2O4HA

Human brain aspartoacylase complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
b'HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o4hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o4hA01
2C1CA 1CG2A 3WC7A 3PBEA 5HVHA 2O53A 1R43A 3JRUA 1AYEA 1TKHA 3RAMA 3BHXA 3KQXA 1BPNA 4NGRA 4BD9A 2ABZA 1XBUA 3CPAA 4LQGA 3KI9A 2IQ6A 5JM6A 3RZAA 2PCUA 2PRQA 1TXRA 3WC6A 5D29A 1BLLE 4H2KA 4WJBA 2ZEEA 1YSJA 4WWVA 5HXDA 3VH9A 2PJ0A 3VARA 3RBUA 4NGMA 4OC4A 4PXCA 3PB9X 2PJ9A 2AFXA 2ZEFA 1Z8LA 4OMEA 2GLJA 2OR4A 1CPSA 1F2PA 3B2YA 3FECA 2PJAA 3B3VA 3N5FA 4MCSA 6CPAA 1VIXA 2F7VA 3SJEA 1RTQA 4OC5A 1BPMA 1Z5RA 3B7IA 1ELLP 4UEZA 3I1UA 2ZEDA 3BI0A 5LYFA 3IO1A 1LFWA 3K9TA 2PIZA 3FH4A 2ZEPA 8CPAA 1TKJA 2AFMA 3SJXA 2C6PA 4MCRA 4MHYA 1TF8A 1XRYA 2POKA 3H8FA 4KSIA 2IMOA 2PVVA 3KL9A 2V8VA 2QJ8A 4X3RA 4R6TA 1YW4A 1DTDA 5LYDA 3IJ3A 2JBKA 3B35A 3FVLA 4P4BA 2ZOGA 5CBMA 1YLOA 4JYWA 2VL1A 1Y7EA 2V8HA 2J9AA 4NGQA 4OC0A 4EWTA 5HVGA 5THWA 3T8WA 4DJLA 3NH8A 3D66A 1FNOA 2GREA 3PBBA 5J1QA 2ZOFA 1LOKA 1IGBA 3FF3A 4TNUA 4PQAA 2EK9A 2PVWA 2C6CA 4ZX8A 1EE3P 3D67A 4AXVA 2BCOA 4NJQA 4O23A 2HC9A 3DGVA 1F2OA 4FUUA 3VATA 3DLJA 3KHXA 5LRKA 4R7MA 3WT4A 3PRTA 4A94A 3H8GA 3KZWA 1XFOA 2PJ1A 3IFEA 3CT9A 1PYTB 2EK8A 2RB7A 3IWWA 2ZELA 4ONWA 3KR5A 2QYVA 2GLFA 5HVFA 3B3SA 3QNVA 2HB6A 1VGYA 3CDXA 4K3NA 1LAPA 2JEWA 3IIBA 1CPXA 4B6ZA 7CPAA 4NJRA 4FAIA 3HUVA 4NFRA 4IAVA 5JGFA 1LANA 2PE3A 2ZENA 1UWYA 4F9VA 3LMSA 2AFWA 2PIYA 5JH9A 3MRUA 3IC1A 3NFZA 4P6YA 2C6GA 4ZX9A 1ZLHA 2XEFA 4UEEA 4DYOA 3KASA 2I3CA 4P44A 1OBRA 3PFOA 4OC2A 3S9LA 5LYLA 4DUKA 4A39A 3NH5A 3PEIA 4MHNA 4MMOA 4P4IA 4YWYA 5K8PA 4ZY2A 3HLPA 1M4LA 2PJ3A 2XEIA 1CBXA 4ZY1A 4G1PA 3FMCA 1H8LA 4OC1A 1R3NA 2PJBA 5K8NA 2DEAA 3IEHA 3B3WA 2XEGA 2CTCA 1YMEA 1HEEA 2PJ5A 2EWBA 3CPXA 1TF9A 3GB0A 1ARMA 1ZLIA 5F09A 3B3TA 5K8MA 3FX6A 4UIAA 2Q4ZA 2WZNA 3GLJA 4RUHA 3KQZA 3V7ZA 3PB4X 3V38A 4R8FA 3SI2A 3TC8A 4X8IA 3H8EA 4ZYQA 2Q51A 1BAVA 4P4JA 1CP7A 4UF4A 2AFUA 4EFDA 1IY7A 3FEDA 2PJ7A 3KGQA 4NGSA 3PB6X 5D8NA 2V77A 5LYIA 3S9MA 1XJOA 3TX8A 1F57A 4P10A 3FEEA 1LAMA 1QQ9A 2FVGA 2V8GA 1ZG8A 2AFOA 3BXMA 4OIDA 3PFEA 4IK2A 4ZI6A 4NGTA 4F9UA 4YU9A 4W9YA 2V8DA 1JQGA 2CTBA 2PJ4A 4A38A 1GYTA 3SJGA 1ZG7A 2JBJA 4Z65A 3PB7X 1YW6A 1VHEA 1Y0YA 4FBEA 4MXUA 5ELYA 4PXDA 2ZEMA 4P4EA 3ISZA 1CX8A 5CPAA 3KHZA 1VHOA 4UEFA 3FJUA 4TWEA 3SI0A 4FWUA 4P4FA 4PPZA 4ZY0A 4OIWA 1XMBA 4IHMA 5IB9A 4X2TA 1ELMP 5I4MA 1KWMA 4MHPA 2F8HA 3D4UA 3D7GA 3ISXA 1Q7LA 4MCPA 4MCQA 5LRGA 4P45A 5LRJA 4F8ZA 4JZ0A 2ZEGA 3D68A 3PB8X 2CIJA 2ZEOA 4PXBA 1TKFA 3D7DA 2AFSA 1Y0RA 4A37A 2Q43A 2XEJA 3B3CA 2CF4A 1DE4C 3GUXA 4R76A 4OKOA 1HDQA 3D7FA 3MN8A 2GU2A 3SI1A 1CP6A 2BOAA 2WYRA 4CPAA 3NH4A 3WC5A 1QMUA 1Z2LA 4OC3A 3WABA 2OOTA 1LCPA 4PXEA 4MRIA 4NGPA 3L2NA 3K2KA 2O4HA 1AMPA 1HDUA 2AFZA 2BO9A 2NSMA 4P4DA 3KR4A 1ARLA 3NA6A 2NYQA 4NGNA 1PCAA 1NSAA 2PJ6A 3BI1A 3S9NA 1ZG9A 5DS0A 4Q7AA 2QVPA 2PJCA 4UIBA 2PJ8A 2IJZA 4MHZA 2PJ2A 3D7HA 5K8OA 2ANPA 4GM5A 3SJFA 2G9DA 3LWUA 4OP4A 4EMEA 1FT7A 2RFHA 2ZEHA
chains in the Genus database with same CATH superfamily
2C1CA 1CG2A 5T6BA 4C7HA 1VQP1 2JS4A 3JRUA 3CCQ1 1TKHA 2ATRA 1X3ZA 4CGPA 4NGRA 3G711 2ABZA 3LUSA 1YJW1 3CCSZ 4F0XA 3FKII 2W03A 1SIWA 3VH9A 3S1RI 1Q821 4NGMA 4OC4A 4LQ6A 1YHQZ 2JDDA 4OLLA 2P6EA 2GLJA 2OR4A 1JWQA 2F7VA 1P4NA 3I1UA 4RI1A 2OH1A 1LFWA 4JJXA 3EXNA 2FIAA 3GTGI 2AFMA 4MD9A 2PVVA 3I9SA 4BBHA 1KZFA 2CNSA 1Q861 1VQLZ 2E2II 2B5GA 3A9LA 1YW4A 2AYDA 1DTDA 5LYDA 1Q7Y2 2OB0A 1RQFA 1QYPA 2JBKA 4P4BA 1YLOA 3SHPA 2WSAA 4JYWA 3EO4A 4XX2A 5I0CA 4MH4A 4A3LI 3N7ZA 5THWA 3K7AI 5LL6f 4DJLA 1X0TA 5C3EI 5J1QA 4RS4A 4RVDA 1IGBA 2EK9A 4YFJA 3KKWA 4A3FI 1B6BA 2BCOA 4O23A 1IOIA 4FUUA 1NUIA 3KHXA 5LRKA 2BEIA 1QSRA 2PJ1A 2BJOA 2YGWA 1PYTB 2RB7A 1VQ4Z 4ONWA 3KR5A 2QYVA 2WPWA 3B3SA 4A93I 1L1OC 1VGYA 3C26A 3CDXA 1LAPA 2JEWA 3VMGA 4B6ZA 1Y7RA 4NJRA 3CMA1 2ARHA 2R1IA 5JGFA 4MD8A 1LANA 2ZENA 3T90A 4HKFA 4KS9A 1UWYA 1MJBA 2VQYA 3MRUA 4P6YA 2C6GA 1ZLHA 4NBGA 1VQ8Z 2QR1B 2Q4VA 3OW2Z 1WCMI 4NBEA 2JEVA 4QC6A 2JIPA 3NH5A 1TWGI 3JTKA 4XNHC 4P4IA 2ZXVA 4J3GA 1QSMA 2XEIA 1S5KA 1CBXA 2PM9A 4ZY1A 4G1PA 4QUSA 4FD6A 3FMCA 3EY5A 3S2DI 2DE7A 1WW9A 2XEGA 3CCM1 2PJ5A 2WAQA 3IX0A 3BJ8A 1Q822 4PV6A 3GB0A 1ARMA 1CJWA 4PSWA 4NBFA 1VQ91 1P9NA 1LRZA 2QEX1 2Q4ZA 3GLJA 4R57A 4CS0B 1YJNZ 4RUHA 1WK4A 3F0AA 1IYLA 1IYKA 1RXTA 3CZXA 3CQZI 3CC4Z 1YREA 1Y1VS 1NMTA 2B4DB 3SI2A 3TC8A 3TCVA 3S14I 3Q87A 4P4JA 1M1K1 1S7FA 2GANA 3NE7A 4EFDA 3W6XA 1N71A 3FEDA 1YITZ 3CCE1 4NGSA 1S3ZA 1UFHA 2F4OA 4HGZA 1TWAI 5C44I 2P28A 1XEBA 4KOUA 1W2BY 5F49A 4NSQA 1ZG8A 1V0CA 4OIDA 2OTL1 3PFEA 4ZI6A 5JPHA 4NGTA 4W9YA 1JQGA 2PJ4A 3HOWI 3CCR1 3CCLZ 1GYTA 1ZG7A 2QA41 3PB7X 2ZW5A 1L0CA 1VHEA 1Y0YA 4PXDA 4CGNA 1YIJZ 1CX8A 5CPAA 4B11A 3ZZIA 2FL4A 2OOXB 3FJUA 3PP9A 3S6FA 3GKRA 1S7NA 2R8VA 4X2TA 4JD6A 1ON0A 1VLAA 3QWUA 2ZW6A 4MHPA 4NBBA 4NOZA 5T64A 3S6GA 4ZGYB 2OTJ1 2YNCC 4RVHA 4AG7A 2P6FA 3T4NB 4P45A 1NJI1 1X3WA 5AG6A 1I12A 2ZEOA 3LD2A 3FXTA 2XEJA 4Q38A 1HDQA 3FYNA 4BINA 3I55Z 1ZB8A 2BOAA 2AJ6A 1I3QI 4CPAA 3F5BA 1Z2LA 2OOTA 1LCPA 4PXEA 2E2HI 3L2NA 1HDUA 2BO9A 1ARLA 3FRMA 4A3KI 3HOUI 2G2KA 1KUXA 1KD11 4A3GI 1QVGY 1ZG9A 5CM2M 4QTTA 5DS0A 2O28A 2IV2X 3PO2I 1PU9A 4MHZA 2PJ2A 4E2WA 3D7HA 3TO6A 5IB0A 2ANPA 2PQ8A 4GM5A 1Z9UA 1VKCA 1S60A 1ML8A 4A95A 2QECA 1U6MA 3QAHA 3G3SA 4U5YA 4AYBA 2HF1A 4KORA 5C82A 3LACA 5HVHA 2JIQA 4UFXA 1AYEA 4KOSA 2E9HA 4MFKA 2C27A 1BPNA 1Y8CA 4ZBGA 1M1K2 3CPAA 1Q812 3KI9A 1K9M1 1VQ61 1USPA 2VZZA 1IOFA 4IF5A 3FIXA 2B5GB 2ZEEA 4WWVA 1QSNA 4YGOA 2PJ0A 3VARA 1JWHC 2DE6A 4C2XA 4RN7A 3B8GA 2HUZA 3DDDA 3RO0A 2PJ9A 2YNDA 3JVNA 3TE5B 1YI2Z 1CM0A 3FECA 1WJ2A 2PJAA 4L89A 6CPAA 3R95A 4MHDA 4OC5A 1BPMA 3B7IA 4RV9A 3I4NI 2R7ZI 5LYFA 3TOBA 3FH4A 1M44A 8CPAA 1RO0A 1AUGA 3KIFA 1Z01A 4MCRA 4MHYA 1XRYA 4M6GA 3KL9A 4CL1A 2V8VA 4MFQA 1A2ZA 3R96A 2AKLA 3CCUZ 5C4XI 5D1PA 4MI4A 3IJ3A 3B35A 5DWNA 5CBMA 4NBCA 2ZAEB 1VQ81 4NGQA 3WR7A 2Z11A 4R87A 4EWTA 5HVGA 3T8WA 2G3AA 3D66A 5F47A 3PBBA 2JA8I 4NBAA 2ZOFA 1NJI2 5G1ZA 2PVWA 1NP6A 3D67A 4NJQA 2HC9A 5G21A 3DGVA 1F2OA 3K9UA 3VATA 4HNYB 5CNPA 3WT4A 3PRTA 4A94A 3U50C 2EO8A 4ONUA 4HGYA 3KZWA 1XFOA 3D3SA 4IUSA 3IU2A 1KQSZ 1K83I 2ZELA 3PGPA 4UCNA 2GLFA 3QB8A 2V3VA 5HVFA 1YLEA 1QSTA 1Z8WA 3QNVA 3JAMf 4QBJA 4CGOA 3EC4A 1KD12 2DF5A 3S1MI 2VPZA 1PUAA 4FAIA 3HUVA 1WIIA 2EGTA 2HQYA 2OZKA 3S16I 4GS4A 1ZB9A 2PIYA 3IC1A 4UEEA 3TOAA 4JLYA 3CXSA 2BSWA 4OADA 1VHSA 1Q16A 3NDIA 2PDOA 1X12A 5K8PA 4ZY2A 3S6HA 1M4LA 2PJ3A 3R1KA 1TWCI 2M48A 1Z02A 1M4DA 1K731 3FB3A 4BY7I 1K9M2 1H8LA 4UWIA 1XIXA 1R3NA 3CC71 3I56Z 2Q7BA 3CCVZ 2CTCA 3CD6Z 1YMEA 1HEEA 3DSBA 4PK3A 2JMOA 1ZLIA 5F09A 3CC2Z 3ZJ0A 3GCFA 3KQZA 1S72Z 3IU1A 3W6SA 3PB4X 5T67A 1YIJ1 3V38A 3CCJZ 4KOVA 1I21A 2JLMA 5JQ4A 4ZYQA 5IV0A 1BAVA 2QLVB 4B10A 1YQEA 5FLXb 5G20A 5DWMA 1IICA 1CP7A 4XPDB 1Z8TA 1KUVA 1VQOZ 1VQNZ 4UF4A 2AFUA 5H84A 1IIDA 4MD7A 3G4SZ 3GYAA 4E33A 3PB6X 1YJ9Z 2DPSA 5D8NA 3CMEZ 2HV2A 4MFZA 3DNSA 2NVQI 3TX8A 2R98A 4NF1A 1QF8A 1Z03A 2VXKA 2KCWA 2EVNA 1W2BZ 1VQ5Z 4A2ZA 2V8DA 5FVJA 1JJ2Z 5D1OA 4A3CI 4UFWA 2VPXA 4E31A 3SJGA 2JBJA 1YW6A 4KLWA 1Y9WA 5ELYA 2YU9I 1TWHI 5AG5A 4FWUA 3GIUA 3HOZI 4P4FA 4IHMA 4R3LA 1RO5A 2GTIA 4KOXA 3HOVI 2F8HA 3D4UA 4AVCA 1Q7LA 3TE4A 2Q04A 1Y1WI 4AB7A 1VQMZ 4A30A 4NEXA 2B4BA 4FD4A 3PB8X 1VQ7Z 5IP7I 2IL4A 3D7DA 2B63I 2AFSA 5IP9I 4A37A 3VWEA 3FQQA 4KUBA 3CXCY 2DE5A 2LIYA 3D2MA 1Y1VI 1FDOA 2F4MA 1VQPZ 4HNXB 4QB9A 1Y9KA 2VEZA 2WYRA 4KVOE 3NH4A 3WC5A 3CCQZ 4OC3A 4MRIA 3G71Z 3K2KA 1YI21 1YJWZ 2GFQA 1MJAA 3V8IA 4A33A 1K732 4MFPA 2PJ6A 1Q862 1YVKA 2VF1A 4NCZA 1PFTA 5A27A 2V45A 4E0AA 1GHEA 2JIMA 2Y0MA 2QVPA 1I50I 1VQK1 2PRBA 1XE4A 2V8IA 3CXPA 2QRDB 5KTCA 2P3YA 4OP4A 3R9GA 1RO2A 4EMEA 3H5ZA 3HOYI 2H5MA 2A4NA 4NBDA 3PBEA 2VUMI 2O53A 3RAMA 3KQXA 2J8RA 2R7HA 4BD9A 1XBUA 5JM6A 4Q36A 2BUEA 2PCUA 2PRQA 5GCNA 4RVFA 3P2FA 3BG1B 3WC6A 5D29A 1BLLE 3TO7A 2NVYI 1KUYA 2NAPA 4PXCA 4KOTA 4RVGA 3PB9X 5AG4A 3MZKB 3OW2Y 3IWGA 3JAMb 2AFXA 3G6E1 1Z8LA 4U9ZA 4OMEA 1CPSA 4KOYA 3N5FA 4Y49B 1RTQA 1ELLP 4UEZA 4E2AA 3BJ7A 2REFA 3IO1A 3K9TA 4A3JI 1M1DA 2H85A 2GE3A 4C2ZA 4KVME 2X7BA 3OWCA 3CCS1 3H8FA 2IMOA 5FLXf 2QJ8A 4R6TA 2FE7A 4EWCA 2Q7SA 4NXYA 2G3TA 3FVLA 3TDHB 4XPKA 2VL1A 1Y7EA 2ZW4A 2VPWA 1YHQ1 2V8HA 2J9AA 3PZJA 3UY5A 2FSRA 4XPDC 4BMHA 3W91A 3CMAZ 4H6UA 4LX9A 1LOKA 2LEXA 3RNZA 2OZHA 4TNUA 4PQAA 5F46A 3I4MI 2C6CA 2CNMA 4E2XA 4ZX8A 2Z3KA 4AXVA 2RPRA 3CPWY 2QIRA 1BOBA 1VQL1 3VB9A 2PSWA 1NSLA 1FY7A 2F5IA 3ESWA 3RZDI 2EK8A 3MGDA 3CC21 3J7A4 2B3UA 4CGMA 2QKDA 3F8KA 1YX0A 4KLVA 4NFRA 1Z4RA 1KC81 2PE3A 4KSFA 4MFJA 3TT2A 3CCMZ 2Z3NA 4F9VA 1BO4A 3LMSA 1N8R1 3J80f 4M3SA 2XEFA 4DYOA 1VQ9Z 2I3CA 1OBRA 2QEXZ 2FIWA 3EERA 4OC2A 2JA5I 5LYLA 4DK1A 4K30A 1AA6A 4B5OA 2Z3OA 2CXAA 4MHNA 4YWYA 4A3II 4CYOA 1VQ41 3VWDA 1M901 4OAEA 4HNWB 2PK7A 2WPXA 4B13A 3KIHA 4KVXA 5K8NA 2DEAA 3IEHA 3CCEZ 2YNEA 5IT9b 1XF8A 2EWBA 3CPXA 3R9FA 3LODA 4PSXA 1RO4A 2FXFA 3B3TA 3FX6A 4AG9A 5K8MA 3S17I 3D8PA 4B12A 3D2LA 2PR1A 3R9EA 3GTQI 4R8FA 2OTLZ 4CRYB 4DGLA 4X5KA 3NDJA 4MY0A 2Q51A 4MONA 2Q4YA 5D1OB 3CCRZ 3GTPI 2JIRA 4BBRI 4UFVA 2QA4Z 5F48A 1YVOA 1TFIA 4H89A 4CRZB 2ODFA 3D2PA 2JDCA 2GIVA 4MY3A 1QSOA 2GTHA 2VUGA 1K4JA 4U9YA 4CAVA 2PC1A 4ORFA 4P10A 2OTJZ 1YJN1 1LAMA 1YUAA 3SXOA 3FQMA 1YR0A 2NVTI 3CC41 1MJ9A 1S7MA 1S7KA 4B5PA 4IK2A 4F9UA 4YU9A 2JA7I 2CTBA 3H0GI 1QVFY 4M6IA 2OOYB 2G0BA 3M4OI 3RZOI 4RS2A 2ZEMA 4JXRA 4P4EA 1YIT1 2R92I 4Y49C 4HPSA 5C4JI 4CYNA 1XMTA 4ZY0A 1XMBA 2E7ZA 4A3BI 5IB9A 1KWMA 5ISVA 3GY9A 4II9A 3D7GA 4BY1I 4MCQA 3GTLI 2K5TA 5LRJA 4E8OA 1KC82 2CIJA 2RC4A 5HH1A 1N8R2 1TKFA 3NE8A 3J81b 2JIOA 4HH4A 3SXNA 4E32A 5A2Qb 3CCL1 4CYPA 3B3CA 4UBRA 1DE4C 4R76A 4UA3A 1NE9A 4CYQA 4MBUA 2RIQA 2OZGA 3CXCZ 3D7FA 1LQLA 3MN8A 1TWFI 2GU2A 3FNCA 1K8A1 3P2HA 4CGLA 3WABA 1M902 1WZNA 1AMPA 3M3YI 1NSAA 5C88A 1VQ6Z 4Y7NI 3FBUA 4Q7AA 1M4IA 2PJCA 3PO3I 2REEA 2IJZA 3PO3S 2RFHA 2WUUA 4MJ8A 3IFUA 3WC7A 3I551 1KQSY 1R43A 4A3DI 3BHXA 4FD7A 2VBQA 1XOVA 2OU2A 3EFAA 4LQGA 1Q2DA 2V8JA 2IQ6A 4C7IA 3RZAA 1TXRA 5E96A 4H2KA 4WJBA 1YSJA 2PMZA 4KSAA 5HXDA 4CAFA 3RBUA 5IT9f 1IU8A 3EEDA 2EUIA 1Z4EA 2ZEFA 4DQYB 5EBVA 1F2PA 3B2YA 2JNYA 3B3VA 4MCSA 4KUAA 1VIXA 2EBJA 4JXQA 3IF8A 3SJEA 1Z5RA 2KPIA 2ZEDA 3J80b 3BI0A 2PIZA 2OZUA 5J8FA 3S15I 2ZEPA 1TKJA 2RBLA 5EC4A 4NB8A 3SJXA 2C6PA 5KTAA 1TF8A 2POKA 4KSIA 4EVYA 3BG0B 1ZH1A 4X3RA 4M6HA 5G22A 2QRCB 3GTMI 1I1DA 2PR8A 3GTMS 4E2ZA 3MZLB 2ZOGA 4H6ZA 1M4GA 1Q2CA 2V8KA 3S2HI 4OC0A 3NH8A 1FNOA 2VI7A 2GREA 2W04A 2Z3PA 2Y0SA 5A28A 4F0YA 4BBSI 1USPB 2HU9A 5IX3A 2I00A 4UCMA 5HMNA 3FF3A 1QVGZ 1EE3P 2Q0YA 2YNCA 1Q811 3D9XA 3DLJA 4R7MA 1KRLA 3CPWZ 3CCU1 2BL1A 3H8GA 3S1NI 3IFEA 1K8A2 3CT9A 1X10A 3CXQA 1QXFA 3IWWA 5KTDA 4QVTA 2FT0A 2K3RA 4AVAA 4CAXA 4UWJA 2HB6A 4K3NA 2VZYA 3IIBA 1CPXA 2WB1A 7CPAA 3CC7Z 3S1QI 4CAEA 2J8NA 4C68A 1SQHA 1JJ2Y 4IAVA 1R9TI 4AVBA 2AFWA 2LFUA 5JH9A 2DPTA 3NFZA 4F6AA 4ZX9A 3I3GA 3KASA 4P44A 4S1TA 3PFOA 4A32A 4FD5A 3S9LA 3J81f 3E0KA 2P0WA 3HOXI 5A2Qf 2ZW7A 1Q2YA 4DUKA 3S6KA 1SFOI 4A39A 5J8CA 3PEIA 4MMOA 5BWAB 3HLPA 1ZO0A 3QAYA 4L8AA 1J4JA 3JUWA 4KZTA 2J8MA 4OC1A 2PJBA 1IB1E 4QTUA 3DR8A 3VMHA 3B3WA 5EMIA 2RHBA 4UCPA 3G8WA 1DL6A 2J6AA 2RT9A 1TF9A 3VTNA 2AE6A 3GTJI 5FLMI 2D4PA 1MK4A 4UIAA 2WZNA 4E2YA 4R3KA 3V7ZA 1RNIA 4Y52I 4A3MI 4XPLA 5AGEA 4X8IA 5AN9F 2R93I 4B5PB 3H8EA 2IZ4A 2CY2A 2Z3LA 2Q44A 3I561 3CCV1 1IY7A 2PJ7A 3KGQA 3F3PC 4NBHA 3CD61 4X6AI 3P5JB 1R57A 3IWEA 4NH1C 2V77A 5LYIA 1S7LA 3S9MA 1B87A 1WWZA 1XJOA 4C2YA 1F57A 2Z3MA 1Z8XA 3FEEA 1S721 4I49A 1YK3A 1QQ9A 2FVGA 4NB9A 3I07A 2V8GA 3CCJ1 2AFOA 3BXMA 2B4DA 2K5RA 2FS5A 5AG7A 1P0HA 2KI7B 4A38A 4GXHA 1FDIA 1QVFZ 2IZ3A 2QMLA 4Z65A 1VQO1 4M85A 2M6NA 1VQN1 1TIQA 2R6MA 4CAWA 4FBEA 1YGHA 4MXUA 3GKQA 3ISZA 3G4S1 1Q7Y1 3KHZA 3T9YA 1VHOA 3BLNA 4UEFA 1YJ91 4TWEA 3SI0A 4PPZA 4KOWA 3CME1 4OIWA 2YADA 1ELMP 5I4MA 4B14A 3ISXA 4MCPA 2ZPAA 5LRGA 2JA6I 2Z0ZA 4F8ZA 1RLYA 4JZ0A 4XNHB 1VQ51 2ZEGA 3D68A 3TO9A 3DR6A 1VQKZ 4PXBA 3TFYA 1Y0RA 2Z10A 1OZPA 2Q43A 2NMTA 2NVXI 2VPYA 4DNCA 3H3VJ 2FCKA 2CF4A 4A3EI 3GUXA 4OKOA 2QREB 1YUKA 2JR6A 3D6WA 4BXXI 3VMIA 3MONA 3HKZA 4LUAA 3TTHA 3SI1A 2JUBA 1CP6A 3IR7A 2B58A 2DXQA 2D4OA 4E30A 4YRHA 1QMUA 1N2FA 4PK2A 4NGPA 2AFZA 2O4HA 2NSMA 4P4DA 3KR4A 3NA6A 2NYQA 4NGNA 1PCAA 4MFLA 4JWPA 1VQM1 2P6GA 3BI1A 3IGRA 3H4QA 3S9NA 4A31A 2CNTA 5H86A 4UIBA 3GTOI 2PJ8A 1VQ71 3RYOA 2I79A 5K8OA 3F3FC 2B3VA 3SJFA 2E2JI 2G9DA 3LWUA 3G6EZ 1FT7A 2ZEHA 1I6HI 4R9MA 3GTKI
chains in the Genus database with same CATH topology
2C1CA 1CG2A 3WC7A 5T6BA 3I551 4NBDA 1KQSY 3PBEA 2VUMI 1VQP1 5HVHA 2O53A 1R43A 2JS4A 3JRUA 4A3DI 3CCQ1 1AYEA 1TKHA 3RAMA 2E9HA 1X3ZA 3BHXA 3KQXA 1BPNA 4NGRA 4BD9A 3G711 2ABZA 3LUSA 1XBUA 1M1K2 1YJW1 3CPAA 3CCSZ 1Q812 4LQGA 3KI9A 2V8JA 2IQ6A 5JM6A 1K9M1 1VQ61 3RZAA 2PCUA 3FKII 2PRQA 1USPA 4RVFA 1TXRA 3BG1B 2W03A 3WC6A 5D29A 1BLLE 4H2KA 4WJBA 2ZEEA 1YSJA 4WWVA 2NVYI 2PMZA 5HXDA 3VH9A 2PJ0A 3VARA 3S1RI 1JWHC 3RBUA 1Q821 4NGMA 4OC4A 2DE6A 4PXCA 5IT9f 4RVGA 3PB9X 3EEDA 3MZKB 3OW2Y 3JAMb 1YHQZ 2PJ9A 2AFXA 3G6E1 3TE5B 1YI2Z 1Z8LA 2ZEFA 4DQYB 2GLJA 4OMEA 2OR4A 1CPSA 1F2PA 3B2YA 3FECA 2JNYA 2PJAA 3B3VA 3N5FA 4MCSA 6CPAA 1VIXA 2F7VA 3IF8A 3SJEA 1RTQA 4OC5A 1BPMA 1Z5RA 2KPIA 3B7IA 1ELLP 4UEZA 3I1UA 2ZEDA 4RV9A 3J80b 3I4NI 2R7ZI 3BI0A 5LYFA 3IO1A 1LFWA 4A3JI 2PIZA 3K9TA 3FH4A 3S15I 2ZEPA 2H85A 8CPAA 1TKJA 1RO0A 2RBLA 3GTGI 2AFMA 3KIFA 4NB8A 3SJXA 3CCS1 2C6PA 1Z01A 1TF8A 2POKA 1XRYA 4MD9A 3H8FA 4KSIA 2IMOA 4MHYA 2PVVA 3KL9A 4CL1A 5FLXf 2V8VA 3BG0B 2QJ8A 1Q861 1VQLZ 1ZH1A 2E2II 4X3RA 2AKLA 2QRCB 3GTMI 3CCUZ 4R6TA 5C4XI 5D1PA 1YW4A 1DTDA 5LYDA 4EWCA 1Q7Y2 1RQFA 3IJ3A 3GTMS 1QYPA 2JBKA 3B35A 4E2ZA 3MZLB 3FVLA 2ZOGA 4P4BA 5CBMA 1YLOA 3TDHB 4JYWA 2VL1A 1Y7EA 4XX2A 4NBCA 2ZAEB 2V8KA 1YHQ1 1VQ81 4MH4A 2V8HA 2J9AA 4NGQA 3S2HI 4A3LI 4OC0A 4EWTA 5HVGA 5THWA 3K7AI 5LL6f 3T8WA 4DJLA 1X0TA 3NH8A 3D66A 1FNOA 2GREA 2W04A 5C3EI 2Y0SA 3PBBA 2JA8I 5J1QA 3CMAZ 4NBAA 1USPB 4BBSI 2HU9A 2ZOFA 1NJI2 4RS4A 1LOKA 4RVDA 1IGBA 3FF3A 4TNUA 4PQAA 2EK9A 1QVGZ 4A3FI 3I4MI 2PVWA 2C6CA 1NP6A 4E2XA 1EE3P 3D67A 4ZX8A 4AXVA 1Q811 2BCOA 3D9XA 4NJQA 4O23A 2RPRA 2HC9A 3DGVA 1F2OA 4FUUA 1NUIA 3CPWY 3VATA 3DLJA 3KHXA 5LRKA 4R7MA 1VQL1 3VB9A 3WT4A 1KRLA 3PRTA 4A94A 3CPWZ 3CCU1 3U50C 3H8GA 4HGYA 3KZWA 1XFOA 2PJ1A 3S1NI 2BJOA 3IFEA 1K8A2 3CT9A 3ESWA 3RZDI 1PYTB 2EK8A 2RB7A 3IWWA 1KQSZ 1K83I 1VQ4Z 2ZELA 4ONWA 3KR5A 2QYVA 2GLFA 5HVFA 3CC21 2K3RA 3B3SA 4A93I 1L1OC 3QNVA 2HB6A 1VGYA 3J7A4 3JAMf 3CDXA 4K3NA 1LAPA 2JEWA 3VMGA 2QKDA 3IIBA 1CPXA 2WB1A 4B6ZA 7CPAA 4NJRA 1KD12 3CC7Z 3S1MI 3S1QI 3CMA1 4FAIA 3HUVA 4NFRA 1JJ2Y 4IAVA 1KC81 1WIIA 2EGTA 5JGFA 4MD8A 2OZKA 1LANA 2PE3A 3CCMZ 1R9TI 3S16I 2ZENA 1UWYA 4F9VA 1ZB9A 3LMSA 1N8R1 2AFWA 2LFUA 2PIYA 5JH9A 3J80f 3MRUA 3IC1A 3NFZA 4P6YA 2C6GA 4ZX9A 1ZLHA 2XEFA 1VQ9Z 4UEEA 4DYOA 3KASA 2I3CA 4NBGA 1OBRA 4S1TA 2QEXZ 1VQ8Z 3PFOA 4P44A 3EERA 2QR1B 4OC2A 2JA5I 3S9LA 3J81f 4DK1A 5LYLA 3HOXI 3OW2Z 5A2Qf 4DUKA 1WCMI 4NBEA 3NDIA 1SFOI 4A39A 3NH5A 1TWGI 3PEIA 4MHNA 4MMOA 4P4IA 4YWYA 5K8PA 4A3II 4ZY2A 1VQ41 3HLPA 1M4LA 2PJ3A 1M901 2XEIA 1TWCI 1CBXA 2M48A 2PK7A 1Z02A 2PM9A 4ZY1A 4G1PA 3FMCA 1K731 3KIHA 3S2DI 1K9M2 4BY7I 1H8LA 4OC1A 2DE7A 1R3NA 2PJBA 3CC71 1WW9A 4QTUA 3I56Z 5K8NA 2DEAA 3IEHA 3CCVZ 3VMHA 3B3WA 2XEGA 2CTCA 2RHBA 3CCEZ 5IT9b 3CCM1 3CD6Z 1YMEA 1HEEA 1DL6A 2J6AA 2PJ5A 2WAQA 3IX0A 2EWBA 3CPXA 1Q822 2JMOA 2RT9A 1TF9A 3GB0A 1ARMA 3VTNA 1ZLIA 4NBFA 1VQ91 1P9NA 3GTJI 5FLMI 5F09A 1RO4A 3CC2Z 2QEX1 3B3TA 3FX6A 4UIAA 5K8MA 2Q4ZA 2WZNA 3GCFA 3S17I 4E2YA 3GLJA 4RUHA 1YJNZ 3KQZA 1S72Z 3V7ZA 3PB4X 1RNIA 5T67A 4Y52I 4A3MI 1YIJ1 3GTQI 3V38A 4R8FA 3CQZI 3CCJZ 3CC4Z 1Y1VS 2OTLZ 3SI2A 4DGLA 3TC8A 4X8IA 5AN9F 2R93I 3NDJA 3H8EA 3S14I 4ZYQA 2Q51A 4MONA 1BAVA 2QLVB 5D1OB 5FLXb 3CCRZ 3Q87A 3GTPI 4P4JA 1M1K1 1CP7A 2IZ4A 4BBRI 2QA4Z 1VQOZ 1VQNZ 4UF4A 1TFIA 2AFUA 4EFDA 3I561 4MD7A 3CCV1 1IY7A 3FEDA 2PJ7A 3KGQA 3G4SZ 1YITZ 4E33A 4MCRA 3CCE1 3F3PC 4NBHA 4NGSA 3CD61 4X6AI 3P5JB 3PB6X 1YJ9Z 5D8NA 4NH1C 2V77A 3CMEZ 5LYIA 2GTHA 2VUGA 3S9MA 1XJOA 2NVQI 3TX8A 2F4OA 4HGZA 1TWAI 1F57A 5C44I 2P28A 1QF8A 2OTJZ 4P10A 1YJN1 3FEEA 1S721 1LAMA 1W2BY 1Z03A 1YUAA 3FQMA 1QQ9A 2FVGA 4NB9A 3I07A 2V8GA 2NVTI 1ZG8A 1W2BZ 3CCJ1 3CC41 2AFOA 3BXMA 4OIDA 2K5RA 1VQ5Z 2OTL1 3PFEA 1S7MA 4IK2A 4ZI6A 4NGTA 4F9UA 4YU9A 4W9YA 2V8DA 1JQGA 2JA7I 2CTBA 3HOWI 2PJ4A 3H0GI 1QVFY 1JJ2Z 2KI7B 5D1OA 4A3CI 4A38A 3CCR1 2OOYB 3M4OI 3CCLZ 4E31A 1GYTA 3SJGA 1QVFZ 2IZ3A 1ZG7A 2JBJA 4Z65A 2QA41 1VQO1 2M6NA 1VQN1 3PB7X 1YW6A 3RZOI 1VHEA 1Y0YA 2R6MA 4FBEA 4MXUA 5ELYA 4PXDA 2YU9I 1TWHI 2ZEMA 3GKQA 1YIJZ 3ISZA 4P4EA 1CX8A 3G4S1 5CPAA 1YIT1 1Q7Y1 3KHZA 2R92I 2OOXB 1VHOA 4UEFA 3FJUA 5C4JI 1YJ91 4TWEA 3SI0A 4FWUA 3HOZI 4P4FA 4PPZA 4ZY0A 3CME1 4OIWA 1XMBA 4IHMA 5IB9A 2YADA 4A3BI 4X2TA 1ELMP 5I4MA 2GTIA 1VLAA 3QWUA 1KWMA 4MHPA 4NBBA 4NOZA 5T64A 3HOVI 2F8HA 3D4UA 3D7GA 3ISXA 2OTJ1 1Q7LA 4MCPA 4BY1I 4MCQA 1Y1WI 4RVHA 3GTLI 1VQMZ 5LRGA 2JA6I 3T4NB 4P45A 5LRJA 1NJI1 4F8ZA 1RLYA 4JZ0A 1VQ51 2ZEGA 3D68A 1X3WA 1KC82 3PB8X 2CIJA 1VQ7Z 2ZEOA 1VQKZ 4PXBA 5IP7I 1N8R2 1TKFA 3D7DA 2B63I 2AFSA 1Y0RA 5IP9I 3J81b 4A37A 3FQQA 2Q43A 4HH4A 4E32A 5A2Qb 3CCL1 2NVXI 2XEJA 3H3VJ 3B3CA 2CF4A 3CXCY 4A3EI 1DE4C 3GUXA 4R76A 4OKOA 2QREB 1YUKA 2JR6A 1HDQA 2RIQA 3D6WA 2DE5A 2LIYA 4BXXI 3VMIA 3MONA 1Y1VI 3CXCZ 3HKZA 3D7FA 1LQLA 2F4MA 1TWFI 3I55Z 2GU2A 3MN8A 3SI1A 1VQPZ 2JUBA 1ZB8A 1K8A1 1CP6A 2BOAA 1I3QI 2WYRA 4CPAA 3NH4A 3WC5A 4E30A 3CCQZ 1QMUA 1Z2LA 4OC3A 3WABA 2OOTA 1LCPA 4PXEA 1M902 1N2FA 2E2HI 4MRIA 4NGPA 3G71Z 2AFZA 2O4HA 1YI21 1AMPA 1HDUA 2BO9A 2NSMA 3M3YI 3K2KA 3L2NA 1YJWZ 4P4DA 3KR4A 1ARLA 3NA6A 2NYQA 4NGNA 1PCAA 1NSAA 4A3KI 1K732 1VQ6Z 3HOUI 2G2KA 2PJ6A 1VQM1 1KD11 1Q862 4A3GI 2VF1A 3BI1A 3S9NA 1QVGY 1PFTA 1ZG9A 5CM2M 4QTTA 5DS0A 4Y7NI 4Q7AA 2QVPA 2PJCA 3GTOI 4UIBA 3PO2I 2PJ8A 3PO3I 1VQ71 1I50I 1VQK1 2IJZA 2PJ2A 4E2WA 3D7HA 4MHZA 5K8OA 2ANPA 3F3FC 4GM5A 2V8IA 3PO3S 3SJFA 2QRDB 2E2JI 2P3YA 2G9DA 3LWUA 4OP4A 1ML8A 1RO2A 3G6EZ 4EMEA 1FT7A 3HOYI 2RFHA 2ZEHA 1I6HI 4AYBA 3IFUA 2HF1A 3GTKI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1C A;  1CG2 A;  3WC7 A;  3PBE A;  5HVH A;  2O53 A;  1R43 A;  3JRU A;  1AYE A;  1TKH A;  3RAM A;  3BHX A;  3KQX A;  1BPN A;  4NGR A;  4BD9 A;  2ABZ A;  1XBU A;  3CPA A;  4LQG A;  3KI9 A;  2IQ6 A;  5JM6 A;  3RZA A;  2PCU A;  2PRQ A;  1TXR A;  3WC6 A;  5D29 A;  1BLL E;  4H2K A;  4WJB A;  2ZEE A;  1YSJ A;  4WWV A;  5HXD A;  3VH9 A;  2PJ0 A;  3VAR A;  3RBU A;  4NGM A;  4OC4 A;  4PXC A;  3PB9 X;  2PJ9 A;  2AFX A;  2ZEF A;  1Z8L A;  4OME A;  2GLJ A;  2OR4 A;  1CPS A;  1F2P A;  3B2Y A;  3FEC A;  2PJA A;  3B3V A;  3N5F A;  4MCS A;  6CPA A;  1VIX A;  2F7V A;  3SJE A;  1RTQ A;  4OC5 A;  1BPM A;  1Z5R A;  3B7I A;  1ELL P;  4UEZ A;  3I1U A;  2ZED A;  3BI0 A;  5LYF A;  3IO1 A;  1LFW A;  3K9T A;  2PIZ A;  3FH4 A;  2ZEP A;  8CPA A;  1TKJ A;  2AFM A;  3SJX A;  2C6P A;  4MCR A;  4MHY A;  1TF8 A;  1XRY A;  2POK A;  3H8F A;  4KSI A;  2IMO A;  2PVV A;  3KL9 A;  2V8V A;  2QJ8 A;  4X3R A;  4R6T A;  1YW4 A;  1DTD A;  5LYD A;  3IJ3 A;  2JBK A;  3B35 A;  3FVL A;  4P4B A;  2ZOG A;  5CBM A;  1YLO A;  4JYW A;  2VL1 A;  1Y7E A;  2V8H A;  2J9A A;  4NGQ A;  4OC0 A;  4EWT A;  5HVG A;  5THW A;  3T8W A;  4DJL A;  3NH8 A;  3D66 A;  1FNO A;  2GRE A;  3PBB A;  5J1Q A;  2ZOF A;  1LOK A;  1IGB A;  3FF3 A;  4TNU A;  4PQA A;  2EK9 A;  2PVW A;  2C6C A;  4ZX8 A;  1EE3 P;  3D67 A;  4AXV A;  2BCO A;  4NJQ A;  4O23 A;  2HC9 A;  3DGV A;  1F2O A;  4FUU A;  3VAT A;  3DLJ A;  3KHX A;  5LRK A;  4R7M A;  3WT4 A;  3PRT A;  4A94 A;  3H8G A;  3KZW A;  1XFO A;  2PJ1 A;  3IFE A;  3CT9 A;  1PYT B;  2EK8 A;  2RB7 A;  3IWW A;  2ZEL A;  4ONW A;  3KR5 A;  2QYV A;  2GLF A;  5HVF A;  3B3S A;  3QNV A;  2HB6 A;  1VGY A;  3CDX A;  4K3N A;  1LAP A;  2JEW A;  3IIB A;  1CPX A;  4B6Z A;  7CPA A;  4NJR A;  4FAI A;  3HUV A;  4NFR A;  4IAV A;  5JGF A;  1LAN A;  2PE3 A;  2ZEN A;  1UWY A;  4F9V A;  3LMS A;  2AFW A;  2PIY A;  5JH9 A;  3MRU A;  3IC1 A;  3NFZ A;  4P6Y A;  2C6G A;  4ZX9 A;  1ZLH A;  2XEF A;  4UEE A;  4DYO A;  3KAS A;  2I3C A;  4P44 A;  1OBR A;  3PFO A;  4OC2 A;  3S9L A;  5LYL A;  4DUK A;  4A39 A;  3NH5 A;  3PEI A;  4MHN A;  4MMO A;  4P4I A;  4YWY A;  5K8P A;  4ZY2 A;  3HLP A;  1M4L A;  2PJ3 A;  2XEI A;  1CBX A;  4ZY1 A;  4G1P A;  3FMC A;  1H8L A;  4OC1 A;  1R3N A;  2PJB A;  5K8N A;  2DEA A;  3IEH A;  3B3W A;  2XEG A;  2CTC A;  1YME A;  1HEE A;  2PJ5 A;  2EWB A;  3CPX A;  1TF9 A;  3GB0 A;  1ARM A;  1ZLI A;  5F09 A;  3B3T A;  5K8M A;  3FX6 A;  4UIA A;  2Q4Z A;  2WZN A;  3GLJ A;  4RUH A;  3KQZ A;  3V7Z A;  3PB4 X;  3V38 A;  4R8F A;  3SI2 A;  3TC8 A;  4X8I A;  3H8E A;  4ZYQ A;  2Q51 A;  1BAV A;  4P4J A;  1CP7 A;  4UF4 A;  2AFU A;  4EFD A;  1IY7 A;  3FED A;  2PJ7 A;  3KGQ A;  4NGS A;  3PB6 X;  5D8N A;  2V77 A;  5LYI A;  3S9M A;  1XJO A;  3TX8 A;  1F57 A;  4P10 A;  3FEE A;  1LAM A;  1QQ9 A;  2FVG A;  2V8G A;  1ZG8 A;  2AFO A;  3BXM A;  4OID A;  3PFE A;  4IK2 A;  4ZI6 A;  4NGT A;  4F9U A;  4YU9 A;  4W9Y A;  2V8D A;  1JQG A;  2CTB A;  2PJ4 A;  4A38 A;  1GYT A;  3SJG A;  1ZG7 A;  2JBJ A;  4Z65 A;  3PB7 X;  1YW6 A;  1VHE A;  1Y0Y A;  4FBE A;  4MXU A;  5ELY A;  4PXD A;  2ZEM A;  4P4E A;  3ISZ A;  1CX8 A;  5CPA A;  3KHZ A;  1VHO A;  4UEF A;  3FJU A;  4TWE A;  3SI0 A;  4FWU A;  4P4F A;  4PPZ A;  4ZY0 A;  4OIW A;  1XMB A;  4IHM A;  5IB9 A;  4X2T A;  1ELM P;  5I4M A;  1KWM A;  4MHP A;  2F8H A;  3D4U A;  3D7G A;  3ISX A;  1Q7L A;  4MCP A;  4MCQ A;  5LRG A;  4P45 A;  5LRJ A;  4F8Z A;  4JZ0 A;  2ZEG A;  3D68 A;  3PB8 X;  2CIJ A;  2ZEO A;  4PXB A;  1TKF A;  3D7D A;  2AFS A;  1Y0R A;  4A37 A;  2Q43 A;  2XEJ A;  3B3C A;  2CF4 A;  1DE4 C;  3GUX A;  4R76 A;  4OKO A;  1HDQ A;  3D7F A;  3MN8 A;  2GU2 A;  3SI1 A;  1CP6 A;  2BOA A;  2WYR A;  4CPA A;  3NH4 A;  3WC5 A;  1QMU A;  1Z2L A;  4OC3 A;  3WAB A;  2OOT A;  1LCP A;  4PXE A;  4MRI A;  4NGP A;  3L2N A;  3K2K A;  2O4H A;  1AMP A;  1HDU A;  2AFZ A;  2BO9 A;  2NSM A;  4P4D A;  3KR4 A;  1ARL A;  3NA6 A;  2NYQ A;  4NGN A;  1PCA A;  1NSA A;  2PJ6 A;  3BI1 A;  3S9N A;  1ZG9 A;  5DS0 A;  4Q7A A;  2QVP A;  2PJC A;  4UIB A;  2PJ8 A;  2IJZ A;  4MHZ A;  2PJ2 A;  3D7H A;  5K8O A;  2ANP A;  4GM5 A;  3SJF A;  2G9D A;  3LWU A;  4OP4 A;  4EME A;  1FT7 A;  2RFH A;  2ZEH A; 
#chains in the Genus database with same CATH topology
 2C1C A;  1CG2 A;  5T6B A;  4C7H A;  1VQP 1;  2JS4 A;  3JRU A;  3CCQ 1;  1TKH A;  2ATR A;  1X3Z A;  4CGP A;  4NGR A;  3G71 1;  2ABZ A;  3LUS A;  1YJW 1;  3CCS Z;  4F0X A;  3FKI I;  2W03 A;  1SIW A;  3VH9 A;  3S1R I;  1Q82 1;  4NGM A;  4OC4 A;  4LQ6 A;  1YHQ Z;  2JDD A;  4OLL A;  2P6E A;  2GLJ A;  2OR4 A;  1JWQ A;  2F7V A;  1P4N A;  3I1U A;  4RI1 A;  2OH1 A;  1LFW A;  4JJX A;  3EXN A;  2FIA A;  3GTG I;  2AFM A;  4MD9 A;  2PVV A;  3I9S A;  4BBH A;  1KZF A;  2CNS A;  1Q86 1;  1VQL Z;  2E2I I;  2B5G A;  3A9L A;  1YW4 A;  2AYD A;  1DTD A;  5LYD A;  1Q7Y 2;  2OB0 A;  1RQF A;  1QYP A;  2JBK A;  4P4B A;  1YLO A;  3SHP A;  2WSA A;  4JYW A;  3EO4 A;  4XX2 A;  5I0C A;  4MH4 A;  4A3L I;  3N7Z A;  5THW A;  3K7A I;  5LL6 f;  4DJL A;  1X0T A;  5C3E I;  5J1Q A;  4RS4 A;  4RVD A;  1IGB A;  2EK9 A;  4YFJ A;  3KKW A;  4A3F I;  1B6B A;  2BCO A;  4O23 A;  1IOI A;  4FUU A;  1NUI A;  3KHX A;  5LRK A;  2BEI A;  1QSR A;  2PJ1 A;  2BJO A;  2YGW A;  1PYT B;  2RB7 A;  1VQ4 Z;  4ONW A;  3KR5 A;  2QYV A;  2WPW A;  3B3S A;  4A93 I;  1L1O C;  1VGY A;  3C26 A;  3CDX A;  1LAP A;  2JEW A;  3VMG A;  4B6Z A;  1Y7R A;  4NJR A;  3CMA 1;  2ARH A;  2R1I A;  5JGF A;  4MD8 A;  1LAN A;  2ZEN A;  3T90 A;  4HKF A;  4KS9 A;  1UWY A;  1MJB A;  2VQY A;  3MRU A;  4P6Y A;  2C6G A;  1ZLH A;  4NBG A;  1VQ8 Z;  2QR1 B;  2Q4V A;  3OW2 Z;  1WCM I;  4NBE A;  2JEV A;  4QC6 A;  2JIP A;  3NH5 A;  1TWG I;  3JTK A;  4XNH C;  4P4I A;  2ZXV A;  4J3G A;  1QSM A;  2XEI A;  1S5K A;  1CBX A;  2PM9 A;  4ZY1 A;  4G1P A;  4QUS A;  4FD6 A;  3FMC A;  3EY5 A;  3S2D I;  2DE7 A;  1WW9 A;  2XEG A;  3CCM 1;  2PJ5 A;  2WAQ A;  3IX0 A;  3BJ8 A;  1Q82 2;  4PV6 A;  3GB0 A;  1ARM A;  1CJW A;  4PSW A;  4NBF A;  1VQ9 1;  1P9N A;  1LRZ A;  2QEX 1;  2Q4Z A;  3GLJ A;  4R57 A;  4CS0 B;  1YJN Z;  4RUH A;  1WK4 A;  3F0A A;  1IYL A;  1IYK A;  1RXT A;  3CZX A;  3CQZ I;  3CC4 Z;  1YRE A;  1Y1V S;  1NMT A;  2B4D B;  3SI2 A;  3TC8 A;  3TCV A;  3S14 I;  3Q87 A;  4P4J A;  1M1K 1;  1S7F A;  2GAN A;  3NE7 A;  4EFD A;  3W6X A;  1N71 A;  3FED A;  1YIT Z;  3CCE 1;  4NGS A;  1S3Z A;  1UFH A;  2F4O A;  4HGZ A;  1TWA I;  5C44 I;  2P28 A;  1XEB A;  4KOU A;  1W2B Y;  5F49 A;  4NSQ A;  1ZG8 A;  1V0C A;  4OID A;  2OTL 1;  3PFE A;  4ZI6 A;  5JPH A;  4NGT A;  4W9Y A;  1JQG A;  2PJ4 A;  3HOW I;  3CCR 1;  3CCL Z;  1GYT A;  1ZG7 A;  2QA4 1;  3PB7 X;  2ZW5 A;  1L0C A;  1VHE A;  1Y0Y A;  4PXD A;  4CGN A;  1YIJ Z;  1CX8 A;  5CPA A;  4B11 A;  3ZZI A;  2FL4 A;  2OOX B;  3FJU A;  3PP9 A;  3S6F A;  3GKR A;  1S7N A;  2R8V A;  4X2T A;  4JD6 A;  1ON0 A;  1VLA A;  3QWU A;  2ZW6 A;  4MHP A;  4NBB A;  4NOZ A;  5T64 A;  3S6G A;  4ZGY B;  2OTJ 1;  2YNC C;  4RVH A;  4AG7 A;  2P6F A;  3T4N B;  4P45 A;  1NJI 1;  1X3W A;  5AG6 A;  1I12 A;  2ZEO A;  3LD2 A;  3FXT A;  2XEJ A;  4Q38 A;  1HDQ A;  3FYN A;  4BIN A;  3I55 Z;  1ZB8 A;  2BOA A;  2AJ6 A;  1I3Q I;  4CPA A;  3F5B A;  1Z2L A;  2OOT A;  1LCP A;  4PXE A;  2E2H I;  3L2N A;  1HDU A;  2BO9 A;  1ARL A;  3FRM A;  4A3K I;  3HOU I;  2G2K A;  1KUX A;  1KD1 1;  4A3G I;  1QVG Y;  1ZG9 A;  5CM2 M;  4QTT A;  5DS0 A;  2O28 A;  2IV2 X;  3PO2 I;  1PU9 A;  4MHZ A;  2PJ2 A;  4E2W A;  3D7H A;  3TO6 A;  5IB0 A;  2ANP A;  2PQ8 A;  4GM5 A;  1Z9U A;  1VKC A;  1S60 A;  1ML8 A;  4A95 A;  2QEC A;  1U6M A;  3QAH A;  3G3S A;  4U5Y A;  4AYB A;  2HF1 A;  4KOR A;  5C82 A;  3LAC A;  5HVH A;  2JIQ A;  4UFX A;  1AYE A;  4KOS A;  2E9H A;  4MFK A;  2C27 A;  1BPN A;  1Y8C A;  4ZBG A;  1M1K 2;  3CPA A;  1Q81 2;  3KI9 A;  1K9M 1;  1VQ6 1;  1USP A;  2VZZ A;  1IOF A;  4IF5 A;  3FIX A;  2B5G B;  2ZEE A;  4WWV A;  1QSN A;  4YGO A;  2PJ0 A;  3VAR A;  1JWH C;  2DE6 A;  4C2X A;  4RN7 A;  3B8G A;  2HUZ A;  3DDD A;  3RO0 A;  2PJ9 A;  2YND A;  3JVN A;  3TE5 B;  1YI2 Z;  1CM0 A;  3FEC A;  1WJ2 A;  2PJA A;  4L89 A;  6CPA A;  3R95 A;  4MHD A;  4OC5 A;  1BPM A;  3B7I A;  4RV9 A;  3I4N I;  2R7Z I;  5LYF A;  3TOB A;  3FH4 A;  1M44 A;  8CPA A;  1RO0 A;  1AUG A;  3KIF A;  1Z01 A;  4MCR A;  4MHY A;  1XRY A;  4M6G A;  3KL9 A;  4CL1 A;  2V8V A;  4MFQ A;  1A2Z A;  3R96 A;  2AKL A;  3CCU Z;  5C4X I;  5D1P A;  4MI4 A;  3IJ3 A;  3B35 A;  5DWN A;  5CBM A;  4NBC A;  2ZAE B;  1VQ8 1;  4NGQ A;  3WR7 A;  2Z11 A;  4R87 A;  4EWT A;  5HVG A;  3T8W A;  2G3A A;  3D66 A;  5F47 A;  3PBB A;  2JA8 I;  4NBA A;  2ZOF A;  1NJI 2;  5G1Z A;  2PVW A;  1NP6 A;  3D67 A;  4NJQ A;  2HC9 A;  5G21 A;  3DGV A;  1F2O A;  3K9U A;  3VAT A;  4HNY B;  5CNP A;  3WT4 A;  3PRT A;  4A94 A;  3U50 C;  2EO8 A;  4ONU A;  4HGY A;  3KZW A;  1XFO A;  3D3S A;  4IUS A;  3IU2 A;  1KQS Z;  1K83 I;  2ZEL A;  3PGP A;  4UCN A;  2GLF A;  3QB8 A;  2V3V A;  5HVF A;  1YLE A;  1QST A;  1Z8W A;  3QNV A;  3JAM f;  4QBJ A;  4CGO A;  3EC4 A;  1KD1 2;  2DF5 A;  3S1M I;  2VPZ A;  1PUA A;  4FAI A;  3HUV A;  1WII A;  2EGT A;  2HQY A;  2OZK A;  3S16 I;  4GS4 A;  1ZB9 A;  2PIY A;  3IC1 A;  4UEE A;  3TOA A;  4JLY A;  3CXS A;  2BSW A;  4OAD A;  1VHS A;  1Q16 A;  3NDI A;  2PDO A;  1X12 A;  5K8P A;  4ZY2 A;  3S6H A;  1M4L A;  2PJ3 A;  3R1K A;  1TWC I;  2M48 A;  1Z02 A;  1M4D A;  1K73 1;  3FB3 A;  4BY7 I;  1K9M 2;  1H8L A;  4UWI A;  1XIX A;  1R3N A;  3CC7 1;  3I56 Z;  2Q7B A;  3CCV Z;  2CTC A;  3CD6 Z;  1YME A;  1HEE A;  3DSB A;  4PK3 A;  2JMO A;  1ZLI A;  5F09 A;  3CC2 Z;  3ZJ0 A;  3GCF A;  3KQZ A;  1S72 Z;  3IU1 A;  3W6S A;  3PB4 X;  5T67 A;  1YIJ 1;  3V38 A;  3CCJ Z;  4KOV A;  1I21 A;  2JLM A;  5JQ4 A;  4ZYQ A;  5IV0 A;  1BAV A;  2QLV B;  4B10 A;  1YQE A;  5FLX b;  5G20 A;  5DWM A;  1IIC A;  1CP7 A;  4XPD B;  1Z8T A;  1KUV A;  1VQO Z;  1VQN Z;  4UF4 A;  2AFU A;  5H84 A;  1IID A;  4MD7 A;  3G4S Z;  3GYA A;  4E33 A;  3PB6 X;  1YJ9 Z;  2DPS A;  5D8N A;  3CME Z;  2HV2 A;  4MFZ A;  3DNS A;  2NVQ I;  3TX8 A;  2R98 A;  4NF1 A;  1QF8 A;  1Z03 A;  2VXK A;  2KCW A;  2EVN A;  1W2B Z;  1VQ5 Z;  4A2Z A;  2V8D A;  5FVJ A;  1JJ2 Z;  5D1O A;  4A3C I;  4UFW A;  2VPX A;  4E31 A;  3SJG A;  2JBJ A;  1YW6 A;  4KLW A;  1Y9W A;  5ELY A;  2YU9 I;  1TWH I;  5AG5 A;  4FWU A;  3GIU A;  3HOZ I;  4P4F A;  4IHM A;  4R3L A;  1RO5 A;  2GTI A;  4KOX A;  3HOV I;  2F8H A;  3D4U A;  4AVC A;  1Q7L A;  3TE4 A;  2Q04 A;  1Y1W I;  4AB7 A;  1VQM Z;  4A30 A;  4NEX A;  2B4B A;  4FD4 A;  3PB8 X;  1VQ7 Z;  5IP7 I;  2IL4 A;  3D7D A;  2B63 I;  2AFS A;  5IP9 I;  4A37 A;  3VWE A;  3FQQ A;  4KUB A;  3CXC Y;  2DE5 A;  2LIY A;  3D2M A;  1Y1V I;  1FDO A;  2F4M A;  1VQP Z;  4HNX B;  4QB9 A;  1Y9K A;  2VEZ A;  2WYR A;  4KVO E;  3NH4 A;  3WC5 A;  3CCQ Z;  4OC3 A;  4MRI A;  3G71 Z;  3K2K A;  1YI2 1;  1YJW Z;  2GFQ A;  1MJA A;  3V8I A;  4A33 A;  1K73 2;  4MFP A;  2PJ6 A;  1Q86 2;  1YVK A;  2VF1 A;  4NCZ A;  1PFT A;  5A27 A;  2V45 A;  4E0A A;  1GHE A;  2JIM A;  2Y0M A;  2QVP A;  1I50 I;  1VQK 1;  2PRB A;  1XE4 A;  2V8I A;  3CXP A;  2QRD B;  5KTC A;  2P3Y A;  4OP4 A;  3R9G A;  1RO2 A;  4EME A;  3H5Z A;  3HOY I;  2H5M A;  2A4N A;  4NBD A;  3PBE A;  2VUM I;  2O53 A;  3RAM A;  3KQX A;  2J8R A;  2R7H A;  4BD9 A;  1XBU A;  5JM6 A;  4Q36 A;  2BUE A;  2PCU A;  2PRQ A;  5GCN A;  4RVF A;  3P2F A;  3BG1 B;  3WC6 A;  5D29 A;  1BLL E;  3TO7 A;  2NVY I;  1KUY A;  2NAP A;  4PXC A;  4KOT A;  4RVG A;  3PB9 X;  5AG4 A;  3MZK B;  3OW2 Y;  3IWG A;  3JAM b;  2AFX A;  3G6E 1;  1Z8L A;  4U9Z A;  4OME A;  1CPS A;  4KOY A;  3N5F A;  4Y49 B;  1RTQ A;  1ELL P;  4UEZ A;  4E2A A;  3BJ7 A;  2REF A;  3IO1 A;  3K9T A;  4A3J I;  1M1D A;  2H85 A;  2GE3 A;  4C2Z A;  4KVM E;  2X7B A;  3OWC A;  3CCS 1;  3H8F A;  2IMO A;  5FLX f;  2QJ8 A;  4R6T A;  2FE7 A;  4EWC A;  2Q7S A;  4NXY A;  2G3T A;  3FVL A;  3TDH B;  4XPK A;  2VL1 A;  1Y7E A;  2ZW4 A;  2VPW A;  1YHQ 1;  2V8H A;  2J9A A;  3PZJ A;  3UY5 A;  2FSR A;  4XPD C;  4BMH A;  3W91 A;  3CMA Z;  4H6U A;  4LX9 A;  1LOK A;  2LEX A;  3RNZ A;  2OZH A;  4TNU A;  4PQA A;  5F46 A;  3I4M I;  2C6C A;  2CNM A;  4E2X A;  4ZX8 A;  2Z3K A;  4AXV A;  2RPR A;  3CPW Y;  2QIR A;  1BOB A;  1VQL 1;  3VB9 A;  2PSW A;  1NSL A;  1FY7 A;  2F5I A;  3ESW A;  3RZD I;  2EK8 A;  3MGD A;  3CC2 1;  3J7A 4;  2B3U A;  4CGM A;  2QKD A;  3F8K A;  1YX0 A;  4KLV A;  4NFR A;  1Z4R A;  1KC8 1;  2PE3 A;  4KSF A;  4MFJ A;  3TT2 A;  3CCM Z;  2Z3N A;  4F9V A;  1BO4 A;  3LMS A;  1N8R 1;  3J80 f;  4M3S A;  2XEF A;  4DYO A;  1VQ9 Z;  2I3C A;  1OBR A;  2QEX Z;  2FIW A;  3EER A;  4OC2 A;  2JA5 I;  5LYL A;  4DK1 A;  4K30 A;  1AA6 A;  4B5O A;  2Z3O A;  2CXA A;  4MHN A;  4YWY A;  4A3I I;  4CYO A;  1VQ4 1;  3VWD A;  1M90 1;  4OAE A;  4HNW B;  2PK7 A;  2WPX A;  4B13 A;  3KIH A;  4KVX A;  5K8N A;  2DEA A;  3IEH A;  3CCE Z;  2YNE A;  5IT9 b;  1XF8 A;  2EWB A;  3CPX A;  3R9F A;  3LOD A;  4PSX A;  1RO4 A;  2FXF A;  3B3T A;  3FX6 A;  4AG9 A;  5K8M A;  3S17 I;  3D8P A;  4B12 A;  3D2L A;  2PR1 A;  3R9E A;  3GTQ I;  4R8F A;  2OTL Z;  4CRY B;  4DGL A;  4X5K A;  3NDJ A;  4MY0 A;  2Q51 A;  4MON A;  2Q4Y A;  5D1O B;  3CCR Z;  3GTP I;  2JIR A;  4BBR I;  4UFV A;  2QA4 Z;  5F48 A;  1YVO A;  1TFI A;  4H89 A;  4CRZ B;  2ODF A;  3D2P A;  2JDC A;  2GIV A;  4MY3 A;  1QSO A;  2GTH A;  2VUG A;  1K4J A;  4U9Y A;  4CAV A;  2PC1 A;  4ORF A;  4P10 A;  2OTJ Z;  1YJN 1;  1LAM A;  1YUA A;  3SXO A;  3FQM A;  1YR0 A;  2NVT I;  3CC4 1;  1MJ9 A;  1S7M A;  1S7K A;  4B5P A;  4IK2 A;  4F9U A;  4YU9 A;  2JA7 I;  2CTB A;  3H0G I;  1QVF Y;  4M6I A;  2OOY B;  2G0B A;  3M4O I;  3RZO I;  4RS2 A;  2ZEM A;  4JXR A;  4P4E A;  1YIT 1;  2R92 I;  4Y49 C;  4HPS A;  5C4J I;  4CYN A;  1XMT A;  4ZY0 A;  1XMB A;  2E7Z A;  4A3B I;  5IB9 A;  1KWM A;  5ISV A;  3GY9 A;  4II9 A;  3D7G A;  4BY1 I;  4MCQ A;  3GTL I;  2K5T A;  5LRJ A;  4E8O A;  1KC8 2;  2CIJ A;  2RC4 A;  5HH1 A;  1N8R 2;  1TKF A;  3NE8 A;  3J81 b;  2JIO A;  4HH4 A;  3SXN A;  4E32 A;  5A2Q b;  3CCL 1;  4CYP A;  3B3C A;  4UBR A;  1DE4 C;  4R76 A;  4UA3 A;  1NE9 A;  4CYQ A;  4MBU A;  2RIQ A;  2OZG A;  3CXC Z;  3D7F A;  1LQL A;  3MN8 A;  1TWF I;  2GU2 A;  3FNC A;  1K8A 1;  3P2H A;  4CGL A;  3WAB A;  1M90 2;  1WZN A;  1AMP A;  3M3Y I;  1NSA A;  5C88 A;  1VQ6 Z;  4Y7N I;  3FBU A;  4Q7A A;  1M4I A;  2PJC A;  3PO3 I;  2REE A;  2IJZ A;  3PO3 S;  2RFH A;  2WUU A;  4MJ8 A;  3IFU A;  3WC7 A;  3I55 1;  1KQS Y;  1R43 A;  4A3D I;  3BHX A;  4FD7 A;  2VBQ A;  1XOV A;  2OU2 A;  3EFA A;  4LQG A;  1Q2D A;  2V8J A;  2IQ6 A;  4C7I A;  3RZA A;  1TXR A;  5E96 A;  4H2K A;  4WJB A;  1YSJ A;  2PMZ A;  4KSA A;  5HXD A;  4CAF A;  3RBU A;  5IT9 f;  1IU8 A;  3EED A;  2EUI A;  1Z4E A;  2ZEF A;  4DQY B;  5EBV A;  1F2P A;  3B2Y A;  2JNY A;  3B3V A;  4MCS A;  4KUA A;  1VIX A;  2EBJ A;  4JXQ A;  3IF8 A;  3SJE A;  1Z5R A;  2KPI A;  2ZED A;  3J80 b;  3BI0 A;  2PIZ A;  2OZU A;  5J8F A;  3S15 I;  2ZEP A;  1TKJ A;  2RBL A;  5EC4 A;  4NB8 A;  3SJX A;  2C6P A;  5KTA A;  1TF8 A;  2POK A;  4KSI A;  4EVY A;  3BG0 B;  1ZH1 A;  4X3R A;  4M6H A;  5G22 A;  2QRC B;  3GTM I;  1I1D A;  2PR8 A;  3GTM S;  4E2Z A;  3MZL B;  2ZOG A;  4H6Z A;  1M4G A;  1Q2C A;  2V8K A;  3S2H I;  4OC0 A;  3NH8 A;  1FNO A;  2VI7 A;  2GRE A;  2W04 A;  2Z3P A;  2Y0S A;  5A28 A;  4F0Y A;  4BBS I;  1USP B;  2HU9 A;  5IX3 A;  2I00 A;  4UCM A;  5HMN A;  3FF3 A;  1QVG Z;  1EE3 P;  2Q0Y A;  2YNC A;  1Q81 1;  3D9X A;  3DLJ A;  4R7M A;  1KRL A;  3CPW Z;  3CCU 1;  2BL1 A;  3H8G A;  3S1N I;  3IFE A;  1K8A 2;  3CT9 A;  1X10 A;  3CXQ A;  1QXF A;  3IWW A;  5KTD A;  4QVT A;  2FT0 A;  2K3R A;  4AVA A;  4CAX A;  4UWJ A;  2HB6 A;  4K3N A;  2VZY A;  3IIB A;  1CPX A;  2WB1 A;  7CPA A;  3CC7 Z;  3S1Q I;  4CAE A;  2J8N A;  4C68 A;  1SQH A;  1JJ2 Y;  4IAV A;  1R9T I;  4AVB A;  2AFW A;  2LFU A;  5JH9 A;  2DPT A;  3NFZ A;  4F6A A;  4ZX9 A;  3I3G A;  3KAS A;  4P44 A;  4S1T A;  3PFO A;  4A32 A;  4FD5 A;  3S9L A;  3J81 f;  3E0K A;  2P0W A;  3HOX I;  5A2Q f;  2ZW7 A;  1Q2Y A;  4DUK A;  3S6K A;  1SFO I;  4A39 A;  5J8C A;  3PEI A;  4MMO A;  5BWA B;  3HLP A;  1ZO0 A;  3QAY A;  4L8A A;  1J4J A;  3JUW A;  4KZT A;  2J8M A;  4OC1 A;  2PJB A;  1IB1 E;  4QTU A;  3DR8 A;  3VMH A;  3B3W A;  5EMI A;  2RHB A;  4UCP A;  3G8W A;  1DL6 A;  2J6A A;  2RT9 A;  1TF9 A;  3VTN A;  2AE6 A;  3GTJ I;  5FLM I;  2D4P A;  1MK4 A;  4UIA A;  2WZN A;  4E2Y A;  4R3K A;  3V7Z A;  1RNI A;  4Y52 I;  4A3M I;  4XPL A;  5AGE A;  4X8I A;  5AN9 F;  2R93 I;  4B5P B;  3H8E A;  2IZ4 A;  2CY2 A;  2Z3L A;  2Q44 A;  3I56 1;  3CCV 1;  1IY7 A;  2PJ7 A;  3KGQ A;  3F3P C;  4NBH A;  3CD6 1;  4X6A I;  3P5J B;  1R57 A;  3IWE A;  4NH1 C;  2V77 A;  5LYI A;  1S7L A;  3S9M A;  1B87 A;  1WWZ A;  1XJO A;  4C2Y A;  1F57 A;  2Z3M A;  1Z8X A;  3FEE A;  1S72 1;  4I49 A;  1YK3 A;  1QQ9 A;  2FVG A;  4NB9 A;  3I07 A;  2V8G A;  3CCJ 1;  2AFO A;  3BXM A;  2B4D A;  2K5R A;  2FS5 A;  5AG7 A;  1P0H A;  2KI7 B;  4A38 A;  4GXH A;  1FDI A;  1QVF Z;  2IZ3 A;  2QML A;  4Z65 A;  1VQO 1;  4M85 A;  2M6N A;  1VQN 1;  1TIQ A;  2R6M A;  4CAW A;  4FBE A;  1YGH A;  4MXU A;  3GKQ A;  3ISZ A;  3G4S 1;  1Q7Y 1;  3KHZ A;  3T9Y A;  1VHO A;  3BLN A;  4UEF A;  1YJ9 1;  4TWE A;  3SI0 A;  4PPZ A;  4KOW A;  3CME 1;  4OIW A;  2YAD A;  1ELM P;  5I4M A;  4B14 A;  3ISX A;  4MCP A;  2ZPA A;  5LRG A;  2JA6 I;  2Z0Z A;  4F8Z A;  1RLY A;  4JZ0 A;  4XNH B;  1VQ5 1;  2ZEG A;  3D68 A;  3TO9 A;  3DR6 A;  1VQK Z;  4PXB A;  3TFY A;  1Y0R A;  2Z10 A;  1OZP A;  2Q43 A;  2NMT A;  2NVX I;  2VPY A;  4DNC A;  3H3V J;  2FCK A;  2CF4 A;  4A3E I;  3GUX A;  4OKO A;  2QRE B;  1YUK A;  2JR6 A;  3D6W A;  4BXX I;  3VMI A;  3MON A;  3HKZ A;  4LUA A;  3TTH A;  3SI1 A;  2JUB A;  1CP6 A;  3IR7 A;  2B58 A;  2DXQ A;  2D4O A;  4E30 A;  4YRH A;  1QMU A;  1N2F A;  4PK2 A;  4NGP A;  2AFZ A;  2O4H A;  2NSM A;  4P4D A;  3KR4 A;  3NA6 A;  2NYQ A;  4NGN A;  1PCA A;  4MFL A;  4JWP A;  1VQM 1;  2P6G A;  3BI1 A;  3IGR A;  3H4Q A;  3S9N A;  4A31 A;  2CNT A;  5H86 A;  4UIB A;  3GTO I;  2PJ8 A;  1VQ7 1;  3RYO A;  2I79 A;  5K8O A;  3F3F C;  2B3V A;  3SJF A;  2E2J I;  2G9D A;  3LWU A;  3G6E Z;  1FT7 A;  2ZEH A;  1I6H I;  4R9M A;  3GTK I; 
#chains in the Genus database with same CATH homology
 2C1C A;  1CG2 A;  3WC7 A;  5T6B A;  3I55 1;  4NBD A;  1KQS Y;  3PBE A;  2VUM I;  1VQP 1;  5HVH A;  2O53 A;  1R43 A;  2JS4 A;  3JRU A;  4A3D I;  3CCQ 1;  1AYE A;  1TKH A;  3RAM A;  2E9H A;  1X3Z A;  3BHX A;  3KQX A;  1BPN A;  4NGR A;  4BD9 A;  3G71 1;  2ABZ A;  3LUS A;  1XBU A;  1M1K 2;  1YJW 1;  3CPA A;  3CCS Z;  1Q81 2;  4LQG A;  3KI9 A;  2V8J A;  2IQ6 A;  5JM6 A;  1K9M 1;  1VQ6 1;  3RZA A;  2PCU A;  3FKI I;  2PRQ A;  1USP A;  4RVF A;  1TXR A;  3BG1 B;  2W03 A;  3WC6 A;  5D29 A;  1BLL E;  4H2K A;  4WJB A;  2ZEE A;  1YSJ A;  4WWV A;  2NVY I;  2PMZ A;  5HXD A;  3VH9 A;  2PJ0 A;  3VAR A;  3S1R I;  1JWH C;  3RBU A;  1Q82 1;  4NGM A;  4OC4 A;  2DE6 A;  4PXC A;  5IT9 f;  4RVG A;  3PB9 X;  3EED A;  3MZK B;  3OW2 Y;  3JAM b;  1YHQ Z;  2PJ9 A;  2AFX A;  3G6E 1;  3TE5 B;  1YI2 Z;  1Z8L A;  2ZEF A;  4DQY B;  2GLJ A;  4OME A;  2OR4 A;  1CPS A;  1F2P A;  3B2Y A;  3FEC A;  2JNY A;  2PJA A;  3B3V A;  3N5F A;  4MCS A;  6CPA A;  1VIX A;  2F7V A;  3IF8 A;  3SJE A;  1RTQ A;  4OC5 A;  1BPM A;  1Z5R A;  2KPI A;  3B7I A;  1ELL P;  4UEZ A;  3I1U A;  2ZED A;  4RV9 A;  3J80 b;  3I4N I;  2R7Z I;  3BI0 A;  5LYF A;  3IO1 A;  1LFW A;  4A3J I;  2PIZ A;  3K9T A;  3FH4 A;  3S15 I;  2ZEP A;  2H85 A;  8CPA A;  1TKJ A;  1RO0 A;  2RBL A;  3GTG I;  2AFM A;  3KIF A;  4NB8 A;  3SJX A;  3CCS 1;  2C6P A;  1Z01 A;  1TF8 A;  2POK A;  1XRY A;  4MD9 A;  3H8F A;  4KSI A;  2IMO A;  4MHY A;  2PVV A;  3KL9 A;  4CL1 A;  5FLX f;  2V8V A;  3BG0 B;  2QJ8 A;  1Q86 1;  1VQL Z;  1ZH1 A;  2E2I I;  4X3R A;  2AKL A;  2QRC B;  3GTM I;  3CCU Z;  4R6T A;  5C4X I;  5D1P A;  1YW4 A;  1DTD A;  5LYD A;  4EWC A;  1Q7Y 2;  1RQF A;  3IJ3 A;  3GTM S;  1QYP A;  2JBK A;  3B35 A;  4E2Z A;  3MZL B;  3FVL A;  2ZOG A;  4P4B A;  5CBM A;  1YLO A;  3TDH B;  4JYW A;  2VL1 A;  1Y7E A;  4XX2 A;  4NBC A;  2ZAE B;  2V8K A;  1YHQ 1;  1VQ8 1;  4MH4 A;  2V8H A;  2J9A A;  4NGQ A;  3S2H I;  4A3L I;  4OC0 A;  4EWT A;  5HVG A;  5THW A;  3K7A I;  5LL6 f;  3T8W A;  4DJL A;  1X0T A;  3NH8 A;  3D66 A;  1FNO A;  2GRE A;  2W04 A;  5C3E I;  2Y0S A;  3PBB A;  2JA8 I;  5J1Q A;  3CMA Z;  4NBA A;  1USP B;  4BBS I;  2HU9 A;  2ZOF A;  1NJI 2;  4RS4 A;  1LOK A;  4RVD A;  1IGB A;  3FF3 A;  4TNU A;  4PQA A;  2EK9 A;  1QVG Z;  4A3F I;  3I4M I;  2PVW A;  2C6C A;  1NP6 A;  4E2X A;  1EE3 P;  3D67 A;  4ZX8 A;  4AXV A;  1Q81 1;  2BCO A;  3D9X A;  4NJQ A;  4O23 A;  2RPR A;  2HC9 A;  3DGV A;  1F2O A;  4FUU A;  1NUI A;  3CPW Y;  3VAT A;  3DLJ A;  3KHX A;  5LRK A;  4R7M A;  1VQL 1;  3VB9 A;  3WT4 A;  1KRL A;  3PRT A;  4A94 A;  3CPW Z;  3CCU 1;  3U50 C;  3H8G A;  4HGY A;  3KZW A;  1XFO A;  2PJ1 A;  3S1N I;  2BJO A;  3IFE A;  1K8A 2;  3CT9 A;  3ESW A;  3RZD I;  1PYT B;  2EK8 A;  2RB7 A;  3IWW A;  1KQS Z;  1K83 I;  1VQ4 Z;  2ZEL A;  4ONW A;  3KR5 A;  2QYV A;  2GLF A;  5HVF A;  3CC2 1;  2K3R A;  3B3S A;  4A93 I;  1L1O C;  3QNV A;  2HB6 A;  1VGY A;  3J7A 4;  3JAM f;  3CDX A;  4K3N A;  1LAP A;  2JEW A;  3VMG A;  2QKD A;  3IIB A;  1CPX A;  2WB1 A;  4B6Z A;  7CPA A;  4NJR A;  1KD1 2;  3CC7 Z;  3S1M I;  3S1Q I;  3CMA 1;  4FAI A;  3HUV A;  4NFR A;  1JJ2 Y;  4IAV A;  1KC8 1;  1WII A;  2EGT A;  5JGF A;  4MD8 A;  2OZK A;  1LAN A;  2PE3 A;  3CCM Z;  1R9T I;  3S16 I;  2ZEN A;  1UWY A;  4F9V A;  1ZB9 A;  3LMS A;  1N8R 1;  2AFW A;  2LFU A;  2PIY A;  5JH9 A;  3J80 f;  3MRU A;  3IC1 A;  3NFZ A;  4P6Y A;  2C6G A;  4ZX9 A;  1ZLH A;  2XEF A;  1VQ9 Z;  4UEE A;  4DYO A;  3KAS A;  2I3C A;  4NBG A;  1OBR A;  4S1T A;  2QEX Z;  1VQ8 Z;  3PFO A;  4P44 A;  3EER A;  2QR1 B;  4OC2 A;  2JA5 I;  3S9L A;  3J81 f;  4DK1 A;  5LYL A;  3HOX I;  3OW2 Z;  5A2Q f;  4DUK A;  1WCM I;  4NBE A;  3NDI A;  1SFO I;  4A39 A;  3NH5 A;  1TWG I;  3PEI A;  4MHN A;  4MMO A;  4P4I A;  4YWY A;  5K8P A;  4A3I I;  4ZY2 A;  1VQ4 1;  3HLP A;  1M4L A;  2PJ3 A;  1M90 1;  2XEI A;  1TWC I;  1CBX A;  2M48 A;  2PK7 A;  1Z02 A;  2PM9 A;  4ZY1 A;  4G1P A;  3FMC A;  1K73 1;  3KIH A;  3S2D I;  1K9M 2;  4BY7 I;  1H8L A;  4OC1 A;  2DE7 A;  1R3N A;  2PJB A;  3CC7 1;  1WW9 A;  4QTU A;  3I56 Z;  5K8N A;  2DEA A;  3IEH A;  3CCV Z;  3VMH A;  3B3W A;  2XEG A;  2CTC A;  2RHB A;  3CCE Z;  5IT9 b;  3CCM 1;  3CD6 Z;  1YME A;  1HEE A;  1DL6 A;  2J6A A;  2PJ5 A;  2WAQ A;  3IX0 A;  2EWB A;  3CPX A;  1Q82 2;  2JMO A;  2RT9 A;  1TF9 A;  3GB0 A;  1ARM A;  3VTN A;  1ZLI A;  4NBF A;  1VQ9 1;  1P9N A;  3GTJ I;  5FLM I;  5F09 A;  1RO4 A;  3CC2 Z;  2QEX 1;  3B3T A;  3FX6 A;  4UIA A;  5K8M A;  2Q4Z A;  2WZN A;  3GCF A;  3S17 I;  4E2Y A;  3GLJ A;  4RUH A;  1YJN Z;  3KQZ A;  1S72 Z;  3V7Z A;  3PB4 X;  1RNI A;  5T67 A;  4Y52 I;  4A3M I;  1YIJ 1;  3GTQ I;  3V38 A;  4R8F A;  3CQZ I;  3CCJ Z;  3CC4 Z;  1Y1V S;  2OTL Z;  3SI2 A;  4DGL A;  3TC8 A;  4X8I A;  5AN9 F;  2R93 I;  3NDJ A;  3H8E A;  3S14 I;  4ZYQ A;  2Q51 A;  4MON A;  1BAV A;  2QLV B;  5D1O B;  5FLX b;  3CCR Z;  3Q87 A;  3GTP I;  4P4J A;  1M1K 1;  1CP7 A;  2IZ4 A;  4BBR I;  2QA4 Z;  1VQO Z;  1VQN Z;  4UF4 A;  1TFI A;  2AFU A;  4EFD A;  3I56 1;  4MD7 A;  3CCV 1;  1IY7 A;  3FED A;  2PJ7 A;  3KGQ A;  3G4S Z;  1YIT Z;  4E33 A;  4MCR A;  3CCE 1;  3F3P C;  4NBH A;  4NGS A;  3CD6 1;  4X6A I;  3P5J B;  3PB6 X;  1YJ9 Z;  5D8N A;  4NH1 C;  2V77 A;  3CME Z;  5LYI A;  2GTH A;  2VUG A;  3S9M A;  1XJO A;  2NVQ I;  3TX8 A;  2F4O A;  4HGZ A;  1TWA I;  1F57 A;  5C44 I;  2P28 A;  1QF8 A;  2OTJ Z;  4P10 A;  1YJN 1;  3FEE A;  1S72 1;  1LAM A;  1W2B Y;  1Z03 A;  1YUA A;  3FQM A;  1QQ9 A;  2FVG A;  4NB9 A;  3I07 A;  2V8G A;  2NVT I;  1ZG8 A;  1W2B Z;  3CCJ 1;  3CC4 1;  2AFO A;  3BXM A;  4OID A;  2K5R A;  1VQ5 Z;  2OTL 1;  3PFE A;  1S7M A;  4IK2 A;  4ZI6 A;  4NGT A;  4F9U A;  4YU9 A;  4W9Y A;  2V8D A;  1JQG A;  2JA7 I;  2CTB A;  3HOW I;  2PJ4 A;  3H0G I;  1QVF Y;  1JJ2 Z;  2KI7 B;  5D1O A;  4A3C I;  4A38 A;  3CCR 1;  2OOY B;  3M4O I;  3CCL Z;  4E31 A;  1GYT A;  3SJG A;  1QVF Z;  2IZ3 A;  1ZG7 A;  2JBJ A;  4Z65 A;  2QA4 1;  1VQO 1;  2M6N A;  1VQN 1;  3PB7 X;  1YW6 A;  3RZO I;  1VHE A;  1Y0Y A;  2R6M A;  4FBE A;  4MXU A;  5ELY A;  4PXD A;  2YU9 I;  1TWH I;  2ZEM A;  3GKQ A;  1YIJ Z;  3ISZ A;  4P4E A;  1CX8 A;  3G4S 1;  5CPA A;  1YIT 1;  1Q7Y 1;  3KHZ A;  2R92 I;  2OOX B;  1VHO A;  4UEF A;  3FJU A;  5C4J I;  1YJ9 1;  4TWE A;  3SI0 A;  4FWU A;  3HOZ I;  4P4F A;  4PPZ A;  4ZY0 A;  3CME 1;  4OIW A;  1XMB A;  4IHM A;  5IB9 A;  2YAD A;  4A3B I;  4X2T A;  1ELM P;  5I4M A;  2GTI A;  1VLA A;  3QWU A;  1KWM A;  4MHP A;  4NBB A;  4NOZ A;  5T64 A;  3HOV I;  2F8H A;  3D4U A;  3D7G A;  3ISX A;  2OTJ 1;  1Q7L A;  4MCP A;  4BY1 I;  4MCQ A;  1Y1W I;  4RVH A;  3GTL I;  1VQM Z;  5LRG A;  2JA6 I;  3T4N B;  4P45 A;  5LRJ A;  1NJI 1;  4F8Z A;  1RLY A;  4JZ0 A;  1VQ5 1;  2ZEG A;  3D68 A;  1X3W A;  1KC8 2;  3PB8 X;  2CIJ A;  1VQ7 Z;  2ZEO A;  1VQK Z;  4PXB A;  5IP7 I;  1N8R 2;  1TKF A;  3D7D A;  2B63 I;  2AFS A;  1Y0R A;  5IP9 I;  3J81 b;  4A37 A;  3FQQ A;  2Q43 A;  4HH4 A;  4E32 A;  5A2Q b;  3CCL 1;  2NVX I;  2XEJ A;  3H3V J;  3B3C A;  2CF4 A;  3CXC Y;  4A3E I;  1DE4 C;  3GUX A;  4R76 A;  4OKO A;  2QRE B;  1YUK A;  2JR6 A;  1HDQ A;  2RIQ A;  3D6W A;  2DE5 A;  2LIY A;  4BXX I;  3VMI A;  3MON A;  1Y1V I;  3CXC Z;  3HKZ A;  3D7F A;  1LQL A;  2F4M A;  1TWF I;  3I55 Z;  2GU2 A;  3MN8 A;  3SI1 A;  1VQP Z;  2JUB A;  1ZB8 A;  1K8A 1;  1CP6 A;  2BOA A;  1I3Q I;  2WYR A;  4CPA A;  3NH4 A;  3WC5 A;  4E30 A;  3CCQ Z;  1QMU A;  1Z2L A;  4OC3 A;  3WAB A;  2OOT A;  1LCP A;  4PXE A;  1M90 2;  1N2F A;  2E2H I;  4MRI A;  4NGP A;  3G71 Z;  2AFZ A;  2O4H A;  1YI2 1;  1AMP A;  1HDU A;  2BO9 A;  2NSM A;  3M3Y I;  3K2K A;  3L2N A;  1YJW Z;  4P4D A;  3KR4 A;  1ARL A;  3NA6 A;  2NYQ A;  4NGN A;  1PCA A;  1NSA A;  4A3K I;  1K73 2;  1VQ6 Z;  3HOU I;  2G2K A;  2PJ6 A;  1VQM 1;  1KD1 1;  1Q86 2;  4A3G I;  2VF1 A;  3BI1 A;  3S9N A;  1QVG Y;  1PFT A;  1ZG9 A;  5CM2 M;  4QTT A;  5DS0 A;  4Y7N I;  4Q7A A;  2QVP A;  2PJC A;  3GTO I;  4UIB A;  3PO2 I;  2PJ8 A;  3PO3 I;  1VQ7 1;  1I50 I;  1VQK 1;  2IJZ A;  2PJ2 A;  4E2W A;  3D7H A;  4MHZ A;  5K8O A;  2ANP A;  3F3F C;  4GM5 A;  2V8I A;  3PO3 S;  3SJF A;  2QRD B;  2E2J I;  2P3Y A;  2G9D A;  3LWU A;  4OP4 A;  1ML8 A;  1RO2 A;  3G6E Z;  4EME A;  1FT7 A;  3HOY I;  2RFH A;  2ZEH A;  1I6H I;  4AYB A;  3IFU A;  2HF1 A;  3GTK I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...