4BY7 I;  3CME Z;  4BBS I;  2E2J I;  1KRL A;  2JUB A;  5FLM I;  1WW9 A;  1YIJ 1;  3NH8 A;  4E33 A;  4RVF A;  4CL1 A;  4A3G I;  1YJ9 Z;  3NH4 A;  1DL6 A;  1JJ2 Y;  3PO3 S;  2K5R A;  3I56 Z;  3OW2 Y;  3D6W A;  2LIY A;  3S16 I;  1S72 Z;  1NJI 1;  1VQ9 1;  4A3F I;  5C4X I;  2JIM A;  3CC2 Z;  1QXF A;  3J81 b;  3TDH B;  2RIQ A;  1N2F A;  2IZ4 A;  3HOW I;  1S7M A;  2PMZ A;  3JAM f;  1VQM Z;  2NVX I;  1KQS Y;  2V45 A;  1Z01 A;  1K83 I;  1NJI 2;  4S1T A;  2VPW A;  1RO2 A;  4NB8 A;  1TWC I;  3MZL B;  1KC8 1;  2E2H I;  1I6H I;  5T64 A;  3FQM A;  1VQK Z;  4A93 I;  5C3E I;  2DE5 A;  4HGZ A;  3H0G I;  3J80 b;  4MON A;  1Q16 A;  4A3B I;  2E9H A;  3NDI A;  3T4N B;  3CXC Z;  4MXU A;  1TWF I;  4QTT A;  4RVH A;  1N8R 1;  4RV9 A;  1Q81 1;  3S14 I;  5C44 I;  1KC8 2;  1Z03 A;  2RBL A;  4NBC A;  2F4O A;  4E2X A;  3CCR 1;  1QVG Y;  4BY1 I;  1VQ7 1;  1Q86 1;  1YUK A;  3GCF A;  2NVQ I;  4NBD A;  1VQP Z;  3GTP I;  4NBF A;  4MD8 A;  5IP7 I;  1N8R 2;  2WB1 A;  1Q81 2;  3CMA Z;  3LUS A;  3NDJ A;  2VPY A;  1ZH1 A;  3CCJ Z;  1TWG I;  2DE6 A;  2BJO A;  3PO2 I;  3I4M I;  2R6M A;  4RS4 A;  2WAQ A;  1Q86 2;  3G4S Z;  3EER A;  1VQL 1;  4HGY A;  3GKQ A;  4E2Z A;  1VQ8 1;  2OTJ 1;  2JA5 I;  3D9X A;  2JA7 I;  1Q7Y 1;  1M1K 1;  3CCM Z;  2DE7 A;  1QF8 A;  2QA4 1;  4A3D I;  3HOY I;  2W04 A;  2QRC B;  3CD6 Z;  2OTL Z;  4MD9 A;  3CC7 1;  2VUM I;  4QTU A;  1YJN 1;  1KD1 1;  3I55 1;  2JIO A;  2QEX Z;  3CPW Z;  1K73 2;  1TFI A;  2Q4Z A;  2YAD A;  3CC4 Z;  2B63 I;  1QVF Y;  1AA6 A;  1Q7Y 2;  4A3K I;  1M1K 2;  1YHQ Z;  1ZB8 A;  4BBR I;  1RO4 A;  1TWH I;  3CCQ Z;  2JIP A;  2KPI A;  2V3V A;  3HOZ I;  1YI2 1;  1YIT 1;  1X3Z A;  3RZO I;  3D2L A;  1YJW 1;  1VQN 1;  1VQ4 1;  4BXX I;  3RZD I;  3I07 A;  1YJ9 1;  2M6N A;  4XX2 A;  1RLY A;  2R92 I;  1KD1 2;  4E31 A;  4E2W A;  1SIW A;  3JAM b;  2JR6 A;  3ESW A;  3NFZ A;  3S1N I;  2VUG A;  3G71 1;  1JJ2 Z;  3GTM S;  2IV2 X;  2KI7 B;  1VQ5 1;  4AYB A;  1I50 I;  1VQ9 Z;  5T67 A;  2IZ3 A;  2R93 I;  3HOV I;  1R9T I;  1RO0 A;  3S1M I;  4Y52 I;  1NUI A;  3CCS Z;  4NFR A;  1TWA I;  4DGL A;  1KQS Z;  1VQK 1;  2JNY A;  1ZB9 A;  1YUA A;  3VMH A;  1USP A;  2ZAE B;  3S1Q I;  5FLX b;  2LEX A;  1VQO 1;  4E30 A;  3CQZ I;  3J7A 4;  1Y1V S;  4E2Y A;  1RQF A;  1WCM I;  4NBB A;  5FLX f;  4NBA A;  3IR7 A;  5A2Q b;  3GTK I;  1Q82 1;  2W03 A;  3S1R I;  3FQQ A;  2G2K A;  5A2Q f;  3CCU Z;  1W2B Y;  4NOZ A;  1X3W A;  3G6E 1;  4NBH A;  3PO3 I;  3S17 I;  2RPR A;  1PFT A;  1QVG Z;  5IP9 I;  4A3L I;  2VPZ A;  1VQ7 Z;  1VQ6 1;  2Y0S A;  4EWC A;  5D1O B;  2RHB A;  1Y1W I;  1X0T A;  4RVD A;  3CCE 1;  1K9M 1;  2JS4 A;  2E2I I;  3IX0 A;  3IF8 A;  4NH1 C;  3CCL 1;  3S15 I;  1WII A;  3CD6 1;  1VQ8 Z;  2F4M A;  3GTJ I;  2OZK A;  2OTL 1;  4DK1 A;  2P3Y A;  3M3Y I;  4MRI A;  4A3E I;  3Q87 A;  2JIR A;  2J6A A;  3CCV Z;  2QEX 1;  1K9M 2;  3VTN A;  3CME 1;  3S2H I;  1YHQ 1;  1WJ2 A;  3VB9 A;  2QA4 Z;  1Z02 A;  3CCQ 1;  2YU9 I;  2V8K A;  1JWH C;  4NBG A;  3GTG I;  1YJN Z;  4Y7N I;  3I55 Z;  3I56 1;  1QVF Z;  2Q51 A;  2V8J A;  1S72 1;  3VMG A;  1YIJ Z;  4NBE A;  1YI2 Z;  1YIT Z;  3CC2 1;  2PK7 A;  2QR1 B;  1YJW Z;  1VQN Z;  3EED A;  2P28 A;  1VQ4 Z;  3HKZ A;  3HOX I;  3OW2 Z;  1VQM 1;  1QYP A;  1FDI A;  1RNI A;  2V8I A;  3VMI A;  4A3I I;  2AYD A;  2E7Z A;  1USP B;  2I3C A;  3KIH A;  3BG0 B;  3BG1 B;  3MZK B;  1SFO I;  3G71 Z;  4A3J I;  3CCS 1;  1VQ5 Z;  2NVY I;  3F3P C;  2JA8 I;  1ML8 A;  3J81 f; 
#chains in the Genus database with same CATH homology
 2QRD B;  2GTH A;  3CXC Y;  2HF1 A;  1LQL A;  2QKD A;  2O4H A;  3GTQ I;  1P9N A;  2NVT I;  2JA6 I;  2OOY B;  2PM9 A;  1L1O C;  1VQO Z;  3K7A I;  5AN9 F;  3GTL I;  3J80 f;  1VQP 1;  3U50 C;  3CCU 1;  3CMA 1;  3CCR Z;  1VLA A;  3CCJ 1;  2OOX B;  5C4J I;  3MON A;  2HU9 A;  3FKI I;  2QLV B;  4MH4 A;  3G4S 1;  1Q82 2;  3H3V J;  2AKL A;  1K8A 1;  4HH4 A;  1W2B Z;  1M90 1;  3P5J B;  5D1P A;  3G6E Z;  3GTM I;  2H85 A;  4X6A I;  1VQ6 Z;  2GU2 A;  3GTO I;  1I3Q I;  4A3C I;  3CCM 1;  4MD7 A;  2EGT A;  4RVG A;  2RT9 A;  2VF1 A;  1VQL Z;  3NH5 A;  4E32 A;  1K8A 2;  2JMO A;  2O53 A;  2M48 A;  1M90 2;  3S2D I;  4TNU A;  3I4N I;  3TE5 B;  5CM2 M;  2OTJ Z;  3CCE Z;  3M4O I;  1K73 1;  5IT9 b;  2GTI A;  4DQY B;  3KIF A;  3CPW Y;  3CC4 1;  3CCV 1;  2LFU A;  1NP6 A;  2R7Z I;  3QWU A;  2K3R A;  3F3F C;  3HOU I;  5D1O A;  5IT9 f;  1Y1V I;  5T6B A;  3CCL Z;  2QRE B;  3CC7 Z;  4NB9 A;  4A3M I;  3IFU A;  5LL6 f;  4BY7 I;  3CME Z;  4BBS I;  2E2J I;  1KRL A;  2JUB A;  5FLM I;  1WW9 A;  1YIJ 1;  3NH8 A;  4E33 A;  4RVF A;  4CL1 A;  4A3G I;  1YJ9 Z;  3NH4 A;  1DL6 A;  1JJ2 Y;  3PO3 S;  2K5R A;  3I56 Z;  3OW2 Y;  3D6W A;  2LIY A;  3S16 I;  1S72 Z;  1NJI 1;  1VQ9 1;  4A3F I;  5C4X I;  3CC2 Z;  3J81 b;  3TDH B;  2RIQ A;  1N2F A;  2IZ4 A;  3HOW I;  1S7M A;  2PMZ A;  3JAM f;  1VQM Z;  2NVX I;  1KQS Y;  1Z01 A;  1K83 I;  1NJI 2;  4S1T A;  1RO2 A;  4NB8 A;  1TWC I;  3MZL B;  1KC8 1;  2E2H I;  1I6H I;  5T64 A;  3FQM A;  1VQK Z;  4A93 I;  5C3E I;  2DE5 A;  4HGZ A;  3H0G I;  4MON A;  3J80 b;  4A3B I;  2E9H A;  3NDI A;  3T4N B;  3CXC Z;  4MXU A;  1TWF I;  4QTT A;  4RVH A;  1N8R 1;  4RV9 A;  1Q81 1;  3S14 I;  5C44 I;  1KC8 2;  1Z03 A;  2RBL A;  4NBC A;  2F4O A;  4E2X A;  3CCR 1;  1QVG Y;  4BY1 I;  1VQ7 1;  1Q86 1;  1YUK A;  3GCF A;  2NVQ I;  4NBD A;  1VQP Z;  3GTP I;  4NBF A;  4MD8 A;  5IP7 I;  1N8R 2;  2WB1 A;  1Q81 2;  3LUS A;  3NDJ A;  3CMA Z;  1ZH1 A;  3CCJ Z;  1TWG I;  2DE6 A;  2BJO A;  3PO2 I;  3I4M I;  2R6M A;  4RS4 A;  2WAQ A;  1Q86 2;  3G4S Z;  3EER A;  1VQL 1;  4HGY A;  3GKQ A;  4E2Z A;  1VQ8 1;  2OTJ 1;  2JA5 I;  3D9X A;  2JA7 I;  1Q7Y 1;  1M1K 1;  3CCM Z;  2DE7 A;  1QF8 A;  2QA4 1;  4A3D I;  3HOY I;  2W04 A;  2QRC B;  3CD6 Z;  2OTL Z;  4MD9 A;  3CC7 1;  2VUM I;  4QTU A;  1YJN 1;  1KD1 1;  3I55 1;  2QEX Z;  3CPW Z;  1K73 2;  1TFI A;  2Q4Z A;  2YAD A;  3CC4 Z;  2B63 I;  1QVF Y;  1Q7Y 2;  4A3K I;  1M1K 2;  1YHQ Z;  1ZB8 A;  4BBR I;  1RO4 A;  1TWH I;  3CCQ Z;  2KPI A;  3HOZ I;  1YI2 1;  1YIT 1;  1X3Z A;  3RZO I;  1YJW 1;  1VQN 1;  1VQ4 1;  4BXX I;  3RZD I;  3I07 A;  1YJ9 1;  2M6N A;  4XX2 A;  1RLY A;  2R92 I;  1KD1 2;  4E31 A;  4E2W A;  3JAM b;  2JR6 A;  3ESW A;  3NFZ A;  3S1N I;  2VUG A;  3G71 1;  1JJ2 Z;  3GTM S;  2KI7 B;  1VQ5 1;  4AYB A;  1I50 I;  1VQ9 Z;  5T67 A;  2IZ3 A;  2R93 I;  3HOV I;  1R9T I;  1RO0 A;  3S1M I;  4Y52 I;  1NUI A;  3CCS Z;  4NFR A;  1TWA I;  4DGL A;  1KQS Z;  1VQK 1;  2JNY A;  1ZB9 A;  1YUA A;  3VMH A;  1USP A;  2ZAE B;  3S1Q I;  5FLX b;  1VQO 1;  4E30 A;  3CQZ I;  3J7A 4;  1Y1V S;  4E2Y A;  1RQF A;  1WCM I;  4NBB A;  5FLX f;  4NBA A;  5A2Q b;  3GTK I;  1Q82 1;  2W03 A;  3S1R I;  3FQQ A;  2G2K A;  5A2Q f;  3CCU Z;  1W2B Y;  4NOZ A;  1X3W A;  3G6E 1;  4NBH A;  3PO3 I;  3S17 I;  2RPR A;  1PFT A;  1QVG Z;  5IP9 I;  4A3L I;  1VQ7 Z;  1VQ6 1;  2Y0S A;  4EWC A;  5D1O B;  2RHB A;  1Y1W I;  1X0T A;  4RVD A;  3CCE 1;  1K9M 1;  2JS4 A;  2E2I I;  3IX0 A;  3IF8 A;  4NH1 C;  3CCL 1;  3S15 I;  1WII A;  3CD6 1;  1VQ8 Z;  2F4M A;  3GTJ I;  2OZK A;  2OTL 1;  4DK1 A;  2P3Y A;  3M3Y I;  4MRI A;  4A3E I;  3Q87 A;  2J6A A;  3CCV Z;  2QEX 1;  1K9M 2;  3VTN A;  3CME 1;  3S2H I;  1YHQ 1;  3VB9 A;  2QA4 Z;  1Z02 A;  3CCQ 1;  2YU9 I;  2V8K A;  1JWH C;  4NBG A;  3GTG I;  1YJN Z;  4Y7N I;  3I55 Z;  3I56 1;  1QVF Z;  2Q51 A;  2V8J A;  1S72 1;  3VMG A;  1YIJ Z;  4NBE A;  1YI2 Z;  1YIT Z;  3CC2 1;  2PK7 A;  2QR1 B;  1YJW Z;  1VQN Z;  3EED A;  2P28 A;  1VQ4 Z;  3HKZ A;  3HOX I;  3OW2 Z;  1VQM 1;  1QYP A;  1RNI A;  2V8I A;  3VMI A;  4A3I I;  1USP B;  2I3C A;  3KIH A;  3BG0 B;  3BG1 B;  3MZK B;  1SFO I;  3G71 Z;  4A3J I;  3CCS 1;  1VQ5 Z;  2NVY I;  3F3P C;  2JA8 I;  1ML8 A;  3J81 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...