2O4HA

Human brain aspartoacylase complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o4hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o4hA01
1Y0RA 3FVLA 3GUXA 1XFOA 3KHXA 5IB9A 2C6CA 1YMEA 1AYEA 4PQAA 2OR4A 4PXCA 2AFXA 2O4HA 2AFMA 1TF9A 1CX8A 2PVWA 2ZOGA 3IWWA 4MCRA 3TC8A 3SJGA 3D67A 2JBJA 2Q51A 1VGYA 2ZOFA 2PJ4A 3D4UA 3SI1A 2EWBA 2NSMA 4UIAA 1FT7A 3PB4X 2XEFA 2GU2A 2NYQA 3D68A 3LWUA 2ANPA 4PXDA 3L2NA 4IAVA 3PBBA 3PBEA 1CP7A 5I4MA 3QNVA 4WWVA 3LMSA 4A38A 2Q4ZA 3VH9A 2XEJA 3FEEA 4UIBA 5K8PA 3S9NA 3D7HA 3SI2A 4NJQA 3CPAA 2V8HA 1YW6A 2PRQA 3KQXA 3D7FA 3WABA 1XRYA 4DYOA 4JZ0A 2Q43A 3BXMA 1ARLA 3TX8A 3B35A 4P6YA 4NGQA 2C6PA 4YU9A 4ZX9A 1Y0YA 1F2PA 2PJ1A 4A39A 3NA6A 1LAPA 3H8FA 4A37A 2DEAA 4P4JA 3D66A 4OIWA 4UEFA 2ZEGA 3KGQA 1Y7EA 2RFHA 5THWA 3FH4A 4P4BA 4OMEA 3B3TA 2CTBA 8CPAA 2PE3A 3FEDA 1LCPA 4FWUA 4MCQA 3T8WA 1BAVA 2ZEMA 5D29A 2JEWA 5LYIA 1ZG7A 1YSJA 4MCSA 2ZEEA 3IIBA 6CPAA 2VL1A 2I3CA 5HVGA 4F9UA 4PXEA 4P4IA 4EMEA 2ABZA 5LRKA 2AFSA 4P4DA 1NSAA 1R43A 2IMOA 4R6TA 2BOAA 3IEHA 4NGSA 4F9VA 3JRUA 5F09A 3FX6A 3H8EA 3RZAA 4FAIA 3WC7A 1CP6A 4NGNA 2HC9A 2ZEPA 5HXDA 2ZEFA 1DTDA 1F57A 3NH4A 2ZELA 2AFOA 2C6GA 3H8GA 5CPAA 4OC1A 2XEIA 1QQ9A 2RB7A 2JBKA 1M4LA 5ELYA 4KSIA 3WT4A 4AXVA 3PB6X 5JM6A 1LFWA 2C1CA 2PIZA 4OC5A 1GYTA 4OC0A 1VHEA 4WJBA 3DGVA 4B6ZA 4F8ZA 3V38A 5HVHA 1HDUA 3S9MA 3IO1A 4NFRA 1Z5RA 5J1QA 3B3CA 1ZG9A 4G1PA 4PXBA 4R76A 2V8DA 3DLJA 2PJBA 3KASA 4TNUA 2PJAA 4Q7AA 2PJ5A 4FUUA 1XBUA 3WC6A 4FBEA 3NH5A 4R7MA 3K9TA 2V77A 5LRJA 5LRGA 3GLJA 1QMUA 3ISZA 3KHZA 3HUVA 1FNOA 3IFEA 4ZY1A 1TF8A 4EFDA 2PIYA 3VATA 2PCUA 3D7DA 1HEEA 3PFEA 1ELMP 2QYVA 1H8LA 4IHMA 4ZY0A 2ZEDA 4NGMA 1UWYA 2POKA 3B2YA 1IGBA 2AFWA 3B7IA 3KR5A 5K8OA 3I1UA 3KL9A 2WZNA 4MMOA 1BPNA 4MHPA 1PCAA 3B3WA 1LOKA 1CG2A 4P4EA 5LYFA 4H2KA 2ZENA 2O53A 4P45A 3RBUA 4MHZA 1Z8LA 1OBRA 3CPXA 4MHYA 4NGRA 3MN8A 2PJ3A 1XMBA 2PJ7A 4LQGA 5K8NA 1LANA 2V8GA 3BHXA 5K8MA 2PVVA 4X3RA 7CPAA 1HDQA 1JQGA 2QJ8A 4ZYQA 3PB7X 2PJ6A 2GLJA 4NGTA 2BO9A 3SJFA 1ZLIA 3BI0A 3FF3A 2PJ9A 3ISXA 5CBMA 4K3NA 4X2TA 4O23A 3N5FA 2EK8A 1CPXA 2PJ8A 4P4FA 3PB9X 3VARA 2WYRA 2GLFA 3SJEA 5LYLA 4OC2A 2CF4A 2FVGA 1KWMA 1YW4A 3KQZA 1VHOA 4BD9A 4MCPA 3K2KA 2XEGA 3PFOA 4JYWA 4OC3A 1LAMA 2QVPA 3HLPA 5DS0A 4A94A 2F7VA 4OKOA 1AMPA 2EK9A 5JH9A 1TKFA 4CPAA 4Z65A 2ZEOA 3FECA 4OIDA 3PRTA 3PB8X 3NH8A 1BPMA 1BLLE 4NGPA 5HVFA 2PJCA 3SI0A 4ZY2A 4ONWA 3IJ3A 4X8IA 1XJOA 1TXRA 2IQ6A 5LYDA 4TWEA 5D8NA 1ELLP 4MXUA 1RTQA 2AFUA 3BI1A 3WC5A 1ZLHA 1Z2LA 3B3VA 4P44A 4EWTA 3SJXA 1F2OA 4IK2A 2V8VA 2CTCA 4DJLA 3FMCA 2F8HA 4MRIA 1VIXA 1ARMA 1R3NA 1IY7A 1EE3P 1PYTB 3KR4A 2AFZA 4YWYA 3KZWA 4ZX8A 1ZG8A 3V7ZA 5JGFA 2J9AA 3GB0A 4PPZA 2BCOA 1TKJA 2G9DA 2ZEHA 2PJ0A 3KI9A 1CBXA 3NFZA 4UEZA 3FJUA 2CIJA 1CPSA 1YLOA 3IC1A 3S9LA 4UEEA 4DUKA 4MHNA 3CDXA 4RUHA 1DE4C 1TKHA 2PJ2A 4W9YA 4R8FA 3CT9A 3MRUA 2HB6A 2OOTA 4UF4A 4NJRA 2GREA 4ZI6A 3RAMA 3D7GA 2IJZA 1Q7LA 4OC4A 3PEIA 3B3SA 4P10A 4OP4A 4GM5A
chains in the Genus database with same CATH superfamily
3FVLA 3GUXA 4RV9A 3KHXA 1L1OC 2HU9A 5IB9A 1YMEA 1AYEA 4NB9A 2B4DB 4KUBA 1RNIA 1IOFA 1TF9A 1PFTA 3D67A 3D4UA 2V3VA 4Y49C 3T90A 3DR6A 4IF5A 2FIWA 4UFXA 2ANPA 4R3LA 2R7ZI 1Q861 4XPLA 3CXPA 2KI7B 4KVXA 4A38A 1M4DA 3VH9A 4UIBA 1I3QI 1JJ2Z 3S9NA 2QMLA 2E2II 1YR0A 2OU2A 3NDIA 4R3KA 3TE5B 1KUVA 1XRYA 1LQLA 3CC41 3CXCZ 4DYOA 1Z01A 3RZDI 2JR6A 2YNDA 3TX8A 3B35A 1S7MA 1K8A2 1TWAI 2G3TA 2H5MA 1N71A 1F2PA 1MJ9A 2YNCC 4A37A 3CCV1 2Y0SA 5DWNA 4E8OA 1Y8CA 3M4OI 3KGQA 2E2HI 1Y7EA 2RFHA 1Y7RA 3CC7Z 4P4BA 4CRZB 1YK3A 1Q2CA 1KRLA 3HOXI 1X0TA 4FWUA 3T8WA 2RC4A 2LEXA 5F46A 4B5PB 6CPAA 4EWCA 4PXEA 4RS2A 2Z3KA 2YGWA 1ZB8A 4CGPA 2VUGA 2ODFA 2RPRA 3G6EZ 4P4DA 5IB0A 4HNXB 3GYAA 4X5KA 3P2HA 3TCVA 3IEHA 4F9VA 4RVGA 2PDOA 3IX0A 3RZAA 3T9YA 1QVGY 4BBHA 2HC9A 4MY3A 3I07A 3ZJ0A 2ZEFA 2ZPAA 4AVBA 1Z8WA 1VQMZ 2CNMA 4OC1A 2R98A 4CAEA 4NBEA 2JBKA 3FNCA 3QAHA 5ELYA 5C44I 4MHDA 4L8AA 4A3CI 1NJI1 1Q862 3JAMf 4B6ZA 3V38A 2Z3MA 5HVHA 1Z02A 4OADA 1Z5RA 5D1PA 2QA41 1YJW1 1MK4A 2V8DA 2HUZA 4J3GA 3IU1A 4S1TA 4MFZA 3IGRA 4E33A 1Z4RA 4MFQA 3WC6A 5BWAB 5LRJA 2V77A 3MONA 2OZHA 1VKCA 1Q2DA 4ZY1A 3C26A 1VQO1 5JPHA 3D2MA 2PIYA 1VQP1 1M4GA 1VQPZ 3D7DA 4DQYB 3NE8A 1AA6A 5AG6A 1VQ6Z 2QYVA 3GCFA 4IHMA 4MI4A 3CXQA 3PO2I 4NGMA 3VB9A 1YJ91 2Z3NA 2OB0A 2AFWA 3RO0A 3KL9A 4MMOA 2YU9I 1BPNA 3IF8A 1PCAA 2B5GA 4AVCA 3PO3S 2M48A 1LOKA 4H2KA 2ZENA 1VQ81 1NMTA 1VQ8Z 3OW2Y 3EY5A 3EERA 1Z8LA 4MHYA 4E2YA 1YGHA 3CCJ1 2DXQA 2D4OA 2V8JA 4B14A 2PJ3A 3R96A 3R1KA 4A3EI 3CCJZ 3S6FA 1TWGI 2PJ7A 5K8NA 1WJ2A 3I4MI 4QB9A 2V8GA 4AG9A 2PVVA 5FLXf 4KVOE 2R7HA 2QJ8A 3HOYI 3EFAA 2GLJA 2J8MA 1NJI2 4QUSA 3TT2A 2AKLA 3BI0A 4L89A 4A30A 2PJ9A 3ISXA 4JWPA 5CBMA 4K3NA 4X2TA 1CJWA 3N5FA 2EK8A 4O23A 3FYNA 1VQ9Z 3VARA 1W2BY 2EUIA 2WYRA 5T6BA 4E2XA 3SJEA 1QVFY 4KSAA 4OC2A 3GKRA 4FD6A 1YW4A 4RVFA 4BXXI 1P4NA 1VHOA 4MCPA 2XEGA 4JYWA 3CCR1 4OC3A 3HLPA 3TE4A 1AMPA 4CPAA 4E32A 1WZNA 1VHSA 3J7A4 4NOZA 3GTMS 3FQMA 4OIDA 4U5YA 3PRTA 4DK1A 3S2DI 3K9UA 2EGTA 4C2ZA 3SI0A 4ZY2A 3S6HA 4ONWA 3IJ3A 3CMAZ 4OLLA 4QTUA 4KSFA 4Y52I 1RTQA 3JAMb 2AFUA 1QSMA 1YIT1 4B12A 1X3ZA 1YITZ 3KIFA 4KZTA 4ONUA 4DNCA 1XF8A 4MONA 2ARHA 2F8HA 2R8VA 4MRIA 1IY7A 3MGDA 1PYTB 4NBDA 3KR4A 3NDJA 3ZZIA 2WPWA 4H6ZA 1ZH1A 3KZWA 4GXHA 3GB0A 2BCOA 1XE4A 1YVOA 2ZEHA 2PJ0A 2ZXVA 2JS4A 3P5JB 3P2FA 1S7NA 3FJUA 4B11A 4CGLA 1I21A 1WIIA 1RLYA 3GIUA 1K9M1 4CRYB 3IR7A 1DE4C 1TKHA 4E31A 3CPWY 1VQK1 2QR1B 2ZW4A 3MRUA 1USPB 5AGEA 2VPXA 2DE5A 3RAMA 2BL1A 1NUIA 3D7GA 2JIQA 1Q7LA 4OC4A 3PEIA 3B3SA 3M3YI 4P10A 4OP4A 3CME1 1VQ51 5D1OB 1Y0RA 2BUEA 4E2ZA 4NH1C 4JXRA 4PXCA 1S7FA 3CCL1 3A9LA 4F0YA 4A3LI 3CCLZ 2PVWA 4MCRA 2JBJA 2Q51A 3W6XA 4PK2A 3PB4X 4MFKA 2NYQA 3D68A 5FLXb 3D2PA 3L2NA 3QWUA 1N8R2 3QNVA 3S14I 5K8PA 1VQL1 2B4DA 1YW6A 3WABA 2LFUA 3FB3A 2BEIA 3RZOI 4M6IA 3KKWA 1S721 2Q43A 1ARLA 4P6YA 3S1MI 4NGQA 4RS4A 4ZX9A 4KOSA 1Y0YA 1XOVA 2PJ1A 2K3RA 2F5IA 1YVKA 1TWCI 3GTPI 1N2FA 4KLVA 1Y1VI 4NBGA 1M1K1 2GANA 4ZGYB 5A27A 3D66A 4UEFA 2VPWA 1VQNZ 3CCQZ 4KOXA 5EBVA 3E0KA 2PE3A 2G0BA 1K9M2 5HMNA 2VPYA 1LCPA 3S1NI 1BAVA 5LYIA 4A3JI 2PC1A 5KTCA 3W91A 3IIBA 5HVGA 5KTAA 4QVTA 2JLMA 4U9ZA 3BG0B 2M6NA 3SXOA 3G4SZ 1J4JA 4JXQA 4XNHC 2PRBA 4IUSA 2OTL1 3JRUA 2FXFA 2NVYI 2OTLZ 3FX6A 3H8EA 1CP6A 3NE7A 4KLWA 2B3UA 4B5PA 4YRHA 2D4PA 2RB7A 5F47A 4A3FI 1I12A 4KSIA 4AXVA 3S1QI 2JNYA 5JM6A 2W04A 2C1CA 4LQ6A 3GTKI 4PSXA 1Z9UA 4A3KI 4OC0A 1VHEA 1HDUA 3OW2Z 3S9MA 3H0GI 4MBUA 1XIXA 2OTJZ 2IV2X 2VXKA 3B3CA 1ZG9A 4G1PA 3HKZA 3DLJA 2PJBA 1YX0A 4C7HA 1PUAA 4FUUA 2FL4A 2NVTI 4MH4A 2F4MA 1QMUA 2ZW6A 2JMOA 2Q04A 1Q821 3IFEA 2P0WA 4EFDA 1VQ7Z 4MFLA 1M1K2 2K5TA 2WPXA 4YFJA 3PGPA 2Z3OA 1W2BZ 3D6WA 4UFVA 4X6AI 3GTOI 1QVFZ 1CM0A 2PCUA 1IIDA 3DR8A 3PZJA 3SXNA 2V8KA 2CNTA 2F4OA 2Z10A 4NBAA 3CC71 4MFPA 3FIXA 5AG5A 3I4NI 1SIWA 2ZEDA 5C3EI 3B2YA 2NVQI 1UFHA 5K8OA 3KR5A 2WZNA 2WAQA 1CG2A 3CCEZ 3EXNA 3GY9A 4NSQA 3G6E1 1KD11 4BBSI 3CCUZ 3RBUA 2WB1A 2P28A 3TO6A 2DPTA 3MN8A 1IYLA 3R9GA 5FVJA 3D2LA 5K8MA 4QC6A 1VQM1 4HNYB 4Y49B 3OWCA 4JD6A 1X12A 4U9YA 5IP7I 3F3FC 3SJFA 2PSWA 5C82A 1YHQZ 3S17I 1QF8A 1TIQA 2QRDB 2J8RA 2GLFA 5F48A 4AVAA 1KWMA 1DL6A 1QSOA 5G22A 4BD9A 2H85A 2V8IA 2GIVA 2EK9A 2JA8I 5JH9A 1ML8A 2A4NA 1TKFA 1RO2A 3CPWZ 4DGLA 2WSAA 1Q822 2IZ3A 2PR1A 3PB8X 1WK4A 3NH8A 1BPMA 4A32A 1BLLE 4NGPA 5HVFA 3H4QA 1M44A 4X8IA 1M901 4A3GI 2B3VA 2GTIA 5D8NA 1ELLP 4MXUA 1YLEA 4M6HA 1VQ61 1ZLHA 2EVNA 1FDIA 1IOIA 4HGYA 1ON0A 4KOYA 3SJXA 2V8VA 2JEVA 2G2KA 2CTCA 3RYOA 1R3NA 5J8FA 1KD12 3TFYA 2QKDA 1BOBA 4NBFA 2GE3A 2QIRA 3CZXA 4ORFA 3V8IA 4CYOA 3GTGI 2J9AA 1IYKA 1TKJA 2G9DA 3KI9A 4HNWB 2OH1A 1CBXA 4UEZA 2CIJA 3FBUA 1YLOA 4KORA 1Q811 2R1IA 4DUKA 4KOWA 3CDXA 2HV2A 4W9YA 3H3VJ 3CT9A 2OOTA 5G20A 2VF1A 4ZI6A 2JA5I 5ISVA 2IJZA 5E96A 4CS0B 1VQ91 2JDCA 1A2ZA 1Y9WA 4C68A 3F3PC 3D8PA 1XFOA 3I3GA 3S6GA 4PQAA 5JQ4A 4RVDA 4XPKA 2OR4A 1Y1VS 2AFXA 2O4HA 4KS9A 1VQ4Z 2VZYA 5G21A 1CX8A 2ZOGA 3IWWA 3TC8A 3SJGA 3T4NB 4M6GA 1USPA 2PJ4A 2OOYB 3RNZA 3SI1A 5AN9F 2EWBA 2NSMA 4UIAA 1FT7A 2FS5A 2XEFA 2GU2A 1TFIA 4PXDA 4IAVA 1M902 3PBBA 5D1OA 1CP7A 5H86A 3TO7A 4WWVA 2AE6A 2XEJA 2QEXZ 1X10A 3CMA1 4NF1A 3IU2A 4NJQA 1YJN1 2Z3PA 3CPAA 2V8HA 2PRQA 3KIHA 1YJNZ 3KQXA 3D7FA 2GFQA 1YIJZ 4JZ0A 4R57A 3VMIA 2Q4YA 2Q4VA 1Q7Y1 2C6PA 4YU9A 2JIPA 2P6GA 4H6UA 2Q44A 2W03A 3W6SA 3EEDA 4A39A 1LAPA 3SHPA 4P4JA 1XEBA 2ZEGA 1KQSY 4EVYA 4QBJA 5THWA 4CYQA 2DPSA 3FH4A 1Q812 4OMEA 2FE7A 3B3TA 2CTBA 4NCZA 4H89A 2REFA 4MCQA 2EBJA 2ZEMA 3IWGA 4LX9A 1ZG7A 1L0CA 1YSJA 4MCSA 4R9MA 4HKFA 3F0AA 4F9UA 1R57A 2I79A 3QB8A 3I561 1I6HI 2AFSA 3BLNA 3I56Z 1R43A 4FD5A 2IMOA 4R6TA 2BOAA 1RO0A 5CM2M 2FIAA 4XPDC 4MD7A 5F09A 3F5BA 4PK3A 2B58A 4FAIA 3WC7A 2ZEPA 1DTDA 1F57A 2PM9A 2ZELA 2P6EA 5CPAA 4MD8A 1QQ9A 3WT4A 3DSBA 4C2YA 2PIZA 4OC5A 1GYTA 4WJBA 3DGVA 3S1RI 4F8ZA 3FRMA 2QECA 3IO1A 1YUAA 3I9SA 3LUSA 2ZW5A 4LUAA 4PXBA 2CY2A 2OZUA 2YADA 3BJ8A 4R76A 2JIMA 3G711 3HOZI 5AG4A 2B4BA 3KASA 3G71Z 2PJAA 4Q7AA 1K4JA 1JWHC 4NXYA 1Q7Y2 3NH5A 1RO5A 3K9TA 3CD6Z 2Z0ZA 3TOAA 4QTTA 3ISZA 1LRZA 3HUVA 4I49A 3B8GA 1FNOA 1K731 2PR8A 4CAFA 4E0AA 3VATA 5A2Qb 2RIQA 2JDDA 3PFEA 1VQN1 2NMTA 2PQ8A 3CCQ1 1ZO0A 3JTKA 4KVME 2POKA 3B7IA 1I1DA 2WUUA 4XPDB 4NB8A 4P4EA 1YI2Z 1QSNA 2BJOA 3GTJI 3G4S1 1K83I 2J8NA 4MHZA 3TO9A 3CPXA 1S60A 4BMHA 2VUMI 2OOXB 3DDDA 2B63I 3TTHA 1Y1WI 1M1DA 4X3RA 2DE6A 1HDQA 4MY0A 2Q7BA 1V0CA 3PB7X 4NGTA 2KCWA 2VEZA 2BO9A 3S15I 1ZLIA 3BG1B 3FF3A 3CQZI 1CPXA 2PJ8A 1MJAA 3VWEA 3PB9X 4UCNA 5F49A 2OTJ1 1B6BA 5LYLA 5G1ZA 2FVGA 4UFWA 3K2KA 4A31A 4B10A 3WR7A 4OKOA 2Q0YA 1KC81 2E7ZA 1Z8XA 2ZEOA 2IL4A 1S7KA 1QSRA 1K732 2FT0A 1RXTA 3D9XA 4OAEA 2PJCA 4CGOA 1VQ71 2ZAEB 2G3AA 1TXRA 3R95A 2IQ6A 5AG7A 1S5KA 4R87A 3TOBA 4E30A 3BI1A 3WC5A 4A3MI 3CC4Z 3B3VA 4P44A 4UWIA 4JJXA 4IK2A 1WWZA 1Q2YA 2YNCA 4E2AA 3FMCA 4FD4A 4C2XA 1ARMA 3FKII 4XNHB 4FD7A 3S16I 3D3SA 3J80f 3CCVZ 3CCE1 4YGOA 3VMHA 4ZX8A 1ZG8A 3CCU1 4F6AA 2V45A 1P0HA 3ESWA 3NFZA 1YUKA 1KUXA 1CPSA 4HH4A 3GTQI 1BO4A 3IC1A 4UEEA 1SQHA 4AB7A 4RUHA 2PJ2A 1YQEA 2HB6A 5CNPA 4UBRA 2GREA 3VTNA 4RVHA 2IZ4A 1YHQ1 2VZZA 1KQSZ 3I551 3I55Z 5I0CA 1OZPA 2C6CA 1TWFI 2FCKA 1KC82 2R6MA 1Q16A 2AFMA 2R92I 4MD9A 1VGYA 2ZOFA 3F8KA 3GTLI 3LWUA 2C27A 2RBLA 3PBEA 2Z3LA 5I4MA 2QA4Z 4A2ZA 3LMSA 2Q4ZA 1YJWZ 2KPIA 5H84A 5C88A 3FEEA 1TWHI 1JWQA 3D7HA 3SI2A 1IB1E 4A33A 5DWMA 3CC21 4CAVA 4MJ8A 2RT9A 3TDHB 3CC2Z 2NAPA 4CL1A 4ZBGA 3BXMA 4NBHA 2RHBA 1RO4A 1IU8A 1KUYA 3JVNA 1VQOZ 4NEXA 1VLAA 2Q7SA 3IWEA 3NA6A 2DE7A 3H8FA 3MZLB 2DEAA 4NBBA 4OIWA 3GKQA 1FY7A 2JUBA 4BBRI 3MZKB 4MFJA 5IP9I 2VI7A 8CPAA 1YJ9Z 3FEDA 5GCNA 3VMGA 5D29A 2JEWA 2ZEEA 2HQYA 4HGZA 2VL1A 2I3CA 4P4IA 3J81f 3JUWA 4EMEA 2ABZA 5LRKA 1NSAA 5HH1A 2OZKA 4NGSA 4B5OA 1PU9A 1SFOI 3J80b 4NGNA 1JJ2Y 4HPSA 1GHEA 1IICA 5HXDA 2OZGA 3NH4A 2AFOA 2C6GA 3H8GA 2XEIA 4BINA 1VQ41 3CXCY 4PSWA 1M4LA 2EO8A 3R9EA 1M4IA 2JIOA 3PB6X 1LFWA 5A2Qf 2P6FA 3R9FA 5T67A 4CYPA 2R93I 3FQQA 3N7ZA 2PK7A 4NFRA 3CXSA 3QAYA 5J1QA 2QLVB 3G8WA 5IT9f 2J6AA 2QEX1 3UY5A 3CCRZ 3U50C 4TNUA 2PJ5A 2JA6I 1XBUA 2BSWA 1YIJ1 4B13A 4FBEA 3G3SA 4R7MA 1QYPA 5LRGA 3GLJA 3S6KA 3KHZA 5LL6f 2LIYA 1TF8A 2B5GB 1Z03A 2REEA 2NVXI 1N8R1 3HOUI 5C4JI 1ZB9A 1HEEA 1ELMP 1H8LA 3PP9A 4UCMA 3DNSA 1P9NA 4ZY0A 1UWYA 1IGBA 4M85A 3VWDA 2O28A 3I1UA 5EC4A 4MHPA 3B3WA 2Z11A 4CYNA 4A3BI 2QRCB 5LYFA 4KUAA 2O53A 4P45A 5IX3A 4NBCA 2DF5A 1OBRA 4NGRA 1Z8TA 3FXTA 3LD2A 3HOVI 1XMBA 4LQGA 2E9HA 3IFUA 3HOWI 1LANA 4M3SA 3BHXA 2VPZA 4AYBA 1NSLA 7CPAA 1JQGA 2GTHA 1VQKZ 3LODA 4ZYQA 2PJ6A 4KOUA 1NE9A 2QREB 4CGMA 1KZFA 1QSTA 3CCM1 4A3DI 5KTDA 1S7LA 4UWJA 3CCMZ 4P4FA 3CMEZ 4BY1I 1VQ5Z 2ZW7A 3J81b 3BJ7A 2AJ6A 4KOTA 2CF4A 2X7BA 1Z4EA 3KQZA 3Q87A 3PFOA 5A28A 2P3YA 3PO3I 1LAMA 2QVPA 5DS0A 4A94A 1AUGA 2F7VA 4KOVA 1YREA 1QXFA 4E2WA 1R9TI 4BY7I 4Z65A 3CD61 2ATRA 3FECA 3H5ZA 4A95A 4CAWA 1B87A 1QVGZ 1XJOA 4UA3A 5LYDA 3EO4A 4TWEA 4XX2A 1VQLZ 4Q38A 3K7AI 1Z2LA 2AYDA 1WCMI 4RN7A 1S3ZA 3LACA 1S72Z 4EWTA 5IT9b 1F2OA 4Y7NI 4GS4A 4A3II 4DJLA 4A93I 2K5RA 4CAXA 1VIXA 4AG7A 5J8CA 1K8A1 1EE3P 5T64A 5FLMI 1YI21 1Y9KA 2AFZA 4YWYA 4Q36A 1WW9A 5C4XI 3V7ZA 5JGFA 5EMIA 4K30A 2FSRA 4C7IA 1FDOA 4PPZA 2E2JI 3GTMI 2JIRA 2VQYA 2CNSA 4RI1A 1U6MA 2JA7I 2I00A 1I50I 2YNEA 4UCPA 4CGNA 4JLYA 4PV6A 1XMTA 3S9LA 2HF1A 5IV0A 2CXAA 4F0XA 4MHNA 1NP6A 3S2HI 1X3WA 4R8FA 2Y0MA 2PMZA 4II9A 1MJBA 4UF4A 4NJRA 3CCS1 1RQFA 3CCSZ 2VBQA 4GM5A 3EC4A
chains in the Genus database with same CATH topology
1Y0RA 3FVLA 3I55Z 3GUXA 4RV9A 4E2ZA 1XFOA 3KHXA 1L1OC 2HU9A 2C6CA 5IB9A 4NH1C 1YMEA 1AYEA 1TWFI 4PQAA 4RVDA 1KC82 4NB9A 2OR4A 4PXCA 1Y1VS 2R6MA 2AFXA 3CCL1 1RNIA 2O4HA 2AFMA 1TF9A 4A3LI 1VQ4Z 3CCLZ 1PFTA 1CX8A 2PVWA 2ZOGA 3IWWA 4MCRA 3TC8A 2R92I 3SJGA 3D67A 4MD9A 3T4NB 2JBJA 2Q51A 1VGYA 2ZOFA 1USPA 2PJ4A 2OOYB 3D4UA 3SI1A 5AN9F 2EWBA 2NSMA 4UIAA 1FT7A 3PB4X 3GTLI 2XEFA 2GU2A 2NYQA 3D68A 3LWUA 5FLXb 1TFIA 2ANPA 4PXDA 3L2NA 4IAVA 2RBLA 1M902 3QWUA 3PBBA 2R7ZI 1Q861 5D1OA 1CP7A 3PBEA 2KI7B 1N8R2 5I4MA 3QNVA 4WWVA 2QA4Z 3LMSA 4A38A 2Q4ZA 1YJWZ 3VH9A 2KPIA 2XEJA 3S14I 1TWHI 3FEEA 4UIBA 2QEXZ 1I3QI 1JJ2Z 5K8PA 3CMA1 3D7HA 3SI2A 3S9NA 2E2II 1VQL1 4NJQA 1YJN1 3CPAA 2V8HA 1YW6A 2PRQA 3CC21 3NDIA 3KIHA 1YJNZ 3KQXA 3TE5B 2RT9A 3D7FA 3TDHB 3CC2Z 3WABA 1XRYA 1LQLA 4CL1A 3CC41 2LFUA 3CXCZ 4DYOA 1YIJZ 3RZOI 4JZ0A 1S721 1Z01A 2Q43A 3BXMA 3RZDI 4NBHA 2JR6A 2RHBA 1ARLA 3B35A 4P6YA 3TX8A 1S7MA 3S1MI 4NGQA 4RS4A 3VMIA 1RO4A 1K8A2 1TWAI 1Q7Y1 2C6PA 4YU9A 4ZX9A 2W03A 1VQOZ 3EEDA 1Y0YA 1F2PA 2K3RA 2PJ1A 1VLAA 4A39A 3NA6A 2DE7A 1LAPA 1TWCI 3GTPI 3H8FA 4A37A 3CCV1 1N2FA 2Y0SA 3MZLB 2DEAA 4P4JA 1Y1VI 4NBGA 4NBBA 1M1K1 3D66A 4OIWA 4UEFA 3M4OI 2ZEGA 3KGQA 3GKQA 2JUBA 1KQSY 1VQNZ 2E2HI 4BBRI 1Y7EA 2RFHA 5THWA 3CCQZ 3MZKB 3CC7Z 3FH4A 4P4BA 1Q812 4OMEA 5IP9I 3B3TA 2CTBA 8CPAA 2PE3A 1K9M2 1YJ9Z 3FEDA 1LCPA 1KRLA 3HOXI 1X0TA 3S1NI 4FWUA 4MCQA 3T8WA 1BAVA 3VMGA 2ZEMA 5D29A 2JEWA 5LYIA 4A3JI 1ZG7A 1YSJA 4MCSA 2ZEEA 3IIBA 4HGZA 2VL1A 2I3CA 6CPAA 5HVGA 4F9UA 4EWCA 3BG0B 4PXEA 4P4IA 3J81f 4EMEA 1ZB8A 2M6NA 2VUGA 2ABZA 3I561 2RPRA 5LRKA 1I6HI 2AFSA 3G6EZ 4P4DA 1NSAA 3I56Z 3G4SZ 1R43A 2IMOA 4R6TA 2BOAA 1RO0A 5CM2M 3IEHA 2OZKA 2OTL1 4NGSA 4F9VA 4RVGA 3JRUA 2NVYI 4MD7A 2OTLZ 5F09A 3FX6A 1SFOI 3H8EA 3IX0A 3RZAA 4FAIA 3J80b 1QVGY 3WC7A 1CP6A 1JJ2Y 4NGNA 2HC9A 3I07A 2ZEPA 5HXDA 2ZEFA 1DTDA 1F57A 2PM9A 3NH4A 2ZELA 2AFOA 2C6GA 1VQMZ 3H8GA 5CPAA 4MD8A 4OC1A 2XEIA 1QQ9A 2RB7A 1VQ41 3CXCY 4A3FI 4NBEA 2JBKA 1M4LA 5ELYA 5C44I 4KSIA 3WT4A 4AXVA 3S1QI 2JNYA 3PB6X 5JM6A 2W04A 1LFWA 2C1CA 5A2Qf 3GTKI 4A3CI 1GYTA 2PIZA 4OC5A 5T67A 1NJI1 4A3KI 4OC0A 1VHEA 1Q862 3JAMf 4WJBA 3DGVA 3S1RI 2R93I 4B6ZA 3FQQA 4F8ZA 3V38A 5HVHA 1HDUA 3OW2Z 3S9MA 3H0GI 1YUAA 2PK7A 1Z02A 4NFRA 3IO1A 1Z5RA 3LUSA 5J1QA 2OTJZ 5D1PA 3B3CA 2QLVB 2QA41 1ZG9A 1YJW1 5IT9f 4G1PA 2J6AA 4PXBA 2YADA 4R76A 3HKZA 2V8DA 3DLJA 2QEX1 3G711 3HOZI 2PJBA 3CCRZ 4S1TA 3U50C 3G71Z 3KASA 4TNUA 2PJAA 3F3PC 4Q7AA 1JWHC 4E33A 2PJ5A 2JA6I 4FUUA 1XBUA 2NVTI 3WC6A 1YIJ1 1Q7Y2 4FBEA 3NH5A 4R7MA 3K9TA 2V77A 1QYPA 5LRJA 3CD6Z 4MH4A 5LRGA 2F4MA 3GLJA 4QTTA 3MONA 1QMUA 3ISZA 3KHZA 3HUVA 5LL6f 2JMOA 1Q821 1K731 1FNOA 3IFEA 4ZY1A 2LIYA 1VQO1 1TF8A 4EFDA 1VQ7Z 1M1K2 1Z03A 2PIYA 2NVXI 3VATA 5A2Qb 1W2BZ 1N8R1 1VQP1 3D6WA 4X6AI 3GTOI 1QVFZ 2PCUA 3HOUI 1VQPZ 5C4JI 2V8KA 3D7DA 4DQYB 1ZB9A 2RIQA 1HEEA 3PFEA 1VQN1 2F4OA 3CCQ1 4NBAA 1VQ6Z 3CC71 1ELMP 2QYVA 1H8LA 3GCFA 4IHMA 3I4NI 1P9NA 4ZY0A 3PO2I 2ZEDA 4NGMA 3VB9A 5C3EI 1YJ91 1UWYA 2POKA 3B2YA 1IGBA 2NVQI 2AFWA 3B7IA 3KR5A 5K8OA 3I1UA 3KL9A 2WZNA 2WAQA 4MMOA 2YU9I 1BPNA 4MHPA 3IF8A 1PCAA 3B3WA 3PO3S 2M48A 1LOKA 1CG2A 4A3BI 4NB8A 4P4EA 1YI2Z 2QRCB 2BJOA 5LYFA 3CCEZ 4H2KA 3GTJI 3G6E1 2ZENA 1KD11 4BBSI 2O53A 1VQ81 3G4S1 1K83I 3CCUZ 4P45A 3RBUA 4NBCA 2WB1A 1VQ8Z 3OW2Y 4MHZA 3EERA 1Z8LA 1OBRA 3CPXA 4MHYA 4NGRA 4E2YA 2P28A 3CCJ1 2V8JA 3MN8A 2PJ3A 4A3EI 2VUMI 3CCJZ 2OOXB 3HOVI 1XMBA 1TWGI 2PJ7A 4LQGA 5K8NA 2E9HA 3IFUA 2B63I 3HOWI 1LANA 3I4MI 2V8GA 3BHXA 4AYBA 5K8MA 2PVVA 1Y1WI 1VQM1 5FLXf 4X3RA 7CPAA 2DE6A 2GTHA 1HDQA 1JQGA 1VQKZ 2QJ8A 3HOYI 4ZYQA 3PB7X 2PJ6A 2GLJA 4NGTA 5IP7I 1NJI2 2BO9A 3F3FC 2QREB 3SJFA 3S15I 2AKLA 3BG1B 1ZLIA 3BI0A 3FF3A 2PJ9A 3ISXA 5CBMA 3CCM1 4K3NA 4X2TA 4O23A 3N5FA 3CQZI 2EK8A 4A3DI 1CPXA 2PJ8A 3CCMZ 1YHQZ 3S17I 1QF8A 1VQ9Z 4P4FA 3CMEZ 4BY1I 3PB9X 2QRDB 1VQ5Z 3VARA 3J81b 1W2BY 2WYRA 2GLFA 5T6BA 4E2XA 2OTJ1 3SJEA 1QVFY 5LYLA 4OC2A 2CF4A 2FVGA 1KWMA 1DL6A 1YW4A 4RVFA 4BXXI 1VHOA 3KQZA 3Q87A 4BD9A 4MCPA 3K2KA 2XEGA 3PFOA 4JYWA 2P3YA 2H85A 3CCR1 4OC3A 2V8IA 3PO3I 1LAMA 2QVPA 3HLPA 5DS0A 4A94A 2F7VA 4OKOA 1AMPA 2EK9A 1KC81 2JA8I 1ML8A 5JH9A 1TKFA 4E2WA 1RO2A 1R9TI 4CPAA 4BY7I 3CPWZ 4DGLA 4E32A 4Z65A 2ZEOA 3J7A4 4NOZA 3GTMS 1Q822 1K732 3FQMA 2IZ3A 3CD61 3FECA 4OIDA 3PRTA 4DK1A 3D9XA 3PB8X 3NH8A 1BPMA 1BLLE 4NGPA 5HVFA 3S2DI 2EGTA 2PJCA 1VQ71 3SI0A 4ZY2A 2ZAEB 4ONWA 3IJ3A 1QVGZ 4X8IA 1M901 1XJOA 1TXRA 2IQ6A 4A3GI 3CMAZ 2GTIA 4QTUA 5LYDA 4TWEA 5D8NA 4Y52I 4XX2A 1ELLP 4MXUA 1VQLZ 1RTQA 3JAMb 2AFUA 4E30A 3BI1A 1YIT1 3WC5A 1X3ZA 3K7AI 1VQ61 1YITZ 4A3MI 3CC4Z 1Z2LA 1ZLHA 3B3VA 4P44A 4HGYA 1WCMI 1S72Z 4EWTA 3KIFA 5IT9b 3SJXA 1F2OA 4IK2A 2V8VA 2G2KA 4Y7NI 2CTCA 4A3II 4DJLA 4A93I 2K5RA 4MONA 3FMCA 2F8HA 4MRIA 1VIXA 1ARMA 1R3NA 1K8A1 3FKII 1IY7A 1EE3P 5T64A 3S16I 1PYTB 4NBDA 1KD12 5FLMI 2QKDA 3J80f 3CCVZ 3KR4A 4NBFA 3NDJA 1YI21 2AFZA 4YWYA 3CCE1 1ZH1A 3KZWA 1WW9A 5C4XI 3VMHA 4ZX8A 1ZG8A 3V7ZA 5JGFA 3CCU1 1VQ51 3GTGI 2J9AA 3GB0A 4PPZA 2BCOA 1TKJA 2G9DA 2ZEHA 2PJ0A 3KI9A 2JS4A 3P5JB 2E2JI 3ESWA 1CBXA 3NFZA 3GTMI 4UEZA 3FJUA 1YUKA 2CIJA 1CPSA 1WIIA 2JA7I 4HH4A 1I50I 1YLOA 3GTQI 1Q811 3IC1A 3S9LA 4UEEA 1RLYA 2HF1A 1K9M1 4DUKA 4MHNA 3CDXA 4RUHA 1NP6A 3S2HI 1DE4C 1TKHA 2PJ2A 1X3WA 4E31A 4W9YA 3CPWY 1VQK1 4R8FA 2QR1B 3H3VJ 3CT9A 3MRUA 2PMZA 1USPB 2HB6A 2OOTA 2VF1A 4NJRA 4UF4A 2GREA 4ZI6A 2JA5I 2DE5A 3CCS1 1RQFA 4RVHA 2IZ4A 3VTNA 3RAMA 1NUIA 3D7GA 2IJZA 1Q7LA 4OC4A 3CCSZ 3PEIA 1YHQ1 3B3SA 1VQ91 3M3YI 1KQSZ 4P10A 3I551 4OP4A 4GM5A 3CME1 5D1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0R A;  3FVL A;  3GUX A;  1XFO A;  3KHX A;  5IB9 A;  2C6C A;  1YME A;  1AYE A;  4PQA A;  2OR4 A;  4PXC A;  2AFX A;  2O4H A;  2AFM A;  1TF9 A;  1CX8 A;  2PVW A;  2ZOG A;  3IWW A;  4MCR A;  3TC8 A;  3SJG A;  3D67 A;  2JBJ A;  2Q51 A;  1VGY A;  2ZOF A;  2PJ4 A;  3D4U A;  3SI1 A;  2EWB A;  2NSM A;  4UIA A;  1FT7 A;  3PB4 X;  2XEF A;  2GU2 A;  2NYQ A;  3D68 A;  3LWU A;  2ANP A;  4PXD A;  3L2N A;  4IAV A;  3PBB A;  3PBE A;  1CP7 A;  5I4M A;  3QNV A;  4WWV A;  3LMS A;  4A38 A;  2Q4Z A;  3VH9 A;  2XEJ A;  3FEE A;  4UIB A;  5K8P A;  3S9N A;  3D7H A;  3SI2 A;  4NJQ A;  3CPA A;  2V8H A;  1YW6 A;  2PRQ A;  3KQX A;  3D7F A;  3WAB A;  1XRY A;  4DYO A;  4JZ0 A;  2Q43 A;  3BXM A;  1ARL A;  3TX8 A;  3B35 A;  4P6Y A;  4NGQ A;  2C6P A;  4YU9 A;  4ZX9 A;  1Y0Y A;  1F2P A;  2PJ1 A;  4A39 A;  3NA6 A;  1LAP A;  3H8F A;  4A37 A;  2DEA A;  4P4J A;  3D66 A;  4OIW A;  4UEF A;  2ZEG A;  3KGQ A;  1Y7E A;  2RFH A;  5THW A;  3FH4 A;  4P4B A;  4OME A;  3B3T A;  2CTB A;  8CPA A;  2PE3 A;  3FED A;  1LCP A;  4FWU A;  4MCQ A;  3T8W A;  1BAV A;  2ZEM A;  5D29 A;  2JEW A;  5LYI A;  1ZG7 A;  1YSJ A;  4MCS A;  2ZEE A;  3IIB A;  6CPA A;  2VL1 A;  2I3C A;  5HVG A;  4F9U A;  4PXE A;  4P4I A;  4EME A;  2ABZ A;  5LRK A;  2AFS A;  4P4D A;  1NSA A;  1R43 A;  2IMO A;  4R6T A;  2BOA A;  3IEH A;  4NGS A;  4F9V A;  3JRU A;  5F09 A;  3FX6 A;  3H8E A;  3RZA A;  4FAI A;  3WC7 A;  1CP6 A;  4NGN A;  2HC9 A;  2ZEP A;  5HXD A;  2ZEF A;  1DTD A;  1F57 A;  3NH4 A;  2ZEL A;  2AFO A;  2C6G A;  3H8G A;  5CPA A;  4OC1 A;  2XEI A;  1QQ9 A;  2RB7 A;  2JBK A;  1M4L A;  5ELY A;  4KSI A;  3WT4 A;  4AXV A;  3PB6 X;  5JM6 A;  1LFW A;  2C1C A;  2PIZ A;  4OC5 A;  1GYT A;  4OC0 A;  1VHE A;  4WJB A;  3DGV A;  4B6Z A;  4F8Z A;  3V38 A;  5HVH A;  1HDU A;  3S9M A;  3IO1 A;  4NFR A;  1Z5R A;  5J1Q A;  3B3C A;  1ZG9 A;  4G1P A;  4PXB A;  4R76 A;  2V8D A;  3DLJ A;  2PJB A;  3KAS A;  4TNU A;  2PJA A;  4Q7A A;  2PJ5 A;  4FUU A;  1XBU A;  3WC6 A;  4FBE A;  3NH5 A;  4R7M A;  3K9T A;  2V77 A;  5LRJ A;  5LRG A;  3GLJ A;  1QMU A;  3ISZ A;  3KHZ A;  3HUV A;  1FNO A;  3IFE A;  4ZY1 A;  1TF8 A;  4EFD A;  2PIY A;  3VAT A;  2PCU A;  3D7D A;  1HEE A;  3PFE A;  1ELM P;  2QYV A;  1H8L A;  4IHM A;  4ZY0 A;  2ZED A;  4NGM A;  1UWY A;  2POK A;  3B2Y A;  1IGB A;  2AFW A;  3B7I A;  3KR5 A;  5K8O A;  3I1U A;  3KL9 A;  2WZN A;  4MMO A;  1BPN A;  4MHP A;  1PCA A;  3B3W A;  1LOK A;  1CG2 A;  4P4E A;  5LYF A;  4H2K A;  2ZEN A;  2O53 A;  4P45 A;  3RBU A;  4MHZ A;  1Z8L A;  1OBR A;  3CPX A;  4MHY A;  4NGR A;  3MN8 A;  2PJ3 A;  1XMB A;  2PJ7 A;  4LQG A;  5K8N A;  1LAN A;  2V8G A;  3BHX A;  5K8M A;  2PVV A;  4X3R A;  7CPA A;  1HDQ A;  1JQG A;  2QJ8 A;  4ZYQ A;  3PB7 X;  2PJ6 A;  2GLJ A;  4NGT A;  2BO9 A;  3SJF A;  1ZLI A;  3BI0 A;  3FF3 A;  2PJ9 A;  3ISX A;  5CBM A;  4K3N A;  4X2T A;  4O23 A;  3N5F A;  2EK8 A;  1CPX A;  2PJ8 A;  4P4F A;  3PB9 X;  3VAR A;  2WYR A;  2GLF A;  3SJE A;  5LYL A;  4OC2 A;  2CF4 A;  2FVG A;  1KWM A;  1YW4 A;  3KQZ A;  1VHO A;  4BD9 A;  4MCP A;  3K2K A;  2XEG A;  3PFO A;  4JYW A;  4OC3 A;  1LAM A;  2QVP A;  3HLP A;  5DS0 A;  4A94 A;  2F7V A;  4OKO A;  1AMP A;  2EK9 A;  5JH9 A;  1TKF A;  4CPA A;  4Z65 A;  2ZEO A;  3FEC A;  4OID A;  3PRT A;  3PB8 X;  3NH8 A;  1BPM A;  1BLL E;  4NGP A;  5HVF A;  2PJC A;  3SI0 A;  4ZY2 A;  4ONW A;  3IJ3 A;  4X8I A;  1XJO A;  1TXR A;  2IQ6 A;  5LYD A;  4TWE A;  5D8N A;  1ELL P;  4MXU A;  1RTQ A;  2AFU A;  3BI1 A;  3WC5 A;  1ZLH A;  1Z2L A;  3B3V A;  4P44 A;  4EWT A;  3SJX A;  1F2O A;  4IK2 A;  2V8V A;  2CTC A;  4DJL A;  3FMC A;  2F8H A;  4MRI A;  1VIX A;  1ARM A;  1R3N A;  1IY7 A;  1EE3 P;  1PYT B;  3KR4 A;  2AFZ A;  4YWY A;  3KZW A;  4ZX8 A;  1ZG8 A;  3V7Z A;  5JGF A;  2J9A A;  3GB0 A;  4PPZ A;  2BCO A;  1TKJ A;  2G9D A;  2ZEH A;  2PJ0 A;  3KI9 A;  1CBX A;  3NFZ A;  4UEZ A;  3FJU A;  2CIJ A;  1CPS A;  1YLO A;  3IC1 A;  3S9L A;  4UEE A;  4DUK A;  4MHN A;  3CDX A;  4RUH A;  1DE4 C;  1TKH A;  2PJ2 A;  4W9Y A;  4R8F A;  3CT9 A;  3MRU A;  2HB6 A;  2OOT A;  4UF4 A;  4NJR A;  2GRE A;  4ZI6 A;  3RAM A;  3D7G A;  2IJZ A;  1Q7L A;  4OC4 A;  3PEI A;  3B3S A;  4P10 A;  4OP4 A;  4GM5 A; 
#chains in the Genus database with same CATH topology
 3FVL A;  3GUX A;  4RV9 A;  3KHX A;  1L1O C;  2HU9 A;  5IB9 A;  1YME A;  1AYE A;  4NB9 A;  2B4D B;  4KUB A;  1RNI A;  1IOF A;  1TF9 A;  1PFT A;  3D67 A;  3D4U A;  2V3V A;  4Y49 C;  3T90 A;  3DR6 A;  4IF5 A;  2FIW A;  4UFX A;  2ANP A;  4R3L A;  2R7Z I;  1Q86 1;  4XPL A;  3CXP A;  2KI7 B;  4KVX A;  4A38 A;  1M4D A;  3VH9 A;  4UIB A;  1I3Q I;  1JJ2 Z;  3S9N A;  2QML A;  2E2I I;  1YR0 A;  2OU2 A;  3NDI A;  4R3K A;  3TE5 B;  1KUV A;  1XRY A;  1LQL A;  3CC4 1;  3CXC Z;  4DYO A;  1Z01 A;  3RZD I;  2JR6 A;  2YND A;  3TX8 A;  3B35 A;  1S7M A;  1K8A 2;  1TWA I;  2G3T A;  2H5M A;  1N71 A;  1F2P A;  1MJ9 A;  2YNC C;  4A37 A;  3CCV 1;  2Y0S A;  5DWN A;  4E8O A;  1Y8C A;  3M4O I;  3KGQ A;  2E2H I;  1Y7E A;  2RFH A;  1Y7R A;  3CC7 Z;  4P4B A;  4CRZ B;  1YK3 A;  1Q2C A;  1KRL A;  3HOX I;  1X0T A;  4FWU A;  3T8W A;  2RC4 A;  2LEX A;  5F46 A;  4B5P B;  6CPA A;  4EWC A;  4PXE A;  4RS2 A;  2Z3K A;  2YGW A;  1ZB8 A;  4CGP A;  2VUG A;  2ODF A;  2RPR A;  3G6E Z;  4P4D A;  5IB0 A;  4HNX B;  3GYA A;  4X5K A;  3P2H A;  3TCV A;  3IEH A;  4F9V A;  4RVG A;  2PDO A;  3IX0 A;  3RZA A;  3T9Y A;  1QVG Y;  4BBH A;  2HC9 A;  4MY3 A;  3I07 A;  3ZJ0 A;  2ZEF A;  2ZPA A;  4AVB A;  1Z8W A;  1VQM Z;  2CNM A;  4OC1 A;  2R98 A;  4CAE A;  4NBE A;  2JBK A;  3FNC A;  3QAH A;  5ELY A;  5C44 I;  4MHD A;  4L8A A;  4A3C I;  1NJI 1;  1Q86 2;  3JAM f;  4B6Z A;  3V38 A;  2Z3M A;  5HVH A;  1Z02 A;  4OAD A;  1Z5R A;  5D1P A;  2QA4 1;  1YJW 1;  1MK4 A;  2V8D A;  2HUZ A;  4J3G A;  3IU1 A;  4S1T A;  4MFZ A;  3IGR A;  4E33 A;  1Z4R A;  4MFQ A;  3WC6 A;  5BWA B;  5LRJ A;  2V77 A;  3MON A;  2OZH A;  1VKC A;  1Q2D A;  4ZY1 A;  3C26 A;  1VQO 1;  5JPH A;  3D2M A;  2PIY A;  1VQP 1;  1M4G A;  1VQP Z;  3D7D A;  4DQY B;  3NE8 A;  1AA6 A;  5AG6 A;  1VQ6 Z;  2QYV A;  3GCF A;  4IHM A;  4MI4 A;  3CXQ A;  3PO2 I;  4NGM A;  3VB9 A;  1YJ9 1;  2Z3N A;  2OB0 A;  2AFW A;  3RO0 A;  3KL9 A;  4MMO A;  2YU9 I;  1BPN A;  3IF8 A;  1PCA A;  2B5G A;  4AVC A;  3PO3 S;  2M48 A;  1LOK A;  4H2K A;  2ZEN A;  1VQ8 1;  1NMT A;  1VQ8 Z;  3OW2 Y;  3EY5 A;  3EER A;  1Z8L A;  4MHY A;  4E2Y A;  1YGH A;  3CCJ 1;  2DXQ A;  2D4O A;  2V8J A;  4B14 A;  2PJ3 A;  3R96 A;  3R1K A;  4A3E I;  3CCJ Z;  3S6F A;  1TWG I;  2PJ7 A;  5K8N A;  1WJ2 A;  3I4M I;  4QB9 A;  2V8G A;  4AG9 A;  2PVV A;  5FLX f;  4KVO E;  2R7H A;  2QJ8 A;  3HOY I;  3EFA A;  2GLJ A;  2J8M A;  1NJI 2;  4QUS A;  3TT2 A;  2AKL A;  3BI0 A;  4L89 A;  4A30 A;  2PJ9 A;  3ISX A;  4JWP A;  5CBM A;  4K3N A;  4X2T A;  1CJW A;  3N5F A;  2EK8 A;  4O23 A;  3FYN A;  1VQ9 Z;  3VAR A;  1W2B Y;  2EUI A;  2WYR A;  5T6B A;  4E2X A;  3SJE A;  1QVF Y;  4KSA A;  4OC2 A;  3GKR A;  4FD6 A;  1YW4 A;  4RVF A;  4BXX I;  1P4N A;  1VHO A;  4MCP A;  2XEG A;  4JYW A;  3CCR 1;  4OC3 A;  3HLP A;  3TE4 A;  1AMP A;  4CPA A;  4E32 A;  1WZN A;  1VHS A;  3J7A 4;  4NOZ A;  3GTM S;  3FQM A;  4OID A;  4U5Y A;  3PRT A;  4DK1 A;  3S2D I;  3K9U A;  2EGT A;  4C2Z A;  3SI0 A;  4ZY2 A;  3S6H A;  4ONW A;  3IJ3 A;  3CMA Z;  4OLL A;  4QTU A;  4KSF A;  4Y52 I;  1RTQ A;  3JAM b;  2AFU A;  1QSM A;  1YIT 1;  4B12 A;  1X3Z A;  1YIT Z;  3KIF A;  4KZT A;  4ONU A;  4DNC A;  1XF8 A;  4MON A;  2ARH A;  2F8H A;  2R8V A;  4MRI A;  1IY7 A;  3MGD A;  1PYT B;  4NBD A;  3KR4 A;  3NDJ A;  3ZZI A;  2WPW A;  4H6Z A;  1ZH1 A;  3KZW A;  4GXH A;  3GB0 A;  2BCO A;  1XE4 A;  1YVO A;  2ZEH A;  2PJ0 A;  2ZXV A;  2JS4 A;  3P5J B;  3P2F A;  1S7N A;  3FJU A;  4B11 A;  4CGL A;  1I21 A;  1WII A;  1RLY A;  3GIU A;  1K9M 1;  4CRY B;  3IR7 A;  1DE4 C;  1TKH A;  4E31 A;  3CPW Y;  1VQK 1;  2QR1 B;  2ZW4 A;  3MRU A;  1USP B;  5AGE A;  2VPX A;  2DE5 A;  3RAM A;  2BL1 A;  1NUI A;  3D7G A;  2JIQ A;  1Q7L A;  4OC4 A;  3PEI A;  3B3S A;  3M3Y I;  4P10 A;  4OP4 A;  3CME 1;  1VQ5 1;  5D1O B;  1Y0R A;  2BUE A;  4E2Z A;  4NH1 C;  4JXR A;  4PXC A;  1S7F A;  3CCL 1;  3A9L A;  4F0Y A;  4A3L I;  3CCL Z;  2PVW A;  4MCR A;  2JBJ A;  2Q51 A;  3W6X A;  4PK2 A;  3PB4 X;  4MFK A;  2NYQ A;  3D68 A;  5FLX b;  3D2P A;  3L2N A;  3QWU A;  1N8R 2;  3QNV A;  3S14 I;  5K8P A;  1VQL 1;  2B4D A;  1YW6 A;  3WAB A;  2LFU A;  3FB3 A;  2BEI A;  3RZO I;  4M6I A;  3KKW A;  1S72 1;  2Q43 A;  1ARL A;  4P6Y A;  3S1M I;  4NGQ A;  4RS4 A;  4ZX9 A;  4KOS A;  1Y0Y A;  1XOV A;  2PJ1 A;  2K3R A;  2F5I A;  1YVK A;  1TWC I;  3GTP I;  1N2F A;  4KLV A;  1Y1V I;  4NBG A;  1M1K 1;  2GAN A;  4ZGY B;  5A27 A;  3D66 A;  4UEF A;  2VPW A;  1VQN Z;  3CCQ Z;  4KOX A;  5EBV A;  3E0K A;  2PE3 A;  2G0B A;  1K9M 2;  5HMN A;  2VPY A;  1LCP A;  3S1N I;  1BAV A;  5LYI A;  4A3J I;  2PC1 A;  5KTC A;  3W91 A;  3IIB A;  5HVG A;  5KTA A;  4QVT A;  2JLM A;  4U9Z A;  3BG0 B;  2M6N A;  3SXO A;  3G4S Z;  1J4J A;  4JXQ A;  4XNH C;  2PRB A;  4IUS A;  2OTL 1;  3JRU A;  2FXF A;  2NVY I;  2OTL Z;  3FX6 A;  3H8E A;  1CP6 A;  3NE7 A;  4KLW A;  2B3U A;  4B5P A;  4YRH A;  2D4P A;  2RB7 A;  5F47 A;  4A3F I;  1I12 A;  4KSI A;  4AXV A;  3S1Q I;  2JNY A;  5JM6 A;  2W04 A;  2C1C A;  4LQ6 A;  3GTK I;  4PSX A;  1Z9U A;  4A3K I;  4OC0 A;  1VHE A;  1HDU A;  3OW2 Z;  3S9M A;  3H0G I;  4MBU A;  1XIX A;  2OTJ Z;  2IV2 X;  2VXK A;  3B3C A;  1ZG9 A;  4G1P A;  3HKZ A;  3DLJ A;  2PJB A;  1YX0 A;  4C7H A;  1PUA A;  4FUU A;  2FL4 A;  2NVT I;  4MH4 A;  2F4M A;  1QMU A;  2ZW6 A;  2JMO A;  2Q04 A;  1Q82 1;  3IFE A;  2P0W A;  4EFD A;  1VQ7 Z;  4MFL A;  1M1K 2;  2K5T A;  2WPX A;  4YFJ A;  3PGP A;  2Z3O A;  1W2B Z;  3D6W A;  4UFV A;  4X6A I;  3GTO I;  1QVF Z;  1CM0 A;  2PCU A;  1IID A;  3DR8 A;  3PZJ A;  3SXN A;  2V8K A;  2CNT A;  2F4O A;  2Z10 A;  4NBA A;  3CC7 1;  4MFP A;  3FIX A;  5AG5 A;  3I4N I;  1SIW A;  2ZED A;  5C3E I;  3B2Y A;  2NVQ I;  1UFH A;  5K8O A;  3KR5 A;  2WZN A;  2WAQ A;  1CG2 A;  3CCE Z;  3EXN A;  3GY9 A;  4NSQ A;  3G6E 1;  1KD1 1;  4BBS I;  3CCU Z;  3RBU A;  2WB1 A;  2P28 A;  3TO6 A;  2DPT A;  3MN8 A;  1IYL A;  3R9G A;  5FVJ A;  3D2L A;  5K8M A;  4QC6 A;  1VQM 1;  4HNY B;  4Y49 B;  3OWC A;  4JD6 A;  1X12 A;  4U9Y A;  5IP7 I;  3F3F C;  3SJF A;  2PSW A;  5C82 A;  1YHQ Z;  3S17 I;  1QF8 A;  1TIQ A;  2QRD B;  2J8R A;  2GLF A;  5F48 A;  4AVA A;  1KWM A;  1DL6 A;  1QSO A;  5G22 A;  4BD9 A;  2H85 A;  2V8I A;  2GIV A;  2EK9 A;  2JA8 I;  5JH9 A;  1ML8 A;  2A4N A;  1TKF A;  1RO2 A;  3CPW Z;  4DGL A;  2WSA A;  1Q82 2;  2IZ3 A;  2PR1 A;  3PB8 X;  1WK4 A;  3NH8 A;  1BPM A;  4A32 A;  1BLL E;  4NGP A;  5HVF A;  3H4Q A;  1M44 A;  4X8I A;  1M90 1;  4A3G I;  2B3V A;  2GTI A;  5D8N A;  1ELL P;  4MXU A;  1YLE A;  4M6H A;  1VQ6 1;  1ZLH A;  2EVN A;  1FDI A;  1IOI A;  4HGY A;  1ON0 A;  4KOY A;  3SJX A;  2V8V A;  2JEV A;  2G2K A;  2CTC A;  3RYO A;  1R3N A;  5J8F A;  1KD1 2;  3TFY A;  2QKD A;  1BOB A;  4NBF A;  2GE3 A;  2QIR A;  3CZX A;  4ORF A;  3V8I A;  4CYO A;  3GTG I;  2J9A A;  1IYK A;  1TKJ A;  2G9D A;  3KI9 A;  4HNW B;  2OH1 A;  1CBX A;  4UEZ A;  2CIJ A;  3FBU A;  1YLO A;  4KOR A;  1Q81 1;  2R1I A;  4DUK A;  4KOW A;  3CDX A;  2HV2 A;  4W9Y A;  3H3V J;  3CT9 A;  2OOT A;  5G20 A;  2VF1 A;  4ZI6 A;  2JA5 I;  5ISV A;  2IJZ A;  5E96 A;  4CS0 B;  1VQ9 1;  2JDC A;  1A2Z A;  1Y9W A;  4C68 A;  3F3P C;  3D8P A;  1XFO A;  3I3G A;  3S6G A;  4PQA A;  5JQ4 A;  4RVD A;  4XPK A;  2OR4 A;  1Y1V S;  2AFX A;  2O4H A;  4KS9 A;  1VQ4 Z;  2VZY A;  5G21 A;  1CX8 A;  2ZOG A;  3IWW A;  3TC8 A;  3SJG A;  3T4N B;  4M6G A;  1USP A;  2PJ4 A;  2OOY B;  3RNZ A;  3SI1 A;  5AN9 F;  2EWB A;  2NSM A;  4UIA A;  1FT7 A;  2FS5 A;  2XEF A;  2GU2 A;  1TFI A;  4PXD A;  4IAV A;  1M90 2;  3PBB A;  5D1O A;  1CP7 A;  5H86 A;  3TO7 A;  4WWV A;  2AE6 A;  2XEJ A;  2QEX Z;  1X10 A;  3CMA 1;  4NF1 A;  3IU2 A;  4NJQ A;  1YJN 1;  2Z3P A;  3CPA A;  2V8H A;  2PRQ A;  3KIH A;  1YJN Z;  3KQX A;  3D7F A;  2GFQ A;  1YIJ Z;  4JZ0 A;  4R57 A;  3VMI A;  2Q4Y A;  2Q4V A;  1Q7Y 1;  2C6P A;  4YU9 A;  2JIP A;  2P6G A;  4H6U A;  2Q44 A;  2W03 A;  3W6S A;  3EED A;  4A39 A;  1LAP A;  3SHP A;  4P4J A;  1XEB A;  2ZEG A;  1KQS Y;  4EVY A;  4QBJ A;  5THW A;  4CYQ A;  2DPS A;  3FH4 A;  1Q81 2;  4OME A;  2FE7 A;  3B3T A;  2CTB A;  4NCZ A;  4H89 A;  2REF A;  4MCQ A;  2EBJ A;  2ZEM A;  3IWG A;  4LX9 A;  1ZG7 A;  1L0C A;  1YSJ A;  4MCS A;  4R9M A;  4HKF A;  3F0A A;  4F9U A;  1R57 A;  2I79 A;  3QB8 A;  3I56 1;  1I6H I;  2AFS A;  3BLN A;  3I56 Z;  1R43 A;  4FD5 A;  2IMO A;  4R6T A;  2BOA A;  1RO0 A;  5CM2 M;  2FIA A;  4XPD C;  4MD7 A;  5F09 A;  3F5B A;  4PK3 A;  2B58 A;  4FAI A;  3WC7 A;  2ZEP A;  1DTD A;  1F57 A;  2PM9 A;  2ZEL A;  2P6E A;  5CPA A;  4MD8 A;  1QQ9 A;  3WT4 A;  3DSB A;  4C2Y A;  2PIZ A;  4OC5 A;  1GYT A;  4WJB A;  3DGV A;  3S1R I;  4F8Z A;  3FRM A;  2QEC A;  3IO1 A;  1YUA A;  3I9S A;  3LUS A;  2ZW5 A;  4LUA A;  4PXB A;  2CY2 A;  2OZU A;  2YAD A;  3BJ8 A;  4R76 A;  2JIM A;  3G71 1;  3HOZ I;  5AG4 A;  2B4B A;  3KAS A;  3G71 Z;  2PJA A;  4Q7A A;  1K4J A;  1JWH C;  4NXY A;  1Q7Y 2;  3NH5 A;  1RO5 A;  3K9T A;  3CD6 Z;  2Z0Z A;  3TOA A;  4QTT A;  3ISZ A;  1LRZ A;  3HUV A;  4I49 A;  3B8G A;  1FNO A;  1K73 1;  2PR8 A;  4CAF A;  4E0A A;  3VAT A;  5A2Q b;  2RIQ A;  2JDD A;  3PFE A;  1VQN 1;  2NMT A;  2PQ8 A;  3CCQ 1;  1ZO0 A;  3JTK A;  4KVM E;  2POK A;  3B7I A;  1I1D A;  2WUU A;  4XPD B;  4NB8 A;  4P4E A;  1YI2 Z;  1QSN A;  2BJO A;  3GTJ I;  3G4S 1;  1K83 I;  2J8N A;  4MHZ A;  3TO9 A;  3CPX A;  1S60 A;  4BMH A;  2VUM I;  2OOX B;  3DDD A;  2B63 I;  3TTH A;  1Y1W I;  1M1D A;  4X3R A;  2DE6 A;  1HDQ A;  4MY0 A;  2Q7B A;  1V0C A;  3PB7 X;  4NGT A;  2KCW A;  2VEZ A;  2BO9 A;  3S15 I;  1ZLI A;  3BG1 B;  3FF3 A;  3CQZ I;  1CPX A;  2PJ8 A;  1MJA A;  3VWE A;  3PB9 X;  4UCN A;  5F49 A;  2OTJ 1;  1B6B A;  5LYL A;  5G1Z A;  2FVG A;  4UFW A;  3K2K A;  4A31 A;  4B10 A;  3WR7 A;  4OKO A;  2Q0Y A;  1KC8 1;  2E7Z A;  1Z8X A;  2ZEO A;  2IL4 A;  1S7K A;  1QSR A;  1K73 2;  2FT0 A;  1RXT A;  3D9X A;  4OAE A;  2PJC A;  4CGO A;  1VQ7 1;  2ZAE B;  2G3A A;  1TXR A;  3R95 A;  2IQ6 A;  5AG7 A;  1S5K A;  4R87 A;  3TOB A;  4E30 A;  3BI1 A;  3WC5 A;  4A3M I;  3CC4 Z;  3B3V A;  4P44 A;  4UWI A;  4JJX A;  4IK2 A;  1WWZ A;  1Q2Y A;  2YNC A;  4E2A A;  3FMC A;  4FD4 A;  4C2X A;  1ARM A;  3FKI I;  4XNH B;  4FD7 A;  3S16 I;  3D3S A;  3J80 f;  3CCV Z;  3CCE 1;  4YGO A;  3VMH A;  4ZX8 A;  1ZG8 A;  3CCU 1;  4F6A A;  2V45 A;  1P0H A;  3ESW A;  3NFZ A;  1YUK A;  1KUX A;  1CPS A;  4HH4 A;  3GTQ I;  1BO4 A;  3IC1 A;  4UEE A;  1SQH A;  4AB7 A;  4RUH A;  2PJ2 A;  1YQE A;  2HB6 A;  5CNP A;  4UBR A;  2GRE A;  3VTN A;  4RVH A;  2IZ4 A;  1YHQ 1;  2VZZ A;  1KQS Z;  3I55 1;  3I55 Z;  5I0C A;  1OZP A;  2C6C A;  1TWF I;  2FCK A;  1KC8 2;  2R6M A;  1Q16 A;  2AFM A;  2R92 I;  4MD9 A;  1VGY A;  2ZOF A;  3F8K A;  3GTL I;  3LWU A;  2C27 A;  2RBL A;  3PBE A;  2Z3L A;  5I4M A;  2QA4 Z;  4A2Z A;  3LMS A;  2Q4Z A;  1YJW Z;  2KPI A;  5H84 A;  5C88 A;  3FEE A;  1TWH I;  1JWQ A;  3D7H A;  3SI2 A;  1IB1 E;  4A33 A;  5DWM A;  3CC2 1;  4CAV A;  4MJ8 A;  2RT9 A;  3TDH B;  3CC2 Z;  2NAP A;  4CL1 A;  4ZBG A;  3BXM A;  4NBH A;  2RHB A;  1RO4 A;  1IU8 A;  1KUY A;  3JVN A;  1VQO Z;  4NEX A;  1VLA A;  2Q7S A;  3IWE A;  3NA6 A;  2DE7 A;  3H8F A;  3MZL B;  2DEA A;  4NBB A;  4OIW A;  3GKQ A;  1FY7 A;  2JUB A;  4BBR I;  3MZK B;  4MFJ A;  5IP9 I;  2VI7 A;  8CPA A;  1YJ9 Z;  3FED A;  5GCN A;  3VMG A;  5D29 A;  2JEW A;  2ZEE A;  2HQY A;  4HGZ A;  2VL1 A;  2I3C A;  4P4I A;  3J81 f;  3JUW A;  4EME A;  2ABZ A;  5LRK A;  1NSA A;  5HH1 A;  2OZK A;  4NGS A;  4B5O A;  1PU9 A;  1SFO I;  3J80 b;  4NGN A;  1JJ2 Y;  4HPS A;  1GHE A;  1IIC A;  5HXD A;  2OZG A;  3NH4 A;  2AFO A;  2C6G A;  3H8G A;  2XEI A;  4BIN A;  1VQ4 1;  3CXC Y;  4PSW A;  1M4L A;  2EO8 A;  3R9E A;  1M4I A;  2JIO A;  3PB6 X;  1LFW A;  5A2Q f;  2P6F A;  3R9F A;  5T67 A;  4CYP A;  2R93 I;  3FQQ A;  3N7Z A;  2PK7 A;  4NFR A;  3CXS A;  3QAY A;  5J1Q A;  2QLV B;  3G8W A;  5IT9 f;  2J6A A;  2QEX 1;  3UY5 A;  3CCR Z;  3U50 C;  4TNU A;  2PJ5 A;  2JA6 I;  1XBU A;  2BSW A;  1YIJ 1;  4B13 A;  4FBE A;  3G3S A;  4R7M A;  1QYP A;  5LRG A;  3GLJ A;  3S6K A;  3KHZ A;  5LL6 f;  2LIY A;  1TF8 A;  2B5G B;  1Z03 A;  2REE A;  2NVX I;  1N8R 1;  3HOU I;  5C4J I;  1ZB9 A;  1HEE A;  1ELM P;  1H8L A;  3PP9 A;  4UCM A;  3DNS A;  1P9N A;  4ZY0 A;  1UWY A;  1IGB A;  4M85 A;  3VWD A;  2O28 A;  3I1U A;  5EC4 A;  4MHP A;  3B3W A;  2Z11 A;  4CYN A;  4A3B I;  2QRC B;  5LYF A;  4KUA A;  2O53 A;  4P45 A;  5IX3 A;  4NBC A;  2DF5 A;  1OBR A;  4NGR A;  1Z8T A;  3FXT A;  3LD2 A;  3HOV I;  1XMB A;  4LQG A;  2E9H A;  3IFU A;  3HOW I;  1LAN A;  4M3S A;  3BHX A;  2VPZ A;  4AYB A;  1NSL A;  7CPA A;  1JQG A;  2GTH A;  1VQK Z;  3LOD A;  4ZYQ A;  2PJ6 A;  4KOU A;  1NE9 A;  2QRE B;  4CGM A;  1KZF A;  1QST A;  3CCM 1;  4A3D I;  5KTD A;  1S7L A;  4UWJ A;  3CCM Z;  4P4F A;  3CME Z;  4BY1 I;  1VQ5 Z;  2ZW7 A;  3J81 b;  3BJ7 A;  2AJ6 A;  4KOT A;  2CF4 A;  2X7B A;  1Z4E A;  3KQZ A;  3Q87 A;  3PFO A;  5A28 A;  2P3Y A;  3PO3 I;  1LAM A;  2QVP A;  5DS0 A;  4A94 A;  1AUG A;  2F7V A;  4KOV A;  1YRE A;  1QXF A;  4E2W A;  1R9T I;  4BY7 I;  4Z65 A;  3CD6 1;  2ATR A;  3FEC A;  3H5Z A;  4A95 A;  4CAW A;  1B87 A;  1QVG Z;  1XJO A;  4UA3 A;  5LYD A;  3EO4 A;  4TWE A;  4XX2 A;  1VQL Z;  4Q38 A;  3K7A I;  1Z2L A;  2AYD A;  1WCM I;  4RN7 A;  1S3Z A;  3LAC A;  1S72 Z;  4EWT A;  5IT9 b;  1F2O A;  4Y7N I;  4GS4 A;  4A3I I;  4DJL A;  4A93 I;  2K5R A;  4CAX A;  1VIX A;  4AG7 A;  5J8C A;  1K8A 1;  1EE3 P;  5T64 A;  5FLM I;  1YI2 1;  1Y9K A;  2AFZ A;  4YWY A;  4Q36 A;  1WW9 A;  5C4X I;  3V7Z A;  5JGF A;  5EMI A;  4K30 A;  2FSR A;  4C7I A;  1FDO A;  4PPZ A;  2E2J I;  3GTM I;  2JIR A;  2VQY A;  2CNS A;  4RI1 A;  1U6M A;  2JA7 I;  2I00 A;  1I50 I;  2YNE A;  4UCP A;  4CGN A;  4JLY A;  4PV6 A;  1XMT A;  3S9L A;  2HF1 A;  5IV0 A;  2CXA A;  4F0X A;  4MHN A;  1NP6 A;  3S2H I;  1X3W A;  4R8F A;  2Y0M A;  2PMZ A;  4II9 A;  1MJB A;  4UF4 A;  4NJR A;  3CCS 1;  1RQF A;  3CCS Z;  2VBQ A;  4GM5 A;  3EC4 A; 
#chains in the Genus database with same CATH homology
 1Y0R A;  3FVL A;  3I55 Z;  3GUX A;  4RV9 A;  4E2Z A;  1XFO A;  3KHX A;  1L1O C;  2HU9 A;  2C6C A;  5IB9 A;  4NH1 C;  1YME A;  1AYE A;  1TWF I;  4PQA A;  4RVD A;  1KC8 2;  4NB9 A;  2OR4 A;  4PXC A;  1Y1V S;  2R6M A;  2AFX A;  3CCL 1;  1RNI A;  2O4H A;  2AFM A;  1TF9 A;  4A3L I;  1VQ4 Z;  3CCL Z;  1PFT A;  1CX8 A;  2PVW A;  2ZOG A;  3IWW A;  4MCR A;  3TC8 A;  2R92 I;  3SJG A;  3D67 A;  4MD9 A;  3T4N B;  2JBJ A;  2Q51 A;  1VGY A;  2ZOF A;  1USP A;  2PJ4 A;  2OOY B;  3D4U A;  3SI1 A;  5AN9 F;  2EWB A;  2NSM A;  4UIA A;  1FT7 A;  3PB4 X;  3GTL I;  2XEF A;  2GU2 A;  2NYQ A;  3D68 A;  3LWU A;  5FLX b;  1TFI A;  2ANP A;  4PXD A;  3L2N A;  4IAV A;  2RBL A;  1M90 2;  3QWU A;  3PBB A;  2R7Z I;  1Q86 1;  5D1O A;  1CP7 A;  3PBE A;  2KI7 B;  1N8R 2;  5I4M A;  3QNV A;  4WWV A;  2QA4 Z;  3LMS A;  4A38 A;  2Q4Z A;  1YJW Z;  3VH9 A;  2KPI A;  2XEJ A;  3S14 I;  1TWH I;  3FEE A;  4UIB A;  2QEX Z;  1I3Q I;  1JJ2 Z;  5K8P A;  3CMA 1;  3D7H A;  3SI2 A;  3S9N A;  2E2I I;  1VQL 1;  4NJQ A;  1YJN 1;  3CPA A;  2V8H A;  1YW6 A;  2PRQ A;  3CC2 1;  3NDI A;  3KIH A;  1YJN Z;  3KQX A;  3TE5 B;  2RT9 A;  3D7F A;  3TDH B;  3CC2 Z;  3WAB A;  1XRY A;  1LQL A;  4CL1 A;  3CC4 1;  2LFU A;  3CXC Z;  4DYO A;  1YIJ Z;  3RZO I;  4JZ0 A;  1S72 1;  1Z01 A;  2Q43 A;  3BXM A;  3RZD I;  4NBH A;  2JR6 A;  2RHB A;  1ARL A;  3B35 A;  4P6Y A;  3TX8 A;  1S7M A;  3S1M I;  4NGQ A;  4RS4 A;  3VMI A;  1RO4 A;  1K8A 2;  1TWA I;  1Q7Y 1;  2C6P A;  4YU9 A;  4ZX9 A;  2W03 A;  1VQO Z;  3EED A;  1Y0Y A;  1F2P A;  2K3R A;  2PJ1 A;  1VLA A;  4A39 A;  3NA6 A;  2DE7 A;  1LAP A;  1TWC I;  3GTP I;  3H8F A;  4A37 A;  3CCV 1;  1N2F A;  2Y0S A;  3MZL B;  2DEA A;  4P4J A;  1Y1V I;  4NBG A;  4NBB A;  1M1K 1;  3D66 A;  4OIW A;  4UEF A;  3M4O I;  2ZEG A;  3KGQ A;  3GKQ A;  2JUB A;  1KQS Y;  1VQN Z;  2E2H I;  4BBR I;  1Y7E A;  2RFH A;  5THW A;  3CCQ Z;  3MZK B;  3CC7 Z;  3FH4 A;  4P4B A;  1Q81 2;  4OME A;  5IP9 I;  3B3T A;  2CTB A;  8CPA A;  2PE3 A;  1K9M 2;  1YJ9 Z;  3FED A;  1LCP A;  1KRL A;  3HOX I;  1X0T A;  3S1N I;  4FWU A;  4MCQ A;  3T8W A;  1BAV A;  3VMG A;  2ZEM A;  5D29 A;  2JEW A;  5LYI A;  4A3J I;  1ZG7 A;  1YSJ A;  4MCS A;  2ZEE A;  3IIB A;  4HGZ A;  2VL1 A;  2I3C A;  6CPA A;  5HVG A;  4F9U A;  4EWC A;  3BG0 B;  4PXE A;  4P4I A;  3J81 f;  4EME A;  1ZB8 A;  2M6N A;  2VUG A;  2ABZ A;  3I56 1;  2RPR A;  5LRK A;  1I6H I;  2AFS A;  3G6E Z;  4P4D A;  1NSA A;  3I56 Z;  3G4S Z;  1R43 A;  2IMO A;  4R6T A;  2BOA A;  1RO0 A;  5CM2 M;  3IEH A;  2OZK A;  2OTL 1;  4NGS A;  4F9V A;  4RVG A;  3JRU A;  2NVY I;  4MD7 A;  2OTL Z;  5F09 A;  3FX6 A;  1SFO I;  3H8E A;  3IX0 A;  3RZA A;  4FAI A;  3J80 b;  1QVG Y;  3WC7 A;  1CP6 A;  1JJ2 Y;  4NGN A;  2HC9 A;  3I07 A;  2ZEP A;  5HXD A;  2ZEF A;  1DTD A;  1F57 A;  2PM9 A;  3NH4 A;  2ZEL A;  2AFO A;  2C6G A;  1VQM Z;  3H8G A;  5CPA A;  4MD8 A;  4OC1 A;  2XEI A;  1QQ9 A;  2RB7 A;  1VQ4 1;  3CXC Y;  4A3F I;  4NBE A;  2JBK A;  1M4L A;  5ELY A;  5C44 I;  4KSI A;  3WT4 A;  4AXV A;  3S1Q I;  2JNY A;  3PB6 X;  5JM6 A;  2W04 A;  1LFW A;  2C1C A;  5A2Q f;  3GTK I;  4A3C I;  1GYT A;  2PIZ A;  4OC5 A;  5T67 A;  1NJI 1;  4A3K I;  4OC0 A;  1VHE A;  1Q86 2;  3JAM f;  4WJB A;  3DGV A;  3S1R I;  2R93 I;  4B6Z A;  3FQQ A;  4F8Z A;  3V38 A;  5HVH A;  1HDU A;  3OW2 Z;  3S9M A;  3H0G I;  1YUA A;  2PK7 A;  1Z02 A;  4NFR A;  3IO1 A;  1Z5R A;  3LUS A;  5J1Q A;  2OTJ Z;  5D1P A;  3B3C A;  2QLV B;  2QA4 1;  1ZG9 A;  1YJW 1;  5IT9 f;  4G1P A;  2J6A A;  4PXB A;  2YAD A;  4R76 A;  3HKZ A;  2V8D A;  3DLJ A;  2QEX 1;  3G71 1;  3HOZ I;  2PJB A;  3CCR Z;  4S1T A;  3U50 C;  3G71 Z;  3KAS A;  4TNU A;  2PJA A;  3F3P C;  4Q7A A;  1JWH C;  4E33 A;  2PJ5 A;  2JA6 I;  4FUU A;  1XBU A;  2NVT I;  3WC6 A;  1YIJ 1;  1Q7Y 2;  4FBE A;  3NH5 A;  4R7M A;  3K9T A;  2V77 A;  1QYP A;  5LRJ A;  3CD6 Z;  4MH4 A;  5LRG A;  2F4M A;  3GLJ A;  4QTT A;  3MON A;  1QMU A;  3ISZ A;  3KHZ A;  3HUV A;  5LL6 f;  2JMO A;  1Q82 1;  1K73 1;  1FNO A;  3IFE A;  4ZY1 A;  2LIY A;  1VQO 1;  1TF8 A;  4EFD A;  1VQ7 Z;  1M1K 2;  1Z03 A;  2PIY A;  2NVX I;  3VAT A;  5A2Q b;  1W2B Z;  1N8R 1;  1VQP 1;  3D6W A;  4X6A I;  3GTO I;  1QVF Z;  2PCU A;  3HOU I;  1VQP Z;  5C4J I;  2V8K A;  3D7D A;  4DQY B;  1ZB9 A;  2RIQ A;  1HEE A;  3PFE A;  1VQN 1;  2F4O A;  3CCQ 1;  4NBA A;  1VQ6 Z;  3CC7 1;  1ELM P;  2QYV A;  1H8L A;  3GCF A;  4IHM A;  3I4N I;  1P9N A;  4ZY0 A;  3PO2 I;  2ZED A;  4NGM A;  3VB9 A;  5C3E I;  1YJ9 1;  1UWY A;  2POK A;  3B2Y A;  1IGB A;  2NVQ I;  2AFW A;  3B7I A;  3KR5 A;  5K8O A;  3I1U A;  3KL9 A;  2WZN A;  2WAQ A;  4MMO A;  2YU9 I;  1BPN A;  4MHP A;  3IF8 A;  1PCA A;  3B3W A;  3PO3 S;  2M48 A;  1LOK A;  1CG2 A;  4A3B I;  4NB8 A;  4P4E A;  1YI2 Z;  2QRC B;  2BJO A;  5LYF A;  3CCE Z;  4H2K A;  3GTJ I;  3G6E 1;  2ZEN A;  1KD1 1;  4BBS I;  2O53 A;  1VQ8 1;  3G4S 1;  1K83 I;  3CCU Z;  4P45 A;  3RBU A;  4NBC A;  2WB1 A;  1VQ8 Z;  3OW2 Y;  4MHZ A;  3EER A;  1Z8L A;  1OBR A;  3CPX A;  4MHY A;  4NGR A;  4E2Y A;  2P28 A;  3CCJ 1;  2V8J A;  3MN8 A;  2PJ3 A;  4A3E I;  2VUM I;  3CCJ Z;  2OOX B;  3HOV I;  1XMB A;  1TWG I;  2PJ7 A;  4LQG A;  5K8N A;  2E9H A;  3IFU A;  2B63 I;  3HOW I;  1LAN A;  3I4M I;  2V8G A;  3BHX A;  4AYB A;  5K8M A;  2PVV A;  1Y1W I;  1VQM 1;  5FLX f;  4X3R A;  7CPA A;  2DE6 A;  2GTH A;  1HDQ A;  1JQG A;  1VQK Z;  2QJ8 A;  3HOY I;  4ZYQ A;  3PB7 X;  2PJ6 A;  2GLJ A;  4NGT A;  5IP7 I;  1NJI 2;  2BO9 A;  3F3F C;  2QRE B;  3SJF A;  3S15 I;  2AKL A;  3BG1 B;  1ZLI A;  3BI0 A;  3FF3 A;  2PJ9 A;  3ISX A;  5CBM A;  3CCM 1;  4K3N A;  4X2T A;  4O23 A;  3N5F A;  3CQZ I;  2EK8 A;  4A3D I;  1CPX A;  2PJ8 A;  3CCM Z;  1YHQ Z;  3S17 I;  1QF8 A;  1VQ9 Z;  4P4F A;  3CME Z;  4BY1 I;  3PB9 X;  2QRD B;  1VQ5 Z;  3VAR A;  3J81 b;  1W2B Y;  2WYR A;  2GLF A;  5T6B A;  4E2X A;  2OTJ 1;  3SJE A;  1QVF Y;  5LYL A;  4OC2 A;  2CF4 A;  2FVG A;  1KWM A;  1DL6 A;  1YW4 A;  4RVF A;  4BXX I;  1VHO A;  3KQZ A;  3Q87 A;  4BD9 A;  4MCP A;  3K2K A;  2XEG A;  3PFO A;  4JYW A;  2P3Y A;  2H85 A;  3CCR 1;  4OC3 A;  2V8I A;  3PO3 I;  1LAM A;  2QVP A;  3HLP A;  5DS0 A;  4A94 A;  2F7V A;  4OKO A;  1AMP A;  2EK9 A;  1KC8 1;  2JA8 I;  1ML8 A;  5JH9 A;  1TKF A;  4E2W A;  1RO2 A;  1R9T I;  4CPA A;  4BY7 I;  3CPW Z;  4DGL A;  4E32 A;  4Z65 A;  2ZEO A;  3J7A 4;  4NOZ A;  3GTM S;  1Q82 2;  1K73 2;  3FQM A;  2IZ3 A;  3CD6 1;  3FEC A;  4OID A;  3PRT A;  4DK1 A;  3D9X A;  3PB8 X;  3NH8 A;  1BPM A;  1BLL E;  4NGP A;  5HVF A;  3S2D I;  2EGT A;  2PJC A;  1VQ7 1;  3SI0 A;  4ZY2 A;  2ZAE B;  4ONW A;  3IJ3 A;  1QVG Z;  4X8I A;  1M90 1;  1XJO A;  1TXR A;  2IQ6 A;  4A3G I;  3CMA Z;  2GTI A;  4QTU A;  5LYD A;  4TWE A;  5D8N A;  4Y52 I;  4XX2 A;  1ELL P;  4MXU A;  1VQL Z;  1RTQ A;  3JAM b;  2AFU A;  4E30 A;  3BI1 A;  1YIT 1;  3WC5 A;  1X3Z A;  3K7A I;  1VQ6 1;  1YIT Z;  4A3M I;  3CC4 Z;  1Z2L A;  1ZLH A;  3B3V A;  4P44 A;  4HGY A;  1WCM I;  1S72 Z;  4EWT A;  3KIF A;  5IT9 b;  3SJX A;  1F2O A;  4IK2 A;  2V8V A;  2G2K A;  4Y7N I;  2CTC A;  4A3I I;  4DJL A;  4A93 I;  2K5R A;  4MON A;  3FMC A;  2F8H A;  4MRI A;  1VIX A;  1ARM A;  1R3N A;  1K8A 1;  3FKI I;  1IY7 A;  1EE3 P;  5T64 A;  3S16 I;  1PYT B;  4NBD A;  1KD1 2;  5FLM I;  2QKD A;  3J80 f;  3CCV Z;  3KR4 A;  4NBF A;  3NDJ A;  1YI2 1;  2AFZ A;  4YWY A;  3CCE 1;  1ZH1 A;  3KZW A;  1WW9 A;  5C4X I;  3VMH A;  4ZX8 A;  1ZG8 A;  3V7Z A;  5JGF A;  3CCU 1;  1VQ5 1;  3GTG I;  2J9A A;  3GB0 A;  4PPZ A;  2BCO A;  1TKJ A;  2G9D A;  2ZEH A;  2PJ0 A;  3KI9 A;  2JS4 A;  3P5J B;  2E2J I;  3ESW A;  1CBX A;  3NFZ A;  3GTM I;  4UEZ A;  3FJU A;  1YUK A;  2CIJ A;  1CPS A;  1WII A;  2JA7 I;  4HH4 A;  1I50 I;  1YLO A;  3GTQ I;  1Q81 1;  3IC1 A;  3S9L A;  4UEE A;  1RLY A;  2HF1 A;  1K9M 1;  4DUK A;  4MHN A;  3CDX A;  4RUH A;  1NP6 A;  3S2H I;  1DE4 C;  1TKH A;  2PJ2 A;  1X3W A;  4E31 A;  4W9Y A;  3CPW Y;  1VQK 1;  4R8F A;  2QR1 B;  3H3V J;  3CT9 A;  3MRU A;  2PMZ A;  1USP B;  2HB6 A;  2OOT A;  2VF1 A;  4NJR A;  4UF4 A;  2GRE A;  4ZI6 A;  2JA5 I;  2DE5 A;  3CCS 1;  1RQF A;  4RVH A;  2IZ4 A;  3VTN A;  3RAM A;  1NUI A;  3D7G A;  2IJZ A;  1Q7L A;  4OC4 A;  3CCS Z;  3PEI A;  1YHQ 1;  3B3S A;  1VQ9 1;  3M3Y I;  1KQS Z;  4P10 A;  3I55 1;  4OP4 A;  4GM5 A;  3CME 1;  5D1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...