1NJI2

Structure of chloramphenicol bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nji200
1VQ81 1VQP1 1Q821 3CD6Z 3CCV1 3G6E1 3CC7Z 3CCU1 1VQN1 1YJW1 1QVFZ 2QEX1 3CXCZ 1M902 1VQ9Z 1YITZ 1VQL1 3CMEZ 3CCEZ 2QA4Z 1K8A2 1VQK1 1Q7Y2 1YJNZ 2OTJZ 3I56Z 1VQMZ 1YHQZ 3CCRZ 1KD12 3CCQZ 1NJI2 1YI21 1KQSY 1VQ5Z 1Q862 3I55Z 1K9M2 3CCMZ 1W2BY 1VQOZ 3CPWY 3CD61 1VQO1 3CC71 1VQ6Z 1M901 1VQ91 1YIJZ 1YIT1 1QVGZ 3CME1 3CC2Z 3CCLZ 3CCE1 1K732 3G71Z 1VQ7Z 3G4SZ 1YJ9Z 1N8R2 2QA41 3OW2Y 1K8A1 1Q7Y1 2OTLZ 1YJN1 1KC82 1VQ4Z 2OTJ1 3I561 1VQM1 1YHQ1 2OTL1 3CCR1 1KD11 3CCQ1 1NJI1 1VQ41 3CMAZ 1W2BZ 3CCSZ 1VQ51 1S72Z 3CCJZ 1Q861 3I551 3CCM1 1K9M1 3CCS1 3CC4Z 1Q812 1JJ2Y 1VQ8Z 1M1K2 1VQ61 1VQPZ 1YIJ1 1Q822 3CC21 3CCL1 3OW2Z 1M1K1 3G711 3G6EZ 3G4S1 3CCVZ 1YJ91 3CCUZ 1K731 1YJWZ 1N8R1 1VQ71 2QEXZ 1VQNZ 1KQSZ 1KC81 1VQLZ 1QVFY 3CXCY 3CMA1 3CPWZ 1VQKZ 1S721 3CCJ1 1QVGY 3CC41 1JJ2Z 1YI2Z 1Q811
chains in the Genus database with same CATH superfamily
1SIWA 4E2ZA 3GTJI 4MXUA 4A3GI 2IZ4A 3CCV1 2PK7A 3QWUA 1TWGI 1YJW1 1TFIA 3M3YI 1YITZ 4BY1I 1X0TA 1VQL1 1X3ZA 4EWCA 1RQFA 2O4HA 3S1MI 2QA4Z 2OOYB 3KIFA 3J7A4 2I3CA 2R92I 2JA5I 2NVXI 4BBRI 4E2YA 2LEXA 2GU2A 3I55Z 4A3II 1TWFI 5A2Qf 5C44I 2DE6A 4HGZA 1VQO1 4A3BI 2RT9A 2RIQA 4MONA 3ESWA 3HOZI 2QRDB 4A3FI 2RHBA 1M901 1I3QI 1YIJZ 4BY7I 2NVYI 4NBDA 3I07A 1VQ7Z 1N8R2 4Y52I 1ML8A 1K8A1 3KIHA 2AYDA 1YJN1 2JS4A 2OTJ1 3I561 1YHQ1 2OTL1 3CCR1 3CCQ1 2E9HA 2Y0SA 1W2BZ 3CCJZ 3CCM1 2P28A 3TE5B 3CCS1 2J6AA 3CC4Z 2E2II 4E33A 2E7ZA 1USPB 3F3FC 4AYBA 3F3PC 1TWAI 3NH4A 3FKII 5T64A 3OW2Z 3GTPI 2Q4ZA 1R9TI 1K731 3G6EZ 3G4S1 4HGYA 3BG1B 1JWHC 1AA6A 3S1QI 5D1OA 3I4MI 2R6MA 3D6WA 1ZB9A 1VQKZ 1Y8CA 4QTUA 1QVGY 1Z03A 3PO3S 3I4NI 3D9XA 4NB9A 3CQZI 3S1RI 3TDHB 4A3EI 3M4OI 2F4MA 1VQP1 1L1OC 4E30A 4S1TA 3CD6Z 5C4XI 2V45A 3S16I 3J81b 3GCFA 2AKLA 1M902 3S15I 1ZH1A 4NB8A 3CMEZ 2M48A 3CCEZ 3MONA 3HOUI 1K8A2 4RV9A 2M6NA 4RVHA 3GTKI 4NFRA 3IFUA 3D2LA 3RZOI 2HF1A 2VPXA 2BJOA 1KQSY 4TNUA 3IX0A 4DQYB 1W2BY 5C3EI 3MZKB 1TWHI 4CL1A 1WW9A 2G2KA 2V8IA 3J80b 2H85A 4NBFA 3NDJA 3CC71 1Y1VS 3VMGA 4A3DI 1VQ91 2EGTA 1QVGZ 2RBLA 1RNIA 1K732 3G71Z 2YU9I 3OW2Y 2VUMI 1VQM1 2WAQA 3JAMb 2R93I 1VQ51 1KRLA 2F4OA 4MD7A 1LQLA 3IF8A 1VQ61 2O53A 3PO3I 2WB1A 4RS4A 3CC21 2VF1A 3CCL1 1M1K1 5D1PA 3CCVZ 1YJ91 1YJWZ 1NUIA 1KQSZ 1Y1WI 4NBCA 1VQLZ 2KPIA 3S1NI 3CMA1 1RO2A 3NH5A 4X6AI 1WCMI 1FDIA 1S721 4NOZA 5FLXb 1JJ2Z 2P3YA 3VB9A 5D1OB 2LFUA 1Z01A 4QTTA 2VPYA 2E2JI 1WJ2A 1VQ81 2Q51A 1X3WA 3Q87A 5T6BA 3U50C 4E31A 3MZLB 3CCU1 1VQN1 2QEX1 3HOYI 4HH4A 3CXCZ 2LIYA 3VMHA 3H3VJ 1RO0A 2JNYA 4MH4A 3S2HI 2QLVB 1YJNZ 5T67A 1Y1VI 2OTJZ 3I56Z 1YHQZ 5CM2M 3CCRZ 3CCQZ 4NH1C 1YI21 2JIQA 3NFZA 1TWCI 2JMOA 3CCMZ 2JA7I 4NBBA 2YADA 3S17I 1P9NA 5IT9f 2QREB 3CPWY 3HKZA 4E2XA 3HOVI 3J81f 2OOXB 1QF8A 2OZKA 3BG0B 1I6HI 1YIT1 5IP7I 3G4SZ 2QA41 1Q7Y1 2RPRA 1NP6A 1VQ4Z 1KD11 1NJI1 4A3CI 1Q16A 1Q861 3I551 1K9M1 2JA8I 3NH8A 1WIIA 3J80f 2JA6I 3GTGI 3GTOI 2V8JA 1JJ2Y 3GKQA 2V3VA 4BBSI 1PFTA 1VQPZ 1YIJ1 2KI7B 3VTNA 3IR7A 5LL6f 2IV2X 1VQ71 2JIMA 2V8KA 3FQQA 1KC81 4E32A 3GTLI 2JIRA 3CXCY 3JAMf 3S14I 4Y7NI 3EERA 3CPWZ 1I50I 3S2DI 3HOXI 3CCJ1 4NBHA 3CC41 4RVFA 2E2HI 2W04A 5C4JI 4A3KI 1Q811 4A3JI 2QR1B 1FDOA 2QRCB 3GTMS 1Q821 5IP9I 2JR6A 2GTHA 5A2Qb 3G6E1 3CC7Z 3T4NB 2R7ZI 1QVFZ 4DK1A 1S7MA 4NBGA 3NDIA 4A3LI 2PMZA 2PM9A 3P5JB 1VQ9Z 2VUGA 2NAPA 3H0GI 3PO2I 1VQK1 1Z02A 1Q7Y2 4NBEA 5FLXf 1VQMZ 1KD12 1QYPA 1NJI2 1VQ5Z 1Q862 4BXXI 1K9M2 4MD8A 1VQOZ 4XX2A 4A93I 3CD61 1ZB8A 1VQ6Z 4A3MI 3CME1 4RVGA 2DE5A 2JIPA 3CC2Z 3CCLZ 2JUBA 3CCE1 2JIOA 1RO4A 1YJ9Z 4MRIA 2OTLZ 1WZNA 1KC82 1USPA 2W03A 4DGLA 1YUAA 1N2FA 1VQ41 3CMAZ 2B63I 2VPZA 3CCSZ 3LUSA 5AN9F 1S72Z 2NVQI 3GTQI 1YUKA 2QKDA 3FQMA 4E2WA 1Q812 2HU9A 1VQ8Z 3VMIA 3EEDA 1M1K2 2GTIA 4RVDA 4NBAA 1SFOI 1Q822 2DE7A 2K5RA 3G711 1N8R1 3CCUZ 1VQNZ 2QEXZ 1QXFA 5IT9b 2K3RA 5FLMI 3RZDI 1QVFY 4MD9A 3GTMI 2ZAEB 2IZ3A 3HOWI 2VPWA 1DL6A 1K83I 1VLAA 1RLYA 1YI2Z 2NVTI 3K7AI
chains in the Genus database with same CATH topology
4E2ZA 3GTJI 4MXUA 4A3GI 2IZ4A 3CCV1 2PK7A 3QWUA 1TWGI 1YJW1 1TFIA 3M3YI 1YITZ 4BY1I 1X0TA 1VQL1 1X3ZA 4EWCA 1RQFA 2O4HA 3S1MI 2QA4Z 2OOYB 3KIFA 3J7A4 2I3CA 2R92I 2JA5I 2NVXI 4BBRI 4E2YA 2GU2A 3I55Z 4A3II 1TWFI 5A2Qf 5C44I 2DE6A 4HGZA 1VQO1 4A3BI 2RT9A 2RIQA 4MONA 3ESWA 3HOZI 2QRDB 4A3FI 2RHBA 1M901 1I3QI 1YIJZ 4BY7I 2NVYI 4NBDA 3I07A 1VQ7Z 1N8R2 4Y52I 1ML8A 1K8A1 3KIHA 1YJN1 2JS4A 2OTJ1 3I561 1YHQ1 2OTL1 3CCR1 3CCQ1 2E9HA 2Y0SA 1W2BZ 3CCJZ 3CCM1 2P28A 3TE5B 3CCS1 2J6AA 3CC4Z 2E2II 4E33A 1USPB 3F3FC 4AYBA 3F3PC 1TWAI 3NH4A 3FKII 5T64A 3OW2Z 3GTPI 2Q4ZA 1R9TI 1K731 3G6EZ 3G4S1 4HGYA 3BG1B 1JWHC 3S1QI 5D1OA 3I4MI 2R6MA 3D6WA 1ZB9A 1VQKZ 4QTUA 1QVGY 1Z03A 3PO3S 3I4NI 3D9XA 4NB9A 3CQZI 3S1RI 3TDHB 4A3EI 3M4OI 2F4MA 1VQP1 1L1OC 4E30A 4S1TA 3CD6Z 5C4XI 3S16I 3J81b 3GCFA 2AKLA 1M902 3S15I 1ZH1A 4NB8A 3CMEZ 2M48A 3CCEZ 3MONA 3HOUI 1K8A2 4RV9A 2M6NA 4RVHA 3GTKI 4NFRA 3IFUA 3RZOI 2HF1A 2BJOA 1KQSY 4TNUA 3IX0A 4DQYB 1W2BY 5C3EI 3MZKB 1TWHI 4CL1A 1WW9A 2G2KA 2V8IA 3J80b 2H85A 4NBFA 3NDJA 3CC71 1Y1VS 3VMGA 4A3DI 1VQ91 2EGTA 1QVGZ 2RBLA 1RNIA 1K732 3G71Z 2YU9I 3OW2Y 2VUMI 1VQM1 2WAQA 3JAMb 2R93I 1VQ51 1KRLA 2F4OA 4MD7A 1LQLA 3IF8A 1VQ61 2O53A 3PO3I 2WB1A 4RS4A 3CC21 2VF1A 3CCL1 1M1K1 5D1PA 3CCVZ 1YJ91 1YJWZ 1NUIA 1KQSZ 1Y1WI 4NBCA 1VQLZ 2KPIA 3S1NI 3CMA1 1RO2A 3NH5A 4X6AI 1WCMI 1S721 4NOZA 5FLXb 1JJ2Z 2P3YA 3VB9A 5D1OB 2LFUA 1Z01A 4QTTA 2E2JI 1VQ81 2Q51A 1X3WA 3Q87A 5T6BA 3U50C 4E31A 3MZLB 3CCU1 1VQN1 2QEX1 3HOYI 4HH4A 3CXCZ 2LIYA 3VMHA 3H3VJ 1RO0A 2JNYA 4MH4A 3S2HI 2QLVB 1YJNZ 5T67A 1Y1VI 2OTJZ 3I56Z 1YHQZ 5CM2M 3CCRZ 3CCQZ 4NH1C 1YI21 3NFZA 1TWCI 2JMOA 3CCMZ 2JA7I 4NBBA 2YADA 3S17I 1P9NA 5IT9f 2QREB 3CPWY 3HKZA 4E2XA 3HOVI 3J81f 2OOXB 1QF8A 2OZKA 3BG0B 1I6HI 1YIT1 5IP7I 3G4SZ 2QA41 1Q7Y1 2RPRA 1NP6A 1VQ4Z 1KD11 1NJI1 4A3CI 1Q861 3I551 1K9M1 2JA8I 3NH8A 1WIIA 3J80f 2JA6I 3GTGI 3GTOI 2V8JA 1JJ2Y 3GKQA 4BBSI 1PFTA 1VQPZ 1YIJ1 2KI7B 3VTNA 5LL6f 1VQ71 2V8KA 3FQQA 1KC81 4E32A 3GTLI 3CXCY 3JAMf 3S14I 4Y7NI 3EERA 3CPWZ 1I50I 3S2DI 3HOXI 3CCJ1 4NBHA 3CC41 4RVFA 2E2HI 2W04A 5C4JI 4A3KI 1Q811 4A3JI 2QR1B 2QRCB 3GTMS 1Q821 5IP9I 2JR6A 2GTHA 5A2Qb 3G6E1 3CC7Z 3T4NB 2R7ZI 1QVFZ 4DK1A 1S7MA 4NBGA 3NDIA 4A3LI 2PMZA 2PM9A 3P5JB 1VQ9Z 2VUGA 3H0GI 3PO2I 1VQK1 1Z02A 1Q7Y2 4NBEA 5FLXf 1VQMZ 1KD12 1QYPA 1NJI2 1VQ5Z 1Q862 4BXXI 1K9M2 4MD8A 1VQOZ 4XX2A 4A93I 3CD61 1ZB8A 1VQ6Z 4A3MI 3CME1 4RVGA 2DE5A 3CC2Z 3CCLZ 2JUBA 3CCE1 1RO4A 1YJ9Z 4MRIA 2OTLZ 1KC82 1USPA 2W03A 4DGLA 1YUAA 1N2FA 1VQ41 3CMAZ 2B63I 3CCSZ 3LUSA 5AN9F 1S72Z 2NVQI 3GTQI 1YUKA 2QKDA 3FQMA 4E2WA 1Q812 2HU9A 1VQ8Z 3VMIA 3EEDA 1M1K2 2GTIA 4RVDA 4NBAA 1SFOI 1Q822 2DE7A 2K5RA 3G711 1N8R1 3CCUZ 1VQNZ 2QEXZ 5IT9b 2K3RA 5FLMI 3RZDI 1QVFY 4MD9A 3GTMI 2ZAEB 2IZ3A 3HOWI 1DL6A 1K83I 1VLAA 1RLYA 1YI2Z 2NVTI 3K7AI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ8 1;  1VQP 1;  1Q82 1;  3CD6 Z;  3CCV 1;  3G6E 1;  3CC7 Z;  3CCU 1;  1VQN 1;  1YJW 1;  1QVF Z;  2QEX 1;  3CXC Z;  1M90 2;  1VQ9 Z;  1YIT Z;  1VQL 1;  3CME Z;  3CCE Z;  2QA4 Z;  1K8A 2;  1VQK 1;  1Q7Y 2;  1YJN Z;  2OTJ Z;  3I56 Z;  1VQM Z;  1YHQ Z;  3CCR Z;  1KD1 2;  3CCQ Z;  1NJI 2;  1YI2 1;  1KQS Y;  1VQ5 Z;  1Q86 2;  3I55 Z;  1K9M 2;  3CCM Z;  1W2B Y;  1VQO Z;  3CPW Y;  3CD6 1;  1VQO 1;  3CC7 1;  1VQ6 Z;  1M90 1;  1VQ9 1;  1YIJ Z;  1YIT 1;  1QVG Z;  3CME 1;  3CC2 Z;  3CCL Z;  3CCE 1;  1K73 2;  3G71 Z;  1VQ7 Z;  3G4S Z;  1YJ9 Z;  1N8R 2;  2QA4 1;  3OW2 Y;  1K8A 1;  1Q7Y 1;  2OTL Z;  1YJN 1;  1KC8 2;  1VQ4 Z;  2OTJ 1;  3I56 1;  1VQM 1;  1YHQ 1;  2OTL 1;  3CCR 1;  1KD1 1;  3CCQ 1;  1NJI 1;  1VQ4 1;  3CMA Z;  1W2B Z;  3CCS Z;  1VQ5 1;  1S72 Z;  3CCJ Z;  1Q86 1;  3I55 1;  3CCM 1;  1K9M 1;  3CCS 1;  3CC4 Z;  1Q81 2;  1JJ2 Y;  1VQ8 Z;  1M1K 2;  1VQ6 1;  1VQP Z;  1YIJ 1;  1Q82 2;  3CC2 1;  3CCL 1;  3OW2 Z;  1M1K 1;  3G71 1;  3G6E Z;  3G4S 1;  3CCV Z;  1YJ9 1;  3CCU Z;  1K73 1;  1YJW Z;  1N8R 1;  1VQ7 1;  2QEX Z;  1VQN Z;  1KQS Z;  1KC8 1;  1VQL Z;  1QVF Y;  3CXC Y;  3CMA 1;  3CPW Z;  1VQK Z;  1S72 1;  3CCJ 1;  1QVG Y;  3CC4 1;  1JJ2 Z;  1YI2 Z;  1Q81 1; 
#chains in the Genus database with same CATH topology
 1SIW A;  4E2Z A;  3GTJ I;  4MXU A;  4A3G I;  2IZ4 A;  3CCV 1;  2PK7 A;  3QWU A;  1TWG I;  1YJW 1;  1TFI A;  3M3Y I;  1YIT Z;  4BY1 I;  1X0T A;  1VQL 1;  1X3Z A;  4EWC A;  1RQF A;  2O4H A;  3S1M I;  2QA4 Z;  2OOY B;  3KIF A;  3J7A 4;  2I3C A;  2R92 I;  2JA5 I;  2NVX I;  4BBR I;  4E2Y A;  2LEX A;  2GU2 A;  3I55 Z;  4A3I I;  1TWF I;  5A2Q f;  5C44 I;  2DE6 A;  4HGZ A;  1VQO 1;  4A3B I;  2RT9 A;  2RIQ A;  4MON A;  3ESW A;  3HOZ I;  2QRD B;  4A3F I;  2RHB A;  1M90 1;  1I3Q I;  1YIJ Z;  4BY7 I;  2NVY I;  4NBD A;  3I07 A;  1VQ7 Z;  1N8R 2;  4Y52 I;  1ML8 A;  1K8A 1;  3KIH A;  2AYD A;  1YJN 1;  2JS4 A;  2OTJ 1;  3I56 1;  1YHQ 1;  2OTL 1;  3CCR 1;  3CCQ 1;  2E9H A;  2Y0S A;  1W2B Z;  3CCJ Z;  3CCM 1;  2P28 A;  3TE5 B;  3CCS 1;  2J6A A;  3CC4 Z;  2E2I I;  4E33 A;  2E7Z A;  1USP B;  3F3F C;  4AYB A;  3F3P C;  1TWA I;  3NH4 A;  3FKI I;  5T64 A;  3OW2 Z;  3GTP I;  2Q4Z A;  1R9T I;  1K73 1;  3G6E Z;  3G4S 1;  4HGY A;  3BG1 B;  1JWH C;  1AA6 A;  3S1Q I;  5D1O A;  3I4M I;  2R6M A;  3D6W A;  1ZB9 A;  1VQK Z;  1Y8C A;  4QTU A;  1QVG Y;  1Z03 A;  3PO3 S;  3I4N I;  3D9X A;  4NB9 A;  3CQZ I;  3S1R I;  3TDH B;  4A3E I;  3M4O I;  2F4M A;  1VQP 1;  1L1O C;  4E30 A;  4S1T A;  3CD6 Z;  5C4X I;  2V45 A;  3S16 I;  3J81 b;  3GCF A;  2AKL A;  1M90 2;  3S15 I;  1ZH1 A;  4NB8 A;  3CME Z;  2M48 A;  3CCE Z;  3MON A;  3HOU I;  1K8A 2;  4RV9 A;  2M6N A;  4RVH A;  3GTK I;  4NFR A;  3IFU A;  3D2L A;  3RZO I;  2HF1 A;  2VPX A;  2BJO A;  1KQS Y;  4TNU A;  3IX0 A;  4DQY B;  1W2B Y;  5C3E I;  3MZK B;  1TWH I;  4CL1 A;  1WW9 A;  2G2K A;  2V8I A;  3J80 b;  2H85 A;  4NBF A;  3NDJ A;  3CC7 1;  1Y1V S;  3VMG A;  4A3D I;  1VQ9 1;  2EGT A;  1QVG Z;  2RBL A;  1RNI A;  1K73 2;  3G71 Z;  2YU9 I;  3OW2 Y;  2VUM I;  1VQM 1;  2WAQ A;  3JAM b;  2R93 I;  1VQ5 1;  1KRL A;  2F4O A;  4MD7 A;  1LQL A;  3IF8 A;  1VQ6 1;  2O53 A;  3PO3 I;  2WB1 A;  4RS4 A;  3CC2 1;  2VF1 A;  3CCL 1;  1M1K 1;  5D1P A;  3CCV Z;  1YJ9 1;  1YJW Z;  1NUI A;  1KQS Z;  1Y1W I;  4NBC A;  1VQL Z;  2KPI A;  3S1N I;  3CMA 1;  1RO2 A;  3NH5 A;  4X6A I;  1WCM I;  1FDI A;  1S72 1;  4NOZ A;  5FLX b;  1JJ2 Z;  2P3Y A;  3VB9 A;  5D1O B;  2LFU A;  1Z01 A;  4QTT A;  2VPY A;  2E2J I;  1WJ2 A;  1VQ8 1;  2Q51 A;  1X3W A;  3Q87 A;  5T6B A;  3U50 C;  4E31 A;  3MZL B;  3CCU 1;  1VQN 1;  2QEX 1;  3HOY I;  4HH4 A;  3CXC Z;  2LIY A;  3VMH A;  3H3V J;  1RO0 A;  2JNY A;  4MH4 A;  3S2H I;  2QLV B;  1YJN Z;  5T67 A;  1Y1V I;  2OTJ Z;  3I56 Z;  1YHQ Z;  5CM2 M;  3CCR Z;  3CCQ Z;  4NH1 C;  1YI2 1;  2JIQ A;  3NFZ A;  1TWC I;  2JMO A;  3CCM Z;  2JA7 I;  4NBB A;  2YAD A;  3S17 I;  1P9N A;  5IT9 f;  2QRE B;  3CPW Y;  3HKZ A;  4E2X A;  3HOV I;  3J81 f;  2OOX B;  1QF8 A;  2OZK A;  3BG0 B;  1I6H I;  1YIT 1;  5IP7 I;  3G4S Z;  2QA4 1;  1Q7Y 1;  2RPR A;  1NP6 A;  1VQ4 Z;  1KD1 1;  1NJI 1;  4A3C I;  1Q16 A;  1Q86 1;  3I55 1;  1K9M 1;  2JA8 I;  3NH8 A;  1WII A;  3J80 f;  2JA6 I;  3GTG I;  3GTO I;  2V8J A;  1JJ2 Y;  3GKQ A;  2V3V A;  4BBS I;  1PFT A;  1VQP Z;  1YIJ 1;  2KI7 B;  3VTN A;  3IR7 A;  5LL6 f;  2IV2 X;  1VQ7 1;  2JIM A;  2V8K A;  3FQQ A;  1KC8 1;  4E32 A;  3GTL I;  2JIR A;  3CXC Y;  3JAM f;  3S14 I;  4Y7N I;  3EER A;  3CPW Z;  1I50 I;  3S2D I;  3HOX I;  3CCJ 1;  4NBH A;  3CC4 1;  4RVF A;  2E2H I;  2W04 A;  5C4J I;  4A3K I;  1Q81 1;  4A3J I;  2QR1 B;  1FDO A;  2QRC B;  3GTM S;  1Q82 1;  5IP9 I;  2JR6 A;  2GTH A;  5A2Q b;  3G6E 1;  3CC7 Z;  3T4N B;  2R7Z I;  1QVF Z;  4DK1 A;  1S7M A;  4NBG A;  3NDI A;  4A3L I;  2PMZ A;  2PM9 A;  3P5J B;  1VQ9 Z;  2VUG A;  2NAP A;  3H0G I;  3PO2 I;  1VQK 1;  1Z02 A;  1Q7Y 2;  4NBE A;  5FLX f;  1VQM Z;  1KD1 2;  1QYP A;  1NJI 2;  1VQ5 Z;  1Q86 2;  4BXX I;  1K9M 2;  4MD8 A;  1VQO Z;  4XX2 A;  4A93 I;  3CD6 1;  1ZB8 A;  1VQ6 Z;  4A3M I;  3CME 1;  4RVG A;  2DE5 A;  2JIP A;  3CC2 Z;  3CCL Z;  2JUB A;  3CCE 1;  2JIO A;  1RO4 A;  1YJ9 Z;  4MRI A;  2OTL Z;  1WZN A;  1KC8 2;  1USP A;  2W03 A;  4DGL A;  1YUA A;  1N2F A;  1VQ4 1;  3CMA Z;  2B63 I;  2VPZ A;  3CCS Z;  3LUS A;  5AN9 F;  1S72 Z;  2NVQ I;  3GTQ I;  1YUK A;  2QKD A;  3FQM A;  4E2W A;  1Q81 2;  2HU9 A;  1VQ8 Z;  3VMI A;  3EED A;  1M1K 2;  2GTI A;  4RVD A;  4NBA A;  1SFO I;  1Q82 2;  2DE7 A;  2K5R A;  3G71 1;  1N8R 1;  3CCU Z;  1VQN Z;  2QEX Z;  1QXF A;  5IT9 b;  2K3R A;  5FLM I;  3RZD I;  1QVF Y;  4MD9 A;  3GTM I;  2ZAE B;  2IZ3 A;  3HOW I;  2VPW A;  1DL6 A;  1K83 I;  1VLA A;  1RLY A;  1YI2 Z;  2NVT I;  3K7A I; 
#chains in the Genus database with same CATH homology
 4E2Z A;  3GTJ I;  4MXU A;  4A3G I;  2IZ4 A;  3CCV 1;  2PK7 A;  3QWU A;  1TWG I;  1YJW 1;  1TFI A;  3M3Y I;  1YIT Z;  4BY1 I;  1X0T A;  1VQL 1;  1X3Z A;  4EWC A;  1RQF A;  2O4H A;  3S1M I;  2QA4 Z;  2OOY B;  3KIF A;  3J7A 4;  2I3C A;  2R92 I;  2JA5 I;  2NVX I;  4BBR I;  4E2Y A;  2GU2 A;  3I55 Z;  4A3I I;  1TWF I;  5A2Q f;  5C44 I;  2DE6 A;  4HGZ A;  1VQO 1;  4A3B I;  2RT9 A;  2RIQ A;  4MON A;  3ESW A;  3HOZ I;  2QRD B;  4A3F I;  2RHB A;  1M90 1;  1I3Q I;  1YIJ Z;  4BY7 I;  2NVY I;  4NBD A;  3I07 A;  1VQ7 Z;  1N8R 2;  4Y52 I;  1ML8 A;  1K8A 1;  3KIH A;  1YJN 1;  2JS4 A;  2OTJ 1;  3I56 1;  1YHQ 1;  2OTL 1;  3CCR 1;  3CCQ 1;  2E9H A;  2Y0S A;  1W2B Z;  3CCJ Z;  3CCM 1;  2P28 A;  3TE5 B;  3CCS 1;  2J6A A;  3CC4 Z;  2E2I I;  4E33 A;  1USP B;  3F3F C;  4AYB A;  3F3P C;  1TWA I;  3NH4 A;  3FKI I;  5T64 A;  3OW2 Z;  3GTP I;  2Q4Z A;  1R9T I;  1K73 1;  3G6E Z;  3G4S 1;  4HGY A;  3BG1 B;  1JWH C;  3S1Q I;  5D1O A;  3I4M I;  2R6M A;  3D6W A;  1ZB9 A;  1VQK Z;  4QTU A;  1QVG Y;  1Z03 A;  3PO3 S;  3I4N I;  3D9X A;  4NB9 A;  3CQZ I;  3S1R I;  3TDH B;  4A3E I;  3M4O I;  2F4M A;  1VQP 1;  1L1O C;  4E30 A;  4S1T A;  3CD6 Z;  5C4X I;  3S16 I;  3J81 b;  3GCF A;  2AKL A;  1M90 2;  3S15 I;  1ZH1 A;  4NB8 A;  3CME Z;  2M48 A;  3CCE Z;  3MON A;  3HOU I;  1K8A 2;  4RV9 A;  2M6N A;  4RVH A;  3GTK I;  4NFR A;  3IFU A;  3RZO I;  2HF1 A;  2BJO A;  1KQS Y;  4TNU A;  3IX0 A;  4DQY B;  1W2B Y;  5C3E I;  3MZK B;  1TWH I;  4CL1 A;  1WW9 A;  2G2K A;  2V8I A;  3J80 b;  2H85 A;  4NBF A;  3NDJ A;  3CC7 1;  1Y1V S;  3VMG A;  4A3D I;  1VQ9 1;  2EGT A;  1QVG Z;  2RBL A;  1RNI A;  1K73 2;  3G71 Z;  2YU9 I;  3OW2 Y;  2VUM I;  1VQM 1;  2WAQ A;  3JAM b;  2R93 I;  1VQ5 1;  1KRL A;  2F4O A;  4MD7 A;  1LQL A;  3IF8 A;  1VQ6 1;  2O53 A;  3PO3 I;  2WB1 A;  4RS4 A;  3CC2 1;  2VF1 A;  3CCL 1;  1M1K 1;  5D1P A;  3CCV Z;  1YJ9 1;  1YJW Z;  1NUI A;  1KQS Z;  1Y1W I;  4NBC A;  1VQL Z;  2KPI A;  3S1N I;  3CMA 1;  1RO2 A;  3NH5 A;  4X6A I;  1WCM I;  1S72 1;  4NOZ A;  5FLX b;  1JJ2 Z;  2P3Y A;  3VB9 A;  5D1O B;  2LFU A;  1Z01 A;  4QTT A;  2E2J I;  1VQ8 1;  2Q51 A;  1X3W A;  3Q87 A;  5T6B A;  3U50 C;  4E31 A;  3MZL B;  3CCU 1;  1VQN 1;  2QEX 1;  3HOY I;  4HH4 A;  3CXC Z;  2LIY A;  3VMH A;  3H3V J;  1RO0 A;  2JNY A;  4MH4 A;  3S2H I;  2QLV B;  1YJN Z;  5T67 A;  1Y1V I;  2OTJ Z;  3I56 Z;  1YHQ Z;  5CM2 M;  3CCR Z;  3CCQ Z;  4NH1 C;  1YI2 1;  3NFZ A;  1TWC I;  2JMO A;  3CCM Z;  2JA7 I;  4NBB A;  2YAD A;  3S17 I;  1P9N A;  5IT9 f;  2QRE B;  3CPW Y;  3HKZ A;  4E2X A;  3HOV I;  3J81 f;  2OOX B;  1QF8 A;  2OZK A;  3BG0 B;  1I6H I;  1YIT 1;  5IP7 I;  3G4S Z;  2QA4 1;  1Q7Y 1;  2RPR A;  1NP6 A;  1VQ4 Z;  1KD1 1;  1NJI 1;  4A3C I;  1Q86 1;  3I55 1;  1K9M 1;  2JA8 I;  3NH8 A;  1WII A;  3J80 f;  2JA6 I;  3GTG I;  3GTO I;  2V8J A;  1JJ2 Y;  3GKQ A;  4BBS I;  1PFT A;  1VQP Z;  1YIJ 1;  2KI7 B;  3VTN A;  5LL6 f;  1VQ7 1;  2V8K A;  3FQQ A;  1KC8 1;  4E32 A;  3GTL I;  3CXC Y;  3JAM f;  3S14 I;  4Y7N I;  3EER A;  3CPW Z;  1I50 I;  3S2D I;  3HOX I;  3CCJ 1;  4NBH A;  3CC4 1;  4RVF A;  2E2H I;  2W04 A;  5C4J I;  4A3K I;  1Q81 1;  4A3J I;  2QR1 B;  2QRC B;  3GTM S;  1Q82 1;  5IP9 I;  2JR6 A;  2GTH A;  5A2Q b;  3G6E 1;  3CC7 Z;  3T4N B;  2R7Z I;  1QVF Z;  4DK1 A;  1S7M A;  4NBG A;  3NDI A;  4A3L I;  2PMZ A;  2PM9 A;  3P5J B;  1VQ9 Z;  2VUG A;  3H0G I;  3PO2 I;  1VQK 1;  1Z02 A;  1Q7Y 2;  4NBE A;  5FLX f;  1VQM Z;  1KD1 2;  1QYP A;  1NJI 2;  1VQ5 Z;  1Q86 2;  4BXX I;  1K9M 2;  4MD8 A;  1VQO Z;  4XX2 A;  4A93 I;  3CD6 1;  1ZB8 A;  1VQ6 Z;  4A3M I;  3CME 1;  4RVG A;  2DE5 A;  3CC2 Z;  3CCL Z;  2JUB A;  3CCE 1;  1RO4 A;  1YJ9 Z;  4MRI A;  2OTL Z;  1KC8 2;  1USP A;  2W03 A;  4DGL A;  1YUA A;  1N2F A;  1VQ4 1;  3CMA Z;  2B63 I;  3CCS Z;  3LUS A;  5AN9 F;  1S72 Z;  2NVQ I;  3GTQ I;  1YUK A;  2QKD A;  3FQM A;  4E2W A;  1Q81 2;  2HU9 A;  1VQ8 Z;  3VMI A;  3EED A;  1M1K 2;  2GTI A;  4RVD A;  4NBA A;  1SFO I;  1Q82 2;  2DE7 A;  2K5R A;  3G71 1;  1N8R 1;  3CCU Z;  1VQN Z;  2QEX Z;  5IT9 b;  2K3R A;  5FLM I;  3RZD I;  1QVF Y;  4MD9 A;  3GTM I;  2ZAE B;  2IZ3 A;  3HOW I;  1DL6 A;  1K83 I;  1VLA A;  1RLY A;  1YI2 Z;  2NVT I;  3K7A I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...