2O4HA

Human brain aspartoacylase complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
b'HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
molecule tags Hydrolase
source organism Homo sapiens
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o4hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o4hA01
3K9TA 3B3VA 1H8LA 1XBUA 3IJ3A 2GLJA 4FUUA 1LANA 3WABA 1TF8A 1F57A 3V7ZA 4NGRA 1GYTA 2NSMA 2G9DA 2ANPA 4ZY0A 1R43A 5I4MA 5HVHA 2AFMA 2IJZA 2QJ8A 1ZG9A 3SI1A 3H8GA 1ZLHA 4MMOA 5CBMA 4WWVA 3LWUA 3DGVA 2PIZA 3SI0A 4PXCA 2PJ6A 4X8IA 2OR4A 4NGQA 2PJ1A 2WYRA 1ARMA 4NGMA 2ZENA 4OC5A 2XEIA 4G1PA 3JRUA 4MHNA 2ZEHA 3WC6A 3IIBA 2CF4A 3B35A 2RFHA 3WC7A 1KWMA 3RBUA 2QYVA 4W9YA 3S9LA 2ZEMA 4IAVA 1TXRA 2OOTA 3CT9A 1HDUA 2BCOA 2VL1A 4AXVA 4MCPA 1CP7A 2V77A 4OC2A 2AFZA 1JQGA 1VIXA 1QQ9A 1BPMA 3TC8A 2XEGA 2C1CA 1R3NA 3KR5A 2ZEPA 3GB0A 1XJOA 4ZY1A 3CDXA 2JBJA 1CPSA 2ZEGA 2FVGA 2ZEDA 4RUHA 4ONWA 2PJ9A 1EE3P 3CPXA 3SJXA 3FEEA 5HVFA 3BI1A 1F2OA 4OKOA 1Y0RA 2V8DA 3PBEA 2F8HA 3PRTA 1QMUA 1ZLIA 4ZY2A 3T8WA 3VH9A 3VARA 3KHXA 1XFOA 2PJ0A 1IGBA 2ZOGA 1CBXA 1Z5RA 3S9NA 4X2TA 4YWYA 3FEDA 4NJRA 6CPAA 2GLFA 4NFRA 8CPAA 4PXBA 5LRGA 4GM5A 1BPNA 4P6YA 4A37A 4B6ZA 1ELMP 1TKHA 3NH4A 4NGNA 3D67A 2PE3A 4TWEA 1LOKA 5DS0A 3GUXA 3TX8A 4X3RA 3IWWA 1IY7A 5JH9A 1YW4A 2BO9A 2PVWA 1Y7EA 4JYWA 2HB6A 1Y0YA 1TF9A 3KR4A 4A38A 3D4UA 3B3SA 2PJ2A 3IC1A 2Q51A 3SI2A 4UIAA 1PCAA 4MCSA 4OC4A 1BLLE 5LYDA 2J9AA 5JM6A 2Q43A 5JGFA 5THWA 4LQGA 2CTBA 1LCPA 2PJAA 4DJLA 3SJGA 1YMEA 4P4JA 3QNVA 5D8NA 4NGSA 4FWUA 4KSIA 2CIJA 4CPAA 2ZEOA 4DUKA 1Q7LA 3KL9A 1CP6A 4NGPA 4ZYQA 1FT7A 2AFOA 3KGQA 5IB9A 4UF4A 3FF3A 4P4FA 4P4BA 2PIYA 3PB8X 3PB4X 3KI9A 3N5FA 3SJEA 3IO1A 1YW6A 2PJBA 4OP4A 4YU9A 3D7FA 2EK9A 4OIWA 7CPAA 5K8NA 1TKFA 1UWYA 5CPAA 1M4LA 4K3NA 2O53A 5K8MA 2CTCA 3V38A 1AYEA 2AFWA 4UEFA 3D7GA 2POKA 4PQAA 2DEAA 3B3TA 2GREA 1CX8A 4EWTA 1FNOA 3PFOA 2F7VA 2PJ3A 2PJ4A 1F2PA 3BI0A 2PJ7A 3KQXA 5J1QA 3HLPA 1BAVA 3L2NA 3KASA 3WC5A 2ZELA 1XMBA 1PYTB 3FX6A 1TKJA 4EMEA 2GU2A 4ZX8A 1ARLA 2IMOA 2V8GA 2Q4ZA 3K2KA 3DLJA 3PB9X 2PJ5A 4BD9A 5F09A 4P10A 3BHXA 3B3WA 3IEHA 3PB6X 1HEEA 2C6PA 4PXEA 4NJQA 2ZOFA 3PBBA 1CPXA 2AFSA 3LMSA 4A39A 2ZEFA 4EFDA 2RB7A 4OC0A 2C6GA 4IHMA 1DTDA 1AMPA 5HVGA 5D29A 4F9VA 4R7MA 2PJCA 2AFUA 4JZ0A 3D68A 5K8OA 2AFXA 1VHOA 3B3CA 3MRUA 4MCQA 2JEWA 1VHEA 4UEZA 3D7DA 4DYOA 3FMCA 3RAMA 1Z2LA 3H8EA 3HUVA 2XEFA 1LAMA 2HC9A 3FVLA 3D7HA 4P4EA 4F9UA 2JBKA 1XRYA 4IK2A 1DE4C 3I1UA 1HDQA 3FECA 2PRQA 4OIDA 1Z8LA 4Q7AA 5LRJA 4OC3A 3ISXA 1VGYA 5K8PA 4MXUA 3VATA 2ZEEA 4PXDA 5HXDA 2PCUA 5LRKA 4MRIA 1OBRA 1ZG7A 3D66A 3PEIA 4PPZA 3RZAA 5LYIA 1RTQA 3H8FA 4FBEA 3PB7X 2O4HA 3B2YA 2I3CA 2NYQA 4OMEA 3KQZA 4ZX9A 2PVVA 4MHYA 3MN8A 1YLOA 3FH4A 1CG2A 4P4DA 4P45A 4H2KA 1LAPA 3IFEA 4MHPA 2PJ8A 4O23A 3KZWA 4UEEA 4A94A 5LYFA 4TNUA 4ZI6A 3B7IA 2WZNA 3WT4A 5ELYA 2V8HA 4R8FA 4Z65A 3FJUA 3ISZA 2IQ6A 2XEJA 3S9MA 3BXMA 2C6CA 4R6TA 4R76A 3NFZA 3NH8A 2V8VA 3NA6A 4NGTA 4MCRA 3CPAA 5LYLA 4FAIA 4OC1A 2EK8A 3SJFA 4UIBA 2EWBA 2QVPA 1LFWA 4MHZA 1YSJA 4P44A 1ELLP 2BOAA 3GLJA 4P4IA 3KHZA 2ABZA 3PFEA 4F8ZA 3NH5A 1ZG8A 4WJBA 1NSAA
chains in the Genus database with same CATH superfamily
3K9TA 4C68A 3WABA 3V7ZA 5IB0A 2PM9A 1R43A 5HVHA 3HOXI 2QJ8A 1ZG9A 1M1DA 3H8GA 4R3LA 4NBAA 4MMOA 5CBMA 5T64A 4WWVA 3K9UA 3SI0A 1KRLA 3JUWA 3Q87A 2PJ6A 2OR4A 4NGQA 2PJ1A 2WYRA 5FLXf 1K731 4OC5A 3JRUA 4MHNA 1S72Z 3CCL1 3S6FA 3QWUA 1S7LA 2Q7SA 1KUVA 1KWMA 2QYVA 4A3KI 4DK1A 4ZGYB 3IU1A 3S9LA 4IAVA 1TXRA 3CT9A 2ZPAA 1HDUA 1QSNA 1Y1WI 2Q44A 1Q2YA 2V77A 2P6EA 3ESWA 1BPMA 2JR6A 2C1CA 3UY5A 1IOIA 5KTAA 4CYQA 3CPWZ 4NBHA 3KIFA 3SJXA 1UFHA 2M48A 3LUSA 3BI1A 1F2OA 4OKOA 1YUKA 1SQHA 5HH1A 3HOWI 2F8HA 1ZLIA 2X7BA 2JUBA 4M85A 3DR6A 2H85A 3VH9A 3KHXA 1YIJZ 1Y1VS 3MZKB 3CCM1 3PO3I 1I21A 4AYBA 4X2TA 1P9NA 2F5IA 6CPAA 1QVFZ 2YU9I 2GLFA 3D2MA 4JJXA 4PXBA 5LRGA 1BPNA 1M4IA 3TO9A 4AG7A 4QTTA 2DE6A 1TKHA 1JWQA 4NGNA 4TWEA 1LOKA 2QRCB 5DS0A 1USPA 1KUXA 5IP9I 1XIXA 4A2ZA 4X3RA 2J6AA 4Q36A 3G71Z 1KUYA 4RVDA 3C26A 2BO9A 1RO5A 1KC82 3CXCZ 3WR7A 3I55Z 5AG6A 5I0CA 3IC1A 2YNDA 2P6FA 4NCZA 4UIAA 3TTHA 4OC4A 3CD61 4KOYA 2J9AA 4RN7A 5JM6A 4KS9A 3SXNA 4S1TA 1M4DA 1Q862 4EWCA 4NB9A 2E2HI 3CQZI 4FWUA 2NVYI 4CGPA 3GY9A 4CPAA 4UA3A 4DUKA 2EUIA 3KL9A 1CP6A 1VQ41 5T67A 3BLNA 1VQK1 1I12A 4UF4A 3S1QI 3CD6Z 4P4BA 2V45A 4L8AA 3SJEA 1YW6A 2WUUA 2QKDA 3M3YI 3D7FA 1MJAA 5FVJA 4UFWA 5C3EI 2JA7I 3S1MI 3S1NI 3IX0A 2WPXA 4UCNA 2NMTA 5K8MA 2CTCA 2QECA 2OZGA 5D1OA 2AKLA 2AFWA 1V0CA 4J3GA 3GTMS 1FNOA 5A2Qf 2F7VA 5AG4A 2PJ4A 3ZZIA 1K8A2 2Y0SA 1BAVA 2Z3KA 3CCLZ 3L2NA 5KTDA 5JQ4A 2Z3MA 5DWMA 4ZBGA 1XMBA 3CZXA 5HMNA 3EC4A 2P0WA 3B8GA 4EMEA 2GU2A 4ZX8A 2JEVA 4MFJA 4A3BI 2IMOA 2I00A 3PB9X 2JA6I 4U5YA 3IEHA 2DXQA 4CGMA 4PXEA 2IL4A 2J8MA 2REFA 1Z8WA 5C44I 2ZW4A 4BXXI 3S16I 2AFSA 2EGTA 2V8IA 5FLXb 1GHEA 2W04A 5IV0A 2G3AA 3BG0B 3BG1B 1AMPA 4FD6A 5HVGA 3I4MI 4JZ0A 1IYKA 1S5KA 2OU2A 3D68A 1M1K2 2VQYA 4C7IA 2AFXA 1X0TA 5F49A 1YJW1 4UBRA 4AVBA 3RAMA 1SIWA 3JAMb 2XEFA 2K3RA 3GTKI 2PR1A 3HOUI 2D4OA 2HC9A 4R57A 1M901 3FVLA 3GCFA 3CCEZ 3P5JB 3S14I 4I49A 2FIWA 2PRQA 1Z03A 4Q7AA 2ZXVA 4MFPA 1VGYA 5K8PA 3VATA 2ZEEA 3R96A 4MONA 3J7A4 3PEIA 4PPZA 3RZAA 1RTQA 3H8FA 4FBEA 3PB7X 3I551 1VQ61 3T9YA 3B2YA 2Q4YA 3K7AI 5A2Qb 4ZX9A 1YK3A 3KIHA 2PVVA 2A4NA 4P4DA 2YNCA 4RV9A 3IWGA 3IFEA 4LQ6A 2OOYB 3NE7A 4UEEA 3T4NB 2OZKA 3TE5B 4Z65A 3D9XA 3OWCA 2IQ6A 4E31A 1VQ6Z 4XPKA 3I56Z 5F47A 3NFZA 2V8VA 1WW9A 4MCRA 4HKFA 1YITZ 1K9M2 4OC1A 2OH1A 4MJ8A 3G6EZ 2QVPA 1LFWA 4NSQA 1Q7Y1 1XEBA 4XNHB 3GLJA 4KOUA 4P4IA 2ABZA 5DWNA 1QF8A 1I1DA 1B87A 3RNZA 3B3VA 4KLVA 1VQLZ 4NEXA 1Z01A 2GLJA 3CCQZ 1TF8A 1F57A 4OLLA 2NSMA 4HNWB 2G9DA 2JDDA 2P6GA 4Y52I 2V8KA 4B12A 1YJ91 3LWUA 4M6GA 4AB7A 4FD4A 4X8IA 2B3UA 1WIIA 1ZB8A 1ARMA 4CGLA 5EC4A 1IYLA 1VQP1 2XEIA 1MJBA 4KSAA 3OW2Z 2O28A 4A3FI 3CC71 5AG7A 2HV2A 4C2XA 3U50C 4Y49B 2EVNA 4CGOA 4AXVA 1YVKA 3TE4A 1YGHA 4A32A 1Y9WA 2YNCC 1VQO1 2PSWA 3FYNA 2E7ZA 2ZAEB 2B4DB 4NH1C 3J80f 2P28A 2J8NA 2ZEPA 3GB0A 4ZY1A 3CDXA 2JBJA 4QB9A 1YUAA 4ONWA 4Y7NI 1EE3P 3VWEA 3LODA 4NBFA 3F3PC 2B4DA 3HOYI 2Q4VA 2R8VA 4R9MA 2E9HA 1BO4A 3T8WA 3J81f 2PJ0A 2ZOGA 3EERA 1CBXA 1Z5RA 2YADA 3S9NA 1JJ2Z 3EXNA 5D1OB 4QVTA 1P4NA 1FDIA 2RPRA 4EVYA 4NJRA 2E2JI 1VQ8Z 2H5MA 4RS2A 2DPSA 4E2XA 2B3VA 3I3GA 4H89A 4A37A 1X10A 3CME1 5GCNA 3CCMZ 2DPTA 1Q7Y2 3GUXA 5H84A 4B11A 3A9LA 1JJ2Y 5LL6f 4UCPA 1YW4A 2JA5I 4PSXA 3KR4A 4HH4A 1VQ81 3B3SA 3CXSA 1PCAA 2PK7A 1S7FA 1K4JA 1K8A1 5THWA 3TO7A 4B13A 3KKWA 5F48A 2JIPA 3TO6A 2R92I 1YMEA 2B5GA 3QNVA 4KLWA 4NGSA 2CIJA 3JVNA 3SHPA 3V8IA 4NGPA 4IUSA 4JWPA 4ZYQA 3DR8A 4A93I 4F0YA 2OTJZ 2PIYA 1Y8CA 3PB8X 3PB4X 4M6HA 3KI9A 3N5FA 2BEIA 5T6BA 3PP9A 2WPWA 3CCUZ 2VXKA 5AG5A 1TKFA 2REEA 2YNEA 1YJ9Z 4YFJA 4RVHA 1AYEA 4LUAA 2HQYA 1RXTA 3H4QA 2DEAA 3B3TA 3G3SA 2GREA 4EWTA 1RQFA 2R98A 1WCMI 3HOZI 1F2PA 3BI0A 5J1QA 3KQXA 2G2KA 3NDIA 2CY2A 2PRBA 1N71A 2ZW7A 4BMHA 1M4GA 3FX6A 3FB3A 2V8GA 3SXOA 3EO4A 1KD12 1M44A 3DLJA 4CS0B 4U9ZA 4BD9A 4P10A 4QTUA 3BHXA 4CYPA 3CCVZ 4NJQA 1K732 2FXFA 1J4JA 3PBBA 2Z3OA 3PGPA 4MFKA 2ZEFA 2RB7A 3D2LA 3RO0A 3NDJA 3VWDA 2RC4A 1Q16A 3JAMf 5IP7I 4XX2A 1W2BY 4UWJA 4QUSA 3CPWY 4XNHC 3CCV1 1Z4EA 4RS4A 4B10A 2JEWA 4IF5A 3S17I 2QRDB 4UEZA 4YGOA 1YJNZ 3H8EA 3HUVA 3TT2A 5AN9F 5C4XI 1QXFA 3QAHA 1PFTA 2G0BA 4E2ZA 3PO2I 2JBKA 4IK2A 3I1UA 1VQ91 1HDQA 1NP6A 2OZUA 4AG9A 3CXPA 1CJWA 4OIDA 2Z0ZA 4KVME 1Z8LA 4FD5A 1YJWZ 3ISXA 4UCMA 4MXUA 1X12A 4PXDA 2AJ6A 4M6IA 2PCUA 2HU9A 3FNCA 4MRIA 2JIRA 1ZG7A 5EBVA 3GKRA 4FD7A 3H0GI 2NYQA 4NF1A 4XPLA 3D2PA 1ZH1A 3EY5A 1QYPA 4P45A 2VBQA 3VMGA 4XPDC 1TWCI 1Q822 1Q861 4A94A 3I07A 5CM2M 3B7IA 2WZNA 4C2ZA 2ATRA 5ELYA 4CGNA 3ISZA 5D1PA 1VQ4Z 3S6GA 4NGTA 2OTJ1 3SJFA 2LFUA 1S7KA 2I79A 4UIBA 1YSJA 4P44A 1QSOA 1ELLP 2F4MA 2JIOA 3RYOA 3PFEA 3NH5A 4MI4A 1XBUA 3IJ3A 2FCKA 3IU2A 4FUUA 2B63I 1GYTA 4ZY0A 2GANA 2QLVB 3F0AA 3TCVA 3SI1A 3EFAA 5C82A 3IF8A 1ZLHA 1VQM1 3DGVA 1FDOA 4PV6A 1K9M1 1X3WA 4NGMA 2JIQA 2ZENA 2VI7A 4G1PA 4A33A 2ZEHA 4BBRI 3IIBA 2BJOA 2CF4A 3B35A 2RFHA 1Z9UA 3IGRA 1IOFA 3D6WA 1VQMZ 4KOXA 3EEDA 2BCOA 4MCPA 1MK4A 2VEZA 1ZB9A 4OC2A 2AFZA 1JQGA 2BSWA 2PC1A 3FQQA 2B5GB 3TC8A 1R3NA 2F4OA 3KR5A 5ISVA 1ON0A 1CPSA 2ZEGA 2FVGA 4AVAA 1RLYA 2PJ9A 3CPXA 4A95A 3PO3S 5HVFA 1WJ2A 1QVGZ 1VQL1 3PBEA 2LIYA 4H6UA 1VQKZ 1M902 3VARA 1N8R1 4A3LI 4OADA 1XFOA 1TIQA 1IGBA 3VTNA 1VQ9Z 1Q2CA 5J8FA 4A3EI 4YWYA 3FEDA 2P3YA 4DNCA 4NFRA 2M6NA 8CPAA 4GM5A 3HKZA 1VQPZ 3J81b 4B6ZA 1S721 2QEXZ 2Q7BA 3D67A 4UFXA 3TDHB 3OW2Y 2VZZA 2FT0A 1MJ9A 1WK4A 1Q812 4JXRA 1IY7A 1QSMA 5JH9A 2PVWA 1Y7EA 1Z4RA 4JYWA 1Y0YA 4A38A 2PJ2A 2PDOA 3JTKA 3SI2A 4KVOE 2JDCA 4MCSA 4R87A 1BLLE 5LYDA 1NJI1 3R9EA 4BY1I 2FE7A 2Q43A 5JGFA 4LQGA 4NBCA 2CTBA 4HGZA 4HNXB 1LCPA 1K83I 3I4NI 4MFZA 5G1ZA 1KQSZ 3CCR1 4RVGA 1YJN1 4P4JA 1DL6A 1IIDA 5D8NA 3FXTA 5H86A 3RZDI 4HNYB 3H3VJ 1I50I 2AFOA 5IT9b 1NUIA 1QSRA 2AE6A 5IB9A 3FF3A 4P4FA 3DSBA 2LEXA 4M3SA 3GTJI 3CCQ1 4A3DI 4YRHA 1IU8A 3IO1A 3CCRZ 4NBBA 4OP4A 4YU9A 4OIWA 7CPAA 5K8NA 1M4LA 2HUZA 4HGYA 1YHQZ 4UEFA 3D7GA 5J8CA 1CX8A 2V8JA 2JIMA 1Z02A 3G8WA 2PJ7A 3R95A 3S2DI 3J80b 2Z11A 3WC5A 4A3II 2BL1A 4CAXA 2JS4A 3R1KA 2FSRA 3CC7Z 1PYTB 1TFIA 4X6AI 1Q821 4Q38A 4MD9A 5IT9f 1KD11 4MBUA 4DGLA 5BWAB 1ARLA 1XMTA 2Q4ZA 3K2KA 2PJ5A 2VPYA 5F09A 3B3WA 3PB6X 1HEEA 1Y9KA 3HOVI 3GTMI 2C6PA 4JLYA 5F46A 3DDDA 1VLAA 4MD7A 1Z8XA 3D3SA 4KOVA 2PQ8A 3MGDA 1CPXA 4EFDA 1YREA 4R3KA 4OC0A 1WZNA 1S60A 5JPHA 3CXQA 3S2HI 5D29A 4CAVA 2PJCA 2YGWA 3IWEA 1YIT1 5EMIA 5K8OA 1YR0A 3BJ8A 2WAQA 4DQYB 1XF8A 2Q0YA 1VHOA 3B3CA 2KPIA 3G4S1 3ZJ0A 3MRUA 4MCQA 2OOXB 1YI21 1VHEA 4B5PB 3D7DA 2R93I 4MD8A 1R9TI 4NBDA 1S7MA 2EO8A 3VMHA 4E2AA 1LAMA 2QIRA 1NJI2 3D7HA 4F9UA 2RHBA 1VQ5Z 1DE4C 3CMAZ 4ONUA 1NMTA 2R7HA 4H6ZA 3MZLB 5LRJA 2KI7B 3H5ZA 4OC3A 2D4PA 2ZW6A 3P2HA 2DE5A 5HXDA 5LRKA 1OBRA 1X3ZA 3D66A 2WB1A 4A31A 2RT9A 4KORA 2I3CA 3KQZA 4KVXA 1VQ51 1YHQ1 3MN8A 1JWHC 3G711 1CG2A 4H2KA 1LAPA 4MHPA 1I3QI 1B6BA 4NXYA 4O23A 3GTGI 4Y49C 3TOBA 4NOZA 4ZI6A 5A28A 2FL4A 2V8HA 1A2ZA 1WWZA 2OTLZ 3S9MA 2XEJA 3RZOI 2GIVA 2C6CA 1KC81 3NH8A 2Q04A 5LYLA 2EK8A 3TFYA 1M1K1 2EWBA 2NAPA 4MHZA 1TWHI 4E2YA 2BOAA 4CAEA 1NE9A 5FLMI 4F8ZA 1ZG8A 1S3ZA 1USPB 4HPSA 4WJBA 4OAEA 2DF5A 1KZFA 2VZYA 2OTL1 3LD2A 1H8LA 2JA8I 1TWGI 1LANA 4A3CI 2QR1B 1IICA 4QC6A 4NGRA 3LACA 2ANPA 1RO0A 5I4MA 3CC2Z 4RVFA 2AFMA 1YIJ1 2IJZA 1ML8A 4XPDB 1VKCA 2ZW5A 1VQ7Z 2QMLA 5C4JI 2PIZA 2NVTI 4PXCA 1QVFY 5E96A 2IV2X 3GIUA 4ORFA 5CNPA 3WC6A 3CMEZ 4NBGA 2CNTA 3WC7A 2R7ZI 2PR8A 4PK3A 3RBUA 5A27A 4F0XA 4W9YA 2RIQA 3FKII 2K5RA 2ZEMA 2OOTA 2CNSA 3FBUA 4A3GI 1LQLA 2VF1A 2VL1A 2CNMA 2KCWA 4K30A 1Y7RA 3I9SA 4CRYB 4A30A 1CP7A 3E0KA 1VIXA 1QQ9A 2FS5A 2XEGA 3GTOI 1XJOA 2GE3A 3GYAA 1LRZA 2Z3LA 3FRMA 1KQSY 2ZEDA 4RUHA 3GTPI 1PUAA 3TOAA 3FEEA 2C27A 1Y0RA 2V8DA 1Q2DA 3PRTA 1QMUA 4ZY2A 4B5PA 4KUAA 3MONA 4NB8A 3T90A 2QREB 4BY7I 3S1RI 3R9GA 1AA6A 1CM0A 2G3TA 1BOBA 4CL1A 3CCU1 4MHDA 2NVQI 2JMOA 4P6YA 4MH4A 1OZPA 1ELMP 4E0AA 1NSLA 3NH4A 2PE3A 3BJ7A 4E32A 3TX8A 3IWWA 3F5BA 2VUGA 4CYNA 1YLEA 2HB6A 1TF9A 3D4UA 1VQ71 2Q51A 3VB9A 1QVGY 3QAYA 1W2BZ 4BINA 4CRZB 2CXAA 1RO2A 2OB0A 2PJAA 3S15I 4DJLA 4GXHA 3SJGA 3VMIA 4KSIA 1IB1E 2ZEOA 4CAFA 1Q7LA 2VPZA 3I561 4AVCA 3CC4Z 1FT7A 2QA4Z 3CCS1 3NE8A 2Y0MA 3KGQA 2JLMA 3PZJA 2DE7A 4A3JI 4LX9A 3CMA1 2GTIA 3G6E1 3M4OI 2PJBA 2AYDA 3GTQI 2R1IA 1N2FA 2EK9A 1Y1VI 3S6KA 1UWYA 5CPAA 1U6MA 4K3NA 1SFOI 2O53A 4E30A 2J8RA 2QA41 1L1OC 3V38A 3FIXA 2Z10A 1N8R2 3CCJ1 2POKA 4PQAA 2QEX1 1S7NA 2VPXA 3N7ZA 2R6MA 3PFOA 4QBJA 2PJ3A 2GTHA 3F3FC 3HLPA 4E2WA 2OZHA 1Z8TA 2W03A 3KASA 4KOSA 3GTLI 2WSAA 3IR7A 2ZELA 5G20A 4UFVA 2GFQA 4JD6A 1VQNZ 1TKJA 3F8KA 5IX3A 1ZO0A 3D8PA 2VPWA 4II9A 4RI1A 4KSFA 1VHSA 4E33A 2ZOFA 1TWAI 3W6SA 1Q811 3LMSA 4A39A 1P0HA 4GS4A 2K5TA 2C6GA 4C7HA 4IHMA 1DTDA 4F9VA 2HF1A 3IFUA 4R7MA 3CC21 2AFUA 3S6HA 4PSWA 1L0CA 1QSTA 4CYOA 3CCE1 2B58A 4KOWA 3P2FA 2ARHA 1I6HI 2VUMI 1R57A 1RO4A 1XE4A 3FQMA 5G22A 4NBEA 2IZ3A 5C88A 3CXCY 2NVXI 4A3MI 4DYOA 3FMCA 2V3VA 1Z2LA 1RNIA 1YX0A 1XOVA 1FY7A 4KUBA 2IZ4A 4UWIA 2RBLA 4P4EA 1XRYA 3R9FA 5KTCA 4X5KA 4CAWA 2FIAA 4C2YA 1YQEA 4MFLA 3FECA 1YI2Z 4B14A 4L89A 4U9YA 5AGEA 3QB8A 5LYIA 1AUGA 5G21A 2O4HA 4OMEA 4JXQA 4KZTA 4MHYA 3CCJZ 1YLOA 3FH4A 4MFQA 4BBSI 2JNYA 2PJ8A 4MY3A 3KZWA 5LYFA 4TNUA 2Z3NA 3WT4A 4R8FA 1PU9A 3FJUA 4B5OA 3BXMA 1VQN1 4KOTA 4R6TA 4R76A 3NA6A 3CC41 3CCSZ 2PMZA 3CPAA 1VQOZ 1YVOA 4FAIA 2E2II 2B4BA 4MY0A 3W6XA 3G4SZ 3W91A 1TWFI 3DNSA 2BUEA 4F6AA 3KHZA 4PK2A 2Z3PA 4BBHA 2ODFA 4E8OA 1NSAA 3GKQA 2EBJA
chains in the Genus database with same CATH topology
3K9TA 3B3VA 1H8LA 1XBUA 3IJ3A 2JA8I 1VQLZ 1Z01A 2GLJA 4FUUA 1TWGI 1LANA 2B63I 3CCQZ 1TF8A 3WABA 4A3CI 2QR1B 1F57A 3V7ZA 4NGRA 1GYTA 2NSMA 2G9DA 2ANPA 1RO0A 2PM9A 4ZY0A 1R43A 5I4MA 3CC2Z 5HVHA 4Y52I 4RVFA 2AFMA 1YIJ1 5LYFA 2V8KA 2IJZA 2QLVB 3HOXI 2QJ8A 1ZG9A 3SI1A 1ML8A 3IF8A 3H8GA 4NBAA 1YJ91 1ZLHA 1VQM1 1VQ7Z 4MMOA 5CBMA 5C4JI 5T64A 4WWVA 3LWUA 3DGVA 2PIZA 3SI0A 2NVTI 1KRLA 4PXCA 3Q87A 1QVFY 2PJ6A 4X8IA 2OR4A 4NGQA 2PJ1A 2WYRA 1WIIA 1ZB8A 1K9M1 1ARMA 5FLXf 1X3WA 4NGMA 1K731 1VQP1 2ZENA 4OC5A 2XEIA 4G1PA 3JRUA 4MHNA 2ZEHA 1S72Z 3OW2Z 4BBRI 4A3FI 3IIBA 2BJOA 3WC6A 2CF4A 3CCL1 3B35A 3CMEZ 4NBGA 2RFHA 3WC7A 2R7ZI 3QWUA 1KWMA 3RBUA 2QYVA 4A3KI 4W9YA 3D6WA 3CC71 4DK1A 2RIQA 3S9LA 3FKII 1VQMZ 3U50C 2K5RA 2ZEMA 4IAVA 1TXRA 2OOTA 3CT9A 1HDUA 3EEDA 4A3GI 1LQLA 2VF1A 2BCOA 2VL1A 4AXVA 4MCPA 1Y1WI 1VQO1 1ZB9A 1CP7A 2V77A 4OC2A 2AFZA 1JQGA 1VIXA 1QQ9A 3FQQA 3ESWA 1BPMA 2JR6A 2ZAEB 3TC8A 4NH1C 3J80f 2P28A 2C1CA 1R3NA 2XEGA 2F4OA 3GTOI 3KR5A 2ZEPA 3GB0A 1XJOA 4ZY1A 3CDXA 2JBJA 1CPSA 2ZEGA 2FVGA 1KQSY 2ZEDA 4RUHA 1YUAA 4ONWA 3CPWZ 4NBHA 3GTPI 4Y7NI 3KIFA 1RLYA 2PJ9A 1EE3P 3CPXA 3SJXA 3FEEA 3PO3S 5HVFA 2M48A 3LUSA 3BI1A 1F2OA 4OKOA 1YUKA 1QVGZ 1VQL1 1Y0RA 2LIYA 2V8DA 3PBEA 3HOWI 2F8HA 4NBFA 3PRTA 3F3PC 1QMUA 1ZLIA 4ZY2A 1VQKZ 2JUBA 3HOYI 2E9HA 2H85A 1M902 3MONA 4NB8A 3T8WA 3VH9A 3VARA 1N8R1 3KHXA 2QREB 4A3LI 4BY7I 1YIJZ 1Y1VS 3MZKB 1XFOA 3S1RI 3J81f 3CCM1 1IGBA 2PJ0A 2ZOGA 3VTNA 3PO3I 3EERA 1VQ9Z 1CBXA 1Z5RA 2YADA 3S9NA 4AYBA 1JJ2Z 4X2TA 4A3EI 5D1OB 1P9NA 4CL1A 4YWYA 3CCU1 2RPRA 2NVQI 3FEDA 4NJRA 6CPAA 2E2JI 1QVFZ 2P3YA 2YU9I 2GLFA 4NFRA 2M6NA 8CPAA 1VQ8Z 4PXBA 5LRGA 2JMOA 1BPNA 4GM5A 3HKZA 4P6YA 1VQPZ 4E2XA 4MH4A 3J81b 4QTTA 1S721 2DE6A 1ELMP 4A37A 1TKHA 3NH4A 2QEXZ 4NGNA 4B6ZA 3CME1 3D67A 2PE3A 4TWEA 1LOKA 3TDHB 2QRCB 3OW2Y 3CCMZ 5DS0A 1USPA 4E32A 5IP9I 1Q7Y2 3GUXA 3TX8A 1JJ2Y 5LL6f 2J6AA 4X3RA 1Q812 3IWWA 3G71Z 1IY7A 5JH9A 1YW4A 2VUGA 4RVDA 2BO9A 2PVWA 2JA5I 1Y7EA 4JYWA 2HB6A 1KC82 1Y0YA 4HH4A 3CXCZ 1TF9A 1VQ81 3KR4A 4A38A 3D4UA 3I55Z 3B3SA 1VQ71 2PJ2A 3IC1A 2Q51A 3VB9A 3SI2A 4UIAA 1PCAA 2PK7A 4MCSA 1BLLE 4OC4A 5LYDA 1QVGY 1NJI1 4BY1I 1W2BZ 3CD61 2J9AA 5JM6A 2Q43A 5JGFA 1K8A1 4LQGA 5THWA 4NBCA 2CTBA 4HGZA 1RO2A 4S1TA 1LCPA 2PJAA 3S15I 1K83I 3I4NI 4DJLA 1KQSZ 3CCR1 4RVGA 1Q862 3SJGA 4EWCA 3VMIA 4NB9A 1YJN1 2E2HI 2R92I 1DL6A 1YMEA 3QNVA 4NGSA 3CQZI 4FWUA 4KSIA 2NVYI 5D8NA 2CIJA 4CPAA 3RZDI 2ZEOA 4DUKA 3H3VJ 1Q7LA 3KL9A 1CP6A 3I561 1VQ41 4NGPA 1I50I 5T67A 4ZYQA 3CC4Z 1VQK1 1FT7A 2QA4Z 3CCS1 4A93I 2AFOA 5IT9b 3KGQA 1NUIA 2OTJZ 5IB9A 4UF4A 3S1QI 2DE7A 3CD6Z 4A3JI 3FF3A 3CMA1 4P4FA 4P4BA 3GTJI 2PIYA 2GTIA 3G6E1 3PB8X 3PB4X 3KI9A 3N5FA 3M4OI 3CCQ1 4A3DI 3SJEA 3IO1A 1YW6A 3CCRZ 2QKDA 3M3YI 2PJBA 3GTQI 4NBBA 5T6BA 4OP4A 4YU9A 1N2FA 3D7FA 2EK9A 4OIWA 7CPAA 3CCUZ 1Y1VI 1TKFA 5K8NA 1UWYA 5C3EI 2JA7I 3S1MI 5CPAA 3S1NI 3IX0A 1YJ9Z 1M4LA 4K3NA 1SFOI 4HGYA 2O53A 4E30A 2CTCA 5K8MA 4RVHA 1L1OC 2QA41 3V38A 1AYEA 5D1OA 2AKLA 1N8R2 1YHQZ 2AFWA 4UEFA 3CCJ1 3D7GA 2POKA 4PQAA 2QEX1 2DEAA 3GTMS 3B3TA 2GREA 1CX8A 4EWTA 2V8JA 1FNOA 1RQFA 2R6MA 3PFOA 5A2Qf 2F7VA 1Z02A 1WCMI 3HOZI 2PJ3A 2PJ4A 1F2PA 2GTHA 3F3FC 3BI0A 2PJ7A 3KQXA 1K8A2 5J1QA 3HLPA 2Y0SA 4E2WA 1BAVA 3S2DI 3CCLZ 3J80b 2W03A 3L2NA 3KASA 2G2KA 3GTLI 3WC5A 2ZELA 4A3II 3NDIA 2JS4A 3CC7Z 1XMBA 1PYTB 1TFIA 3FX6A 1VQNZ 4X6AI 1TKJA 1Q821 4EMEA 4MD9A 2GU2A 5IT9f 1KD11 4DGLA 4ZX8A 1ARLA 4A3BI 2IMOA 2V8GA 1KD12 2Q4ZA 3K2KA 3DLJA 3PB9X 2PJ5A 2JA6I 4BD9A 5F09A 4P10A 4QTUA 4E33A 3B3WA 3BHXA 1HEEA 3IEHA 3PB6X 3HOVI 4P4JA 3GTMI 2C6PA 4PXEA 1VLAA 3CCVZ 4MD7A 4NJQA 1K732 2ZOFA 1TWAI 3PBBA 5C44I 1Q811 4BXXI 3S16I 1CPXA 2AFSA 2EGTA 3LMSA 4A39A 2V8IA 2ZEFA 4EFDA 2RB7A 5FLXb 3NDJA 2W04A 4OC0A 3BG0B 2C6GA 3BG1B 4IHMA 1DTDA 1AMPA 5HVGA 3S2HI 5D29A 4F9VA 2HF1A 3IFUA 3JAMf 3I4MI 3CC21 2AFUA 2PJCA 4JZ0A 4R7MA 1YIT1 3CCE1 5IP7I 4XX2A 3D68A 5K8OA 1M1K2 1W2BY 2WAQA 4DQYB 1I6HI 2VUMI 1RO4A 3CPWY 1VHOA 2AFXA 1X0TA 3FQMA 3CCV1 3B3CA 2KPIA 3G4S1 3MRUA 4NBEA 4RS4A 4MCQA 2IZ3A 2JEWA 2OOXB 3S17I 1YJW1 1YI21 2QRDB 3CXCY 1VHEA 4UEZA 2NVXI 4A3MI 3D7DA 2R93I 4DYOA 4MD8A 1R9TI 1YJNZ 3FMCA 4NBDA 3RAMA 1S7MA 1RNIA 1Z2LA 3H8EA 3VMHA 3HUVA 3JAMb 2XEFA 1LAMA 2K3RA 3GTKI 3HOUI 2IZ4A 2HC9A 5AN9F 5C4XI 1M901 1PFTA 1NJI2 2RBLA 3FVLA 3D7HA 4E2ZA 3PO2I 4P4EA 4F9UA 2JBKA 1XRYA 3GCFA 4IK2A 2RHBA 3CCEZ 1VQ5Z 1DE4C 3P5JB 1VQ91 3I1UA 3S14I 3CMAZ 1HDQA 1NP6A 3FECA 3MZLB 2PRQA 4OIDA 1Z03A 1Z8LA 4Q7AA 5LRJA 2KI7B 4OC3A 1YI2Z 1YJWZ 3ISXA 1VGYA 5K8PA 4MXUA 3VATA 2ZEEA 4PXDA 4MONA 2DE5A 3J7A4 5HXDA 2PCUA 5LRKA 2HU9A 4MRIA 1OBRA 1X3ZA 1ZG7A 3D66A 3PEIA 4PPZA 3RZAA 5LYIA 1RTQA 3H8FA 2WB1A 4FBEA 2RT9A 3I551 3PB7X 1VQ61 2O4HA 3B2YA 3H0GI 2I3CA 3K7AI 2NYQA 4OMEA 3KQZA 1VQ51 5A2Qb 1YHQ1 4ZX9A 3KIHA 1ZH1A 2PVVA 3CCJZ 3MN8A 1YLOA 3FH4A 1QYPA 4MHYA 1JWHC 3G711 1CG2A 4P4DA 4P45A 4H2KA 1LAPA 4BBSI 2JNYA 4RV9A 3IFEA 4MHPA 2PJ8A 3VMGA 1I3QI 1TWCI 1Q822 4O23A 2OOYB 1Q861 3GTGI 3KZWA 4UEEA 3I07A 4TNUA 3T4NB 5CM2M 4A94A 2OZKA 4NOZA 3TE5B 3B7IA 2WZNA 4ZI6A 3WT4A 5ELYA 2V8HA 4R8FA 4Z65A 3FJUA 3ISZA 2OTLZ 3D9XA 2IQ6A 5D1PA 2XEJA 3S9MA 3RZOI 4E31A 1VQ6Z 3BXMA 2C6CA 1KC81 1VQN1 4R6TA 3I56Z 1VQ4Z 4R76A 3NFZA 3NH8A 2V8VA 1WW9A 3NA6A 4NGTA 3CC41 4MCRA 3CCSZ 2PMZA 3CPAA 1YITZ 1VQOZ 2OTJ1 5LYLA 1K9M2 4FAIA 4OC1A 2EK8A 3SJFA 2LFUA 2E2II 4UIBA 1M1K1 2EWBA 3G6EZ 2QVPA 1LFWA 1Q7Y1 4MHZA 3G4SZ 1YSJA 4P44A 1TWHI 1TWFI 4E2YA 1ELLP 2BOAA 3GLJA 4P4IA 2F4MA 3KHZA 2ABZA 3PFEA 5FLMI 4F8ZA 3NH5A 1ZG8A 1USPB 4WJBA 1NSAA 3GKQA 1QF8A 2OTL1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9T A;  3B3V A;  1H8L A;  1XBU A;  3IJ3 A;  2GLJ A;  4FUU A;  1LAN A;  3WAB A;  1TF8 A;  1F57 A;  3V7Z A;  4NGR A;  1GYT A;  2NSM A;  2G9D A;  2ANP A;  4ZY0 A;  1R43 A;  5I4M A;  5HVH A;  2AFM A;  2IJZ A;  2QJ8 A;  1ZG9 A;  3SI1 A;  3H8G A;  1ZLH A;  4MMO A;  5CBM A;  4WWV A;  3LWU A;  3DGV A;  2PIZ A;  3SI0 A;  4PXC A;  2PJ6 A;  4X8I A;  2OR4 A;  4NGQ A;  2PJ1 A;  2WYR A;  1ARM A;  4NGM A;  2ZEN A;  4OC5 A;  2XEI A;  4G1P A;  3JRU A;  4MHN A;  2ZEH A;  3WC6 A;  3IIB A;  2CF4 A;  3B35 A;  2RFH A;  3WC7 A;  1KWM A;  3RBU A;  2QYV A;  4W9Y A;  3S9L A;  2ZEM A;  4IAV A;  1TXR A;  2OOT A;  3CT9 A;  1HDU A;  2BCO A;  2VL1 A;  4AXV A;  4MCP A;  1CP7 A;  2V77 A;  4OC2 A;  2AFZ A;  1JQG A;  1VIX A;  1QQ9 A;  1BPM A;  3TC8 A;  2XEG A;  2C1C A;  1R3N A;  3KR5 A;  2ZEP A;  3GB0 A;  1XJO A;  4ZY1 A;  3CDX A;  2JBJ A;  1CPS A;  2ZEG A;  2FVG A;  2ZED A;  4RUH A;  4ONW A;  2PJ9 A;  1EE3 P;  3CPX A;  3SJX A;  3FEE A;  5HVF A;  3BI1 A;  1F2O A;  4OKO A;  1Y0R A;  2V8D A;  3PBE A;  2F8H A;  3PRT A;  1QMU A;  1ZLI A;  4ZY2 A;  3T8W A;  3VH9 A;  3VAR A;  3KHX A;  1XFO A;  2PJ0 A;  1IGB A;  2ZOG A;  1CBX A;  1Z5R A;  3S9N A;  4X2T A;  4YWY A;  3FED A;  4NJR A;  6CPA A;  2GLF A;  4NFR A;  8CPA A;  4PXB A;  5LRG A;  4GM5 A;  1BPN A;  4P6Y A;  4A37 A;  4B6Z A;  1ELM P;  1TKH A;  3NH4 A;  4NGN A;  3D67 A;  2PE3 A;  4TWE A;  1LOK A;  5DS0 A;  3GUX A;  3TX8 A;  4X3R A;  3IWW A;  1IY7 A;  5JH9 A;  1YW4 A;  2BO9 A;  2PVW A;  1Y7E A;  4JYW A;  2HB6 A;  1Y0Y A;  1TF9 A;  3KR4 A;  4A38 A;  3D4U A;  3B3S A;  2PJ2 A;  3IC1 A;  2Q51 A;  3SI2 A;  4UIA A;  1PCA A;  4MCS A;  4OC4 A;  1BLL E;  5LYD A;  2J9A A;  5JM6 A;  2Q43 A;  5JGF A;  5THW A;  4LQG A;  2CTB A;  1LCP A;  2PJA A;  4DJL A;  3SJG A;  1YME A;  4P4J A;  3QNV A;  5D8N A;  4NGS A;  4FWU A;  4KSI A;  2CIJ A;  4CPA A;  2ZEO A;  4DUK A;  1Q7L A;  3KL9 A;  1CP6 A;  4NGP A;  4ZYQ A;  1FT7 A;  2AFO A;  3KGQ A;  5IB9 A;  4UF4 A;  3FF3 A;  4P4F A;  4P4B A;  2PIY A;  3PB8 X;  3PB4 X;  3KI9 A;  3N5F A;  3SJE A;  3IO1 A;  1YW6 A;  2PJB A;  4OP4 A;  4YU9 A;  3D7F A;  2EK9 A;  4OIW A;  7CPA A;  5K8N A;  1TKF A;  1UWY A;  5CPA A;  1M4L A;  4K3N A;  2O53 A;  5K8M A;  2CTC A;  3V38 A;  1AYE A;  2AFW A;  4UEF A;  3D7G A;  2POK A;  4PQA A;  2DEA A;  3B3T A;  2GRE A;  1CX8 A;  4EWT A;  1FNO A;  3PFO A;  2F7V A;  2PJ3 A;  2PJ4 A;  1F2P A;  3BI0 A;  2PJ7 A;  3KQX A;  5J1Q A;  3HLP A;  1BAV A;  3L2N A;  3KAS A;  3WC5 A;  2ZEL A;  1XMB A;  1PYT B;  3FX6 A;  1TKJ A;  4EME A;  2GU2 A;  4ZX8 A;  1ARL A;  2IMO A;  2V8G A;  2Q4Z A;  3K2K A;  3DLJ A;  3PB9 X;  2PJ5 A;  4BD9 A;  5F09 A;  4P10 A;  3BHX A;  3B3W A;  3IEH A;  3PB6 X;  1HEE A;  2C6P A;  4PXE A;  4NJQ A;  2ZOF A;  3PBB A;  1CPX A;  2AFS A;  3LMS A;  4A39 A;  2ZEF A;  4EFD A;  2RB7 A;  4OC0 A;  2C6G A;  4IHM A;  1DTD A;  1AMP A;  5HVG A;  5D29 A;  4F9V A;  4R7M A;  2PJC A;  2AFU A;  4JZ0 A;  3D68 A;  5K8O A;  2AFX A;  1VHO A;  3B3C A;  3MRU A;  4MCQ A;  2JEW A;  1VHE A;  4UEZ A;  3D7D A;  4DYO A;  3FMC A;  3RAM A;  1Z2L A;  3H8E A;  3HUV A;  2XEF A;  1LAM A;  2HC9 A;  3FVL A;  3D7H A;  4P4E A;  4F9U A;  2JBK A;  1XRY A;  4IK2 A;  1DE4 C;  3I1U A;  1HDQ A;  3FEC A;  2PRQ A;  4OID A;  1Z8L A;  4Q7A A;  5LRJ A;  4OC3 A;  3ISX A;  1VGY A;  5K8P A;  4MXU A;  3VAT A;  2ZEE A;  4PXD A;  5HXD A;  2PCU A;  5LRK A;  4MRI A;  1OBR A;  1ZG7 A;  3D66 A;  3PEI A;  4PPZ A;  3RZA A;  5LYI A;  1RTQ A;  3H8F A;  4FBE A;  3PB7 X;  2O4H A;  3B2Y A;  2I3C A;  2NYQ A;  4OME A;  3KQZ A;  4ZX9 A;  2PVV A;  4MHY A;  3MN8 A;  1YLO A;  3FH4 A;  1CG2 A;  4P4D A;  4P45 A;  4H2K A;  1LAP A;  3IFE A;  4MHP A;  2PJ8 A;  4O23 A;  3KZW A;  4UEE A;  4A94 A;  5LYF A;  4TNU A;  4ZI6 A;  3B7I A;  2WZN A;  3WT4 A;  5ELY A;  2V8H A;  4R8F A;  4Z65 A;  3FJU A;  3ISZ A;  2IQ6 A;  2XEJ A;  3S9M A;  3BXM A;  2C6C A;  4R6T A;  4R76 A;  3NFZ A;  3NH8 A;  2V8V A;  3NA6 A;  4NGT A;  4MCR A;  3CPA A;  5LYL A;  4FAI A;  4OC1 A;  2EK8 A;  3SJF A;  4UIB A;  2EWB A;  2QVP A;  1LFW A;  4MHZ A;  1YSJ A;  4P44 A;  1ELL P;  2BOA A;  3GLJ A;  4P4I A;  3KHZ A;  2ABZ A;  3PFE A;  4F8Z A;  3NH5 A;  1ZG8 A;  4WJB A;  1NSA A; 
#chains in the Genus database with same CATH topology
 3K9T A;  4C68 A;  3WAB A;  3V7Z A;  5IB0 A;  2PM9 A;  1R43 A;  5HVH A;  3HOX I;  2QJ8 A;  1ZG9 A;  1M1D A;  3H8G A;  4R3L A;  4NBA A;  4MMO A;  5CBM A;  5T64 A;  4WWV A;  3K9U A;  3SI0 A;  1KRL A;  3JUW A;  3Q87 A;  2PJ6 A;  2OR4 A;  4NGQ A;  2PJ1 A;  2WYR A;  5FLX f;  1K73 1;  4OC5 A;  3JRU A;  4MHN A;  1S72 Z;  3CCL 1;  3S6F A;  3QWU A;  1S7L A;  2Q7S A;  1KUV A;  1KWM A;  2QYV A;  4A3K I;  4DK1 A;  4ZGY B;  3IU1 A;  3S9L A;  4IAV A;  1TXR A;  3CT9 A;  2ZPA A;  1HDU A;  1QSN A;  1Y1W I;  2Q44 A;  1Q2Y A;  2V77 A;  2P6E A;  3ESW A;  1BPM A;  2JR6 A;  2C1C A;  3UY5 A;  1IOI A;  5KTA A;  4CYQ A;  3CPW Z;  4NBH A;  3KIF A;  3SJX A;  1UFH A;  2M48 A;  3LUS A;  3BI1 A;  1F2O A;  4OKO A;  1YUK A;  1SQH A;  5HH1 A;  3HOW I;  2F8H A;  1ZLI A;  2X7B A;  2JUB A;  4M85 A;  3DR6 A;  2H85 A;  3VH9 A;  3KHX A;  1YIJ Z;  1Y1V S;  3MZK B;  3CCM 1;  3PO3 I;  1I21 A;  4AYB A;  4X2T A;  1P9N A;  2F5I A;  6CPA A;  1QVF Z;  2YU9 I;  2GLF A;  3D2M A;  4JJX A;  4PXB A;  5LRG A;  1BPN A;  1M4I A;  3TO9 A;  4AG7 A;  4QTT A;  2DE6 A;  1TKH A;  1JWQ A;  4NGN A;  4TWE A;  1LOK A;  2QRC B;  5DS0 A;  1USP A;  1KUX A;  5IP9 I;  1XIX A;  4A2Z A;  4X3R A;  2J6A A;  4Q36 A;  3G71 Z;  1KUY A;  4RVD A;  3C26 A;  2BO9 A;  1RO5 A;  1KC8 2;  3CXC Z;  3WR7 A;  3I55 Z;  5AG6 A;  5I0C A;  3IC1 A;  2YND A;  2P6F A;  4NCZ A;  4UIA A;  3TTH A;  4OC4 A;  3CD6 1;  4KOY A;  2J9A A;  4RN7 A;  5JM6 A;  4KS9 A;  3SXN A;  4S1T A;  1M4D A;  1Q86 2;  4EWC A;  4NB9 A;  2E2H I;  3CQZ I;  4FWU A;  2NVY I;  4CGP A;  3GY9 A;  4CPA A;  4UA3 A;  4DUK A;  2EUI A;  3KL9 A;  1CP6 A;  1VQ4 1;  5T67 A;  3BLN A;  1VQK 1;  1I12 A;  4UF4 A;  3S1Q I;  3CD6 Z;  4P4B A;  2V45 A;  4L8A A;  3SJE A;  1YW6 A;  2WUU A;  2QKD A;  3M3Y I;  3D7F A;  1MJA A;  5FVJ A;  4UFW A;  5C3E I;  2JA7 I;  3S1M I;  3S1N I;  3IX0 A;  2WPX A;  4UCN A;  2NMT A;  5K8M A;  2CTC A;  2QEC A;  2OZG A;  5D1O A;  2AKL A;  2AFW A;  1V0C A;  4J3G A;  3GTM S;  1FNO A;  5A2Q f;  2F7V A;  5AG4 A;  2PJ4 A;  3ZZI A;  1K8A 2;  2Y0S A;  1BAV A;  2Z3K A;  3CCL Z;  3L2N A;  5KTD A;  5JQ4 A;  2Z3M A;  5DWM A;  4ZBG A;  1XMB A;  3CZX A;  5HMN A;  3EC4 A;  2P0W A;  3B8G A;  4EME A;  2GU2 A;  4ZX8 A;  2JEV A;  4MFJ A;  4A3B I;  2IMO A;  2I00 A;  3PB9 X;  2JA6 I;  4U5Y A;  3IEH A;  2DXQ A;  4CGM A;  4PXE A;  2IL4 A;  2J8M A;  2REF A;  1Z8W A;  5C44 I;  2ZW4 A;  4BXX I;  3S16 I;  2AFS A;  2EGT A;  2V8I A;  5FLX b;  1GHE A;  2W04 A;  5IV0 A;  2G3A A;  3BG0 B;  3BG1 B;  1AMP A;  4FD6 A;  5HVG A;  3I4M I;  4JZ0 A;  1IYK A;  1S5K A;  2OU2 A;  3D68 A;  1M1K 2;  2VQY A;  4C7I A;  2AFX A;  1X0T A;  5F49 A;  1YJW 1;  4UBR A;  4AVB A;  3RAM A;  1SIW A;  3JAM b;  2XEF A;  2K3R A;  3GTK I;  2PR1 A;  3HOU I;  2D4O A;  2HC9 A;  4R57 A;  1M90 1;  3FVL A;  3GCF A;  3CCE Z;  3P5J B;  3S14 I;  4I49 A;  2FIW A;  2PRQ A;  1Z03 A;  4Q7A A;  2ZXV A;  4MFP A;  1VGY A;  5K8P A;  3VAT A;  2ZEE A;  3R96 A;  4MON A;  3J7A 4;  3PEI A;  4PPZ A;  3RZA A;  1RTQ A;  3H8F A;  4FBE A;  3PB7 X;  3I55 1;  1VQ6 1;  3T9Y A;  3B2Y A;  2Q4Y A;  3K7A I;  5A2Q b;  4ZX9 A;  1YK3 A;  3KIH A;  2PVV A;  2A4N A;  4P4D A;  2YNC A;  4RV9 A;  3IWG A;  3IFE A;  4LQ6 A;  2OOY B;  3NE7 A;  4UEE A;  3T4N B;  2OZK A;  3TE5 B;  4Z65 A;  3D9X A;  3OWC A;  2IQ6 A;  4E31 A;  1VQ6 Z;  4XPK A;  3I56 Z;  5F47 A;  3NFZ A;  2V8V A;  1WW9 A;  4MCR A;  4HKF A;  1YIT Z;  1K9M 2;  4OC1 A;  2OH1 A;  4MJ8 A;  3G6E Z;  2QVP A;  1LFW A;  4NSQ A;  1Q7Y 1;  1XEB A;  4XNH B;  3GLJ A;  4KOU A;  4P4I A;  2ABZ A;  5DWN A;  1QF8 A;  1I1D A;  1B87 A;  3RNZ A;  3B3V A;  4KLV A;  1VQL Z;  4NEX A;  1Z01 A;  2GLJ A;  3CCQ Z;  1TF8 A;  1F57 A;  4OLL A;  2NSM A;  4HNW B;  2G9D A;  2JDD A;  2P6G A;  4Y52 I;  2V8K A;  4B12 A;  1YJ9 1;  3LWU A;  4M6G A;  4AB7 A;  4FD4 A;  4X8I A;  2B3U A;  1WII A;  1ZB8 A;  1ARM A;  4CGL A;  5EC4 A;  1IYL A;  1VQP 1;  2XEI A;  1MJB A;  4KSA A;  3OW2 Z;  2O28 A;  4A3F I;  3CC7 1;  5AG7 A;  2HV2 A;  4C2X A;  3U50 C;  4Y49 B;  2EVN A;  4CGO A;  4AXV A;  1YVK A;  3TE4 A;  1YGH A;  4A32 A;  1Y9W A;  2YNC C;  1VQO 1;  2PSW A;  3FYN A;  2E7Z A;  2ZAE B;  2B4D B;  4NH1 C;  3J80 f;  2P28 A;  2J8N A;  2ZEP A;  3GB0 A;  4ZY1 A;  3CDX A;  2JBJ A;  4QB9 A;  1YUA A;  4ONW A;  4Y7N I;  1EE3 P;  3VWE A;  3LOD A;  4NBF A;  3F3P C;  2B4D A;  3HOY I;  2Q4V A;  2R8V A;  4R9M A;  2E9H A;  1BO4 A;  3T8W A;  3J81 f;  2PJ0 A;  2ZOG A;  3EER A;  1CBX A;  1Z5R A;  2YAD A;  3S9N A;  1JJ2 Z;  3EXN A;  5D1O B;  4QVT A;  1P4N A;  1FDI A;  2RPR A;  4EVY A;  4NJR A;  2E2J I;  1VQ8 Z;  2H5M A;  4RS2 A;  2DPS A;  4E2X A;  2B3V A;  3I3G A;  4H89 A;  4A37 A;  1X10 A;  3CME 1;  5GCN A;  3CCM Z;  2DPT A;  1Q7Y 2;  3GUX A;  5H84 A;  4B11 A;  3A9L A;  1JJ2 Y;  5LL6 f;  4UCP A;  1YW4 A;  2JA5 I;  4PSX A;  3KR4 A;  4HH4 A;  1VQ8 1;  3B3S A;  3CXS A;  1PCA A;  2PK7 A;  1S7F A;  1K4J A;  1K8A 1;  5THW A;  3TO7 A;  4B13 A;  3KKW A;  5F48 A;  2JIP A;  3TO6 A;  2R92 I;  1YME A;  2B5G A;  3QNV A;  4KLW A;  4NGS A;  2CIJ A;  3JVN A;  3SHP A;  3V8I A;  4NGP A;  4IUS A;  4JWP A;  4ZYQ A;  3DR8 A;  4A93 I;  4F0Y A;  2OTJ Z;  2PIY A;  1Y8C A;  3PB8 X;  3PB4 X;  4M6H A;  3KI9 A;  3N5F A;  2BEI A;  5T6B A;  3PP9 A;  2WPW A;  3CCU Z;  2VXK A;  5AG5 A;  1TKF A;  2REE A;  2YNE A;  1YJ9 Z;  4YFJ A;  4RVH A;  1AYE A;  4LUA A;  2HQY A;  1RXT A;  3H4Q A;  2DEA A;  3B3T A;  3G3S A;  2GRE A;  4EWT A;  1RQF A;  2R98 A;  1WCM I;  3HOZ I;  1F2P A;  3BI0 A;  5J1Q A;  3KQX A;  2G2K A;  3NDI A;  2CY2 A;  2PRB A;  1N71 A;  2ZW7 A;  4BMH A;  1M4G A;  3FX6 A;  3FB3 A;  2V8G A;  3SXO A;  3EO4 A;  1KD1 2;  1M44 A;  3DLJ A;  4CS0 B;  4U9Z A;  4BD9 A;  4P10 A;  4QTU A;  3BHX A;  4CYP A;  3CCV Z;  4NJQ A;  1K73 2;  2FXF A;  1J4J A;  3PBB A;  2Z3O A;  3PGP A;  4MFK A;  2ZEF A;  2RB7 A;  3D2L A;  3RO0 A;  3NDJ A;  3VWD A;  2RC4 A;  1Q16 A;  3JAM f;  5IP7 I;  4XX2 A;  1W2B Y;  4UWJ A;  4QUS A;  3CPW Y;  4XNH C;  3CCV 1;  1Z4E A;  4RS4 A;  4B10 A;  2JEW A;  4IF5 A;  3S17 I;  2QRD B;  4UEZ A;  4YGO A;  1YJN Z;  3H8E A;  3HUV A;  3TT2 A;  5AN9 F;  5C4X I;  1QXF A;  3QAH A;  1PFT A;  2G0B A;  4E2Z A;  3PO2 I;  2JBK A;  4IK2 A;  3I1U A;  1VQ9 1;  1HDQ A;  1NP6 A;  2OZU A;  4AG9 A;  3CXP A;  1CJW A;  4OID A;  2Z0Z A;  4KVM E;  1Z8L A;  4FD5 A;  1YJW Z;  3ISX A;  4UCM A;  4MXU A;  1X12 A;  4PXD A;  2AJ6 A;  4M6I A;  2PCU A;  2HU9 A;  3FNC A;  4MRI A;  2JIR A;  1ZG7 A;  5EBV A;  3GKR A;  4FD7 A;  3H0G I;  2NYQ A;  4NF1 A;  4XPL A;  3D2P A;  1ZH1 A;  3EY5 A;  1QYP A;  4P45 A;  2VBQ A;  3VMG A;  4XPD C;  1TWC I;  1Q82 2;  1Q86 1;  4A94 A;  3I07 A;  5CM2 M;  3B7I A;  2WZN A;  4C2Z A;  2ATR A;  5ELY A;  4CGN A;  3ISZ A;  5D1P A;  1VQ4 Z;  3S6G A;  4NGT A;  2OTJ 1;  3SJF A;  2LFU A;  1S7K A;  2I79 A;  4UIB A;  1YSJ A;  4P44 A;  1QSO A;  1ELL P;  2F4M A;  2JIO A;  3RYO A;  3PFE A;  3NH5 A;  4MI4 A;  1XBU A;  3IJ3 A;  2FCK A;  3IU2 A;  4FUU A;  2B63 I;  1GYT A;  4ZY0 A;  2GAN A;  2QLV B;  3F0A A;  3TCV A;  3SI1 A;  3EFA A;  5C82 A;  3IF8 A;  1ZLH A;  1VQM 1;  3DGV A;  1FDO A;  4PV6 A;  1K9M 1;  1X3W A;  4NGM A;  2JIQ A;  2ZEN A;  2VI7 A;  4G1P A;  4A33 A;  2ZEH A;  4BBR I;  3IIB A;  2BJO A;  2CF4 A;  3B35 A;  2RFH A;  1Z9U A;  3IGR A;  1IOF A;  3D6W A;  1VQM Z;  4KOX A;  3EED A;  2BCO A;  4MCP A;  1MK4 A;  2VEZ A;  1ZB9 A;  4OC2 A;  2AFZ A;  1JQG A;  2BSW A;  2PC1 A;  3FQQ A;  2B5G B;  3TC8 A;  1R3N A;  2F4O A;  3KR5 A;  5ISV A;  1ON0 A;  1CPS A;  2ZEG A;  2FVG A;  4AVA A;  1RLY A;  2PJ9 A;  3CPX A;  4A95 A;  3PO3 S;  5HVF A;  1WJ2 A;  1QVG Z;  1VQL 1;  3PBE A;  2LIY A;  4H6U A;  1VQK Z;  1M90 2;  3VAR A;  1N8R 1;  4A3L I;  4OAD A;  1XFO A;  1TIQ A;  1IGB A;  3VTN A;  1VQ9 Z;  1Q2C A;  5J8F A;  4A3E I;  4YWY A;  3FED A;  2P3Y A;  4DNC A;  4NFR A;  2M6N A;  8CPA A;  4GM5 A;  3HKZ A;  1VQP Z;  3J81 b;  4B6Z A;  1S72 1;  2QEX Z;  2Q7B A;  3D67 A;  4UFX A;  3TDH B;  3OW2 Y;  2VZZ A;  2FT0 A;  1MJ9 A;  1WK4 A;  1Q81 2;  4JXR A;  1IY7 A;  1QSM A;  5JH9 A;  2PVW A;  1Y7E A;  1Z4R A;  4JYW A;  1Y0Y A;  4A38 A;  2PJ2 A;  2PDO A;  3JTK A;  3SI2 A;  4KVO E;  2JDC A;  4MCS A;  4R87 A;  1BLL E;  5LYD A;  1NJI 1;  3R9E A;  4BY1 I;  2FE7 A;  2Q43 A;  5JGF A;  4LQG A;  4NBC A;  2CTB A;  4HGZ A;  4HNX B;  1LCP A;  1K83 I;  3I4N I;  4MFZ A;  5G1Z A;  1KQS Z;  3CCR 1;  4RVG A;  1YJN 1;  4P4J A;  1DL6 A;  1IID A;  5D8N A;  3FXT A;  5H86 A;  3RZD I;  4HNY B;  3H3V J;  1I50 I;  2AFO A;  5IT9 b;  1NUI A;  1QSR A;  2AE6 A;  5IB9 A;  3FF3 A;  4P4F A;  3DSB A;  2LEX A;  4M3S A;  3GTJ I;  3CCQ 1;  4A3D I;  4YRH A;  1IU8 A;  3IO1 A;  3CCR Z;  4NBB A;  4OP4 A;  4YU9 A;  4OIW A;  7CPA A;  5K8N A;  1M4L A;  2HUZ A;  4HGY A;  1YHQ Z;  4UEF A;  3D7G A;  5J8C A;  1CX8 A;  2V8J A;  2JIM A;  1Z02 A;  3G8W A;  2PJ7 A;  3R95 A;  3S2D I;  3J80 b;  2Z11 A;  3WC5 A;  4A3I I;  2BL1 A;  4CAX A;  2JS4 A;  3R1K A;  2FSR A;  3CC7 Z;  1PYT B;  1TFI A;  4X6A I;  1Q82 1;  4Q38 A;  4MD9 A;  5IT9 f;  1KD1 1;  4MBU A;  4DGL A;  5BWA B;  1ARL A;  1XMT A;  2Q4Z A;  3K2K A;  2PJ5 A;  2VPY A;  5F09 A;  3B3W A;  3PB6 X;  1HEE A;  1Y9K A;  3HOV I;  3GTM I;  2C6P A;  4JLY A;  5F46 A;  3DDD A;  1VLA A;  4MD7 A;  1Z8X A;  3D3S A;  4KOV A;  2PQ8 A;  3MGD A;  1CPX A;  4EFD A;  1YRE A;  4R3K A;  4OC0 A;  1WZN A;  1S60 A;  5JPH A;  3CXQ A;  3S2H I;  5D29 A;  4CAV A;  2PJC A;  2YGW A;  3IWE A;  1YIT 1;  5EMI A;  5K8O A;  1YR0 A;  3BJ8 A;  2WAQ A;  4DQY B;  1XF8 A;  2Q0Y A;  1VHO A;  3B3C A;  2KPI A;  3G4S 1;  3ZJ0 A;  3MRU A;  4MCQ A;  2OOX B;  1YI2 1;  1VHE A;  4B5P B;  3D7D A;  2R93 I;  4MD8 A;  1R9T I;  4NBD A;  1S7M A;  2EO8 A;  3VMH A;  4E2A A;  1LAM A;  2QIR A;  1NJI 2;  3D7H A;  4F9U A;  2RHB A;  1VQ5 Z;  1DE4 C;  3CMA Z;  4ONU A;  1NMT A;  2R7H A;  4H6Z A;  3MZL B;  5LRJ A;  2KI7 B;  3H5Z A;  4OC3 A;  2D4P A;  2ZW6 A;  3P2H A;  2DE5 A;  5HXD A;  5LRK A;  1OBR A;  1X3Z A;  3D66 A;  2WB1 A;  4A31 A;  2RT9 A;  4KOR A;  2I3C A;  3KQZ A;  4KVX A;  1VQ5 1;  1YHQ 1;  3MN8 A;  1JWH C;  3G71 1;  1CG2 A;  4H2K A;  1LAP A;  4MHP A;  1I3Q I;  1B6B A;  4NXY A;  4O23 A;  3GTG I;  4Y49 C;  3TOB A;  4NOZ A;  4ZI6 A;  5A28 A;  2FL4 A;  2V8H A;  1A2Z A;  1WWZ A;  2OTL Z;  3S9M A;  2XEJ A;  3RZO I;  2GIV A;  2C6C A;  1KC8 1;  3NH8 A;  2Q04 A;  5LYL A;  2EK8 A;  3TFY A;  1M1K 1;  2EWB A;  2NAP A;  4MHZ A;  1TWH I;  4E2Y A;  2BOA A;  4CAE A;  1NE9 A;  5FLM I;  4F8Z A;  1ZG8 A;  1S3Z A;  1USP B;  4HPS A;  4WJB A;  4OAE A;  2DF5 A;  1KZF A;  2VZY A;  2OTL 1;  3LD2 A;  1H8L A;  2JA8 I;  1TWG I;  1LAN A;  4A3C I;  2QR1 B;  1IIC A;  4QC6 A;  4NGR A;  3LAC A;  2ANP A;  1RO0 A;  5I4M A;  3CC2 Z;  4RVF A;  2AFM A;  1YIJ 1;  2IJZ A;  1ML8 A;  4XPD B;  1VKC A;  2ZW5 A;  1VQ7 Z;  2QML A;  5C4J I;  2PIZ A;  2NVT I;  4PXC A;  1QVF Y;  5E96 A;  2IV2 X;  3GIU A;  4ORF A;  5CNP A;  3WC6 A;  3CME Z;  4NBG A;  2CNT A;  3WC7 A;  2R7Z I;  2PR8 A;  4PK3 A;  3RBU A;  5A27 A;  4F0X A;  4W9Y A;  2RIQ A;  3FKI I;  2K5R A;  2ZEM A;  2OOT A;  2CNS A;  3FBU A;  4A3G I;  1LQL A;  2VF1 A;  2VL1 A;  2CNM A;  2KCW A;  4K30 A;  1Y7R A;  3I9S A;  4CRY B;  4A30 A;  1CP7 A;  3E0K A;  1VIX A;  1QQ9 A;  2FS5 A;  2XEG A;  3GTO I;  1XJO A;  2GE3 A;  3GYA A;  1LRZ A;  2Z3L A;  3FRM A;  1KQS Y;  2ZED A;  4RUH A;  3GTP I;  1PUA A;  3TOA A;  3FEE A;  2C27 A;  1Y0R A;  2V8D A;  1Q2D A;  3PRT A;  1QMU A;  4ZY2 A;  4B5P A;  4KUA A;  3MON A;  4NB8 A;  3T90 A;  2QRE B;  4BY7 I;  3S1R I;  3R9G A;  1AA6 A;  1CM0 A;  2G3T A;  1BOB A;  4CL1 A;  3CCU 1;  4MHD A;  2NVQ I;  2JMO A;  4P6Y A;  4MH4 A;  1OZP A;  1ELM P;  4E0A A;  1NSL A;  3NH4 A;  2PE3 A;  3BJ7 A;  4E32 A;  3TX8 A;  3IWW A;  3F5B A;  2VUG A;  4CYN A;  1YLE A;  2HB6 A;  1TF9 A;  3D4U A;  1VQ7 1;  2Q51 A;  3VB9 A;  1QVG Y;  3QAY A;  1W2B Z;  4BIN A;  4CRZ B;  2CXA A;  1RO2 A;  2OB0 A;  2PJA A;  3S15 I;  4DJL A;  4GXH A;  3SJG A;  3VMI A;  4KSI A;  1IB1 E;  2ZEO A;  4CAF A;  1Q7L A;  2VPZ A;  3I56 1;  4AVC A;  3CC4 Z;  1FT7 A;  2QA4 Z;  3CCS 1;  3NE8 A;  2Y0M A;  3KGQ A;  2JLM A;  3PZJ A;  2DE7 A;  4A3J I;  4LX9 A;  3CMA 1;  2GTI A;  3G6E 1;  3M4O I;  2PJB A;  2AYD A;  3GTQ I;  2R1I A;  1N2F A;  2EK9 A;  1Y1V I;  3S6K A;  1UWY A;  5CPA A;  1U6M A;  4K3N A;  1SFO I;  2O53 A;  4E30 A;  2J8R A;  2QA4 1;  1L1O C;  3V38 A;  3FIX A;  2Z10 A;  1N8R 2;  3CCJ 1;  2POK A;  4PQA A;  2QEX 1;  1S7N A;  2VPX A;  3N7Z A;  2R6M A;  3PFO A;  4QBJ A;  2PJ3 A;  2GTH A;  3F3F C;  3HLP A;  4E2W A;  2OZH A;  1Z8T A;  2W03 A;  3KAS A;  4KOS A;  3GTL I;  2WSA A;  3IR7 A;  2ZEL A;  5G20 A;  4UFV A;  2GFQ A;  4JD6 A;  1VQN Z;  1TKJ A;  3F8K A;  5IX3 A;  1ZO0 A;  3D8P A;  2VPW A;  4II9 A;  4RI1 A;  4KSF A;  1VHS A;  4E33 A;  2ZOF A;  1TWA I;  3W6S A;  1Q81 1;  3LMS A;  4A39 A;  1P0H A;  4GS4 A;  2K5T A;  2C6G A;  4C7H A;  4IHM A;  1DTD A;  4F9V A;  2HF1 A;  3IFU A;  4R7M A;  3CC2 1;  2AFU A;  3S6H A;  4PSW A;  1L0C A;  1QST A;  4CYO A;  3CCE 1;  2B58 A;  4KOW A;  3P2F A;  2ARH A;  1I6H I;  2VUM I;  1R57 A;  1RO4 A;  1XE4 A;  3FQM A;  5G22 A;  4NBE A;  2IZ3 A;  5C88 A;  3CXC Y;  2NVX I;  4A3M I;  4DYO A;  3FMC A;  2V3V A;  1Z2L A;  1RNI A;  1YX0 A;  1XOV A;  1FY7 A;  4KUB A;  2IZ4 A;  4UWI A;  2RBL A;  4P4E A;  1XRY A;  3R9F A;  5KTC A;  4X5K A;  4CAW A;  2FIA A;  4C2Y A;  1YQE A;  4MFL A;  3FEC A;  1YI2 Z;  4B14 A;  4L89 A;  4U9Y A;  5AGE A;  3QB8 A;  5LYI A;  1AUG A;  5G21 A;  2O4H A;  4OME A;  4JXQ A;  4KZT A;  4MHY A;  3CCJ Z;  1YLO A;  3FH4 A;  4MFQ A;  4BBS I;  2JNY A;  2PJ8 A;  4MY3 A;  3KZW A;  5LYF A;  4TNU A;  2Z3N A;  3WT4 A;  4R8F A;  1PU9 A;  3FJU A;  4B5O A;  3BXM A;  1VQN 1;  4KOT A;  4R6T A;  4R76 A;  3NA6 A;  3CC4 1;  3CCS Z;  2PMZ A;  3CPA A;  1VQO Z;  1YVO A;  4FAI A;  2E2I I;  2B4B A;  4MY0 A;  3W6X A;  3G4S Z;  3W91 A;  1TWF I;  3DNS A;  2BUE A;  4F6A A;  3KHZ A;  4PK2 A;  2Z3P A;  4BBH A;  2ODF A;  4E8O A;  1NSA A;  3GKQ A;  2EBJ A; 
#chains in the Genus database with same CATH homology
 3K9T A;  3B3V A;  1H8L A;  1XBU A;  3IJ3 A;  2JA8 I;  1VQL Z;  1Z01 A;  2GLJ A;  4FUU A;  1TWG I;  1LAN A;  2B63 I;  3CCQ Z;  1TF8 A;  3WAB A;  4A3C I;  2QR1 B;  1F57 A;  3V7Z A;  4NGR A;  1GYT A;  2NSM A;  2G9D A;  2ANP A;  1RO0 A;  2PM9 A;  4ZY0 A;  1R43 A;  5I4M A;  3CC2 Z;  5HVH A;  4Y52 I;  4RVF A;  2AFM A;  1YIJ 1;  5LYF A;  2V8K A;  2IJZ A;  2QLV B;  3HOX I;  2QJ8 A;  1ZG9 A;  3SI1 A;  1ML8 A;  3IF8 A;  3H8G A;  4NBA A;  1YJ9 1;  1ZLH A;  1VQM 1;  1VQ7 Z;  4MMO A;  5CBM A;  5C4J I;  5T64 A;  4WWV A;  3LWU A;  3DGV A;  2PIZ A;  3SI0 A;  2NVT I;  1KRL A;  4PXC A;  3Q87 A;  1QVF Y;  2PJ6 A;  4X8I A;  2OR4 A;  4NGQ A;  2PJ1 A;  2WYR A;  1WII A;  1ZB8 A;  1K9M 1;  1ARM A;  5FLX f;  1X3W A;  4NGM A;  1K73 1;  1VQP 1;  2ZEN A;  4OC5 A;  2XEI A;  4G1P A;  3JRU A;  4MHN A;  2ZEH A;  1S72 Z;  3OW2 Z;  4BBR I;  4A3F I;  3IIB A;  2BJO A;  3WC6 A;  2CF4 A;  3CCL 1;  3B35 A;  3CME Z;  4NBG A;  2RFH A;  3WC7 A;  2R7Z I;  3QWU A;  1KWM A;  3RBU A;  2QYV A;  4A3K I;  4W9Y A;  3D6W A;  3CC7 1;  4DK1 A;  2RIQ A;  3S9L A;  3FKI I;  1VQM Z;  3U50 C;  2K5R A;  2ZEM A;  4IAV A;  1TXR A;  2OOT A;  3CT9 A;  1HDU A;  3EED A;  4A3G I;  1LQL A;  2VF1 A;  2BCO A;  2VL1 A;  4AXV A;  4MCP A;  1Y1W I;  1VQO 1;  1ZB9 A;  1CP7 A;  2V77 A;  4OC2 A;  2AFZ A;  1JQG A;  1VIX A;  1QQ9 A;  3FQQ A;  3ESW A;  1BPM A;  2JR6 A;  2ZAE B;  3TC8 A;  4NH1 C;  3J80 f;  2P28 A;  2C1C A;  1R3N A;  2XEG A;  2F4O A;  3GTO I;  3KR5 A;  2ZEP A;  3GB0 A;  1XJO A;  4ZY1 A;  3CDX A;  2JBJ A;  1CPS A;  2ZEG A;  2FVG A;  1KQS Y;  2ZED A;  4RUH A;  1YUA A;  4ONW A;  3CPW Z;  4NBH A;  3GTP I;  4Y7N I;  3KIF A;  1RLY A;  2PJ9 A;  1EE3 P;  3CPX A;  3SJX A;  3FEE A;  3PO3 S;  5HVF A;  2M48 A;  3LUS A;  3BI1 A;  1F2O A;  4OKO A;  1YUK A;  1QVG Z;  1VQL 1;  1Y0R A;  2LIY A;  2V8D A;  3PBE A;  3HOW I;  2F8H A;  4NBF A;  3PRT A;  3F3P C;  1QMU A;  1ZLI A;  4ZY2 A;  1VQK Z;  2JUB A;  3HOY I;  2E9H A;  2H85 A;  1M90 2;  3MON A;  4NB8 A;  3T8W A;  3VH9 A;  3VAR A;  1N8R 1;  3KHX A;  2QRE B;  4A3L I;  4BY7 I;  1YIJ Z;  1Y1V S;  3MZK B;  1XFO A;  3S1R I;  3J81 f;  3CCM 1;  1IGB A;  2PJ0 A;  2ZOG A;  3VTN A;  3PO3 I;  3EER A;  1VQ9 Z;  1CBX A;  1Z5R A;  2YAD A;  3S9N A;  4AYB A;  1JJ2 Z;  4X2T A;  4A3E I;  5D1O B;  1P9N A;  4CL1 A;  4YWY A;  3CCU 1;  2RPR A;  2NVQ I;  3FED A;  4NJR A;  6CPA A;  2E2J I;  1QVF Z;  2P3Y A;  2YU9 I;  2GLF A;  4NFR A;  2M6N A;  8CPA A;  1VQ8 Z;  4PXB A;  5LRG A;  2JMO A;  1BPN A;  4GM5 A;  3HKZ A;  4P6Y A;  1VQP Z;  4E2X A;  4MH4 A;  3J81 b;  4QTT A;  1S72 1;  2DE6 A;  1ELM P;  4A37 A;  1TKH A;  3NH4 A;  2QEX Z;  4NGN A;  4B6Z A;  3CME 1;  3D67 A;  2PE3 A;  4TWE A;  1LOK A;  3TDH B;  2QRC B;  3OW2 Y;  3CCM Z;  5DS0 A;  1USP A;  4E32 A;  5IP9 I;  1Q7Y 2;  3GUX A;  3TX8 A;  1JJ2 Y;  5LL6 f;  2J6A A;  4X3R A;  1Q81 2;  3IWW A;  3G71 Z;  1IY7 A;  5JH9 A;  1YW4 A;  2VUG A;  4RVD A;  2BO9 A;  2PVW A;  2JA5 I;  1Y7E A;  4JYW A;  2HB6 A;  1KC8 2;  1Y0Y A;  4HH4 A;  3CXC Z;  1TF9 A;  1VQ8 1;  3KR4 A;  4A38 A;  3D4U A;  3I55 Z;  3B3S A;  1VQ7 1;  2PJ2 A;  3IC1 A;  2Q51 A;  3VB9 A;  3SI2 A;  4UIA A;  1PCA A;  2PK7 A;  4MCS A;  1BLL E;  4OC4 A;  5LYD A;  1QVG Y;  1NJI 1;  4BY1 I;  1W2B Z;  3CD6 1;  2J9A A;  5JM6 A;  2Q43 A;  5JGF A;  1K8A 1;  4LQG A;  5THW A;  4NBC A;  2CTB A;  4HGZ A;  1RO2 A;  4S1T A;  1LCP A;  2PJA A;  3S15 I;  1K83 I;  3I4N I;  4DJL A;  1KQS Z;  3CCR 1;  4RVG A;  1Q86 2;  3SJG A;  4EWC A;  3VMI A;  4NB9 A;  1YJN 1;  2E2H I;  2R92 I;  1DL6 A;  1YME A;  3QNV A;  4NGS A;  3CQZ I;  4FWU A;  4KSI A;  2NVY I;  5D8N A;  2CIJ A;  4CPA A;  3RZD I;  2ZEO A;  4DUK A;  3H3V J;  1Q7L A;  3KL9 A;  1CP6 A;  3I56 1;  1VQ4 1;  4NGP A;  1I50 I;  5T67 A;  4ZYQ A;  3CC4 Z;  1VQK 1;  1FT7 A;  2QA4 Z;  3CCS 1;  4A93 I;  2AFO A;  5IT9 b;  3KGQ A;  1NUI A;  2OTJ Z;  5IB9 A;  4UF4 A;  3S1Q I;  2DE7 A;  3CD6 Z;  4A3J I;  3FF3 A;  3CMA 1;  4P4F A;  4P4B A;  3GTJ I;  2PIY A;  2GTI A;  3G6E 1;  3PB8 X;  3PB4 X;  3KI9 A;  3N5F A;  3M4O I;  3CCQ 1;  4A3D I;  3SJE A;  3IO1 A;  1YW6 A;  3CCR Z;  2QKD A;  3M3Y I;  2PJB A;  3GTQ I;  4NBB A;  5T6B A;  4OP4 A;  4YU9 A;  1N2F A;  3D7F A;  2EK9 A;  4OIW A;  7CPA A;  3CCU Z;  1Y1V I;  1TKF A;  5K8N A;  1UWY A;  5C3E I;  2JA7 I;  3S1M I;  5CPA A;  3S1N I;  3IX0 A;  1YJ9 Z;  1M4L A;  4K3N A;  1SFO I;  4HGY A;  2O53 A;  4E30 A;  2CTC A;  5K8M A;  4RVH A;  1L1O C;  2QA4 1;  3V38 A;  1AYE A;  5D1O A;  2AKL A;  1N8R 2;  1YHQ Z;  2AFW A;  4UEF A;  3CCJ 1;  3D7G A;  2POK A;  4PQA A;  2QEX 1;  2DEA A;  3GTM S;  3B3T A;  2GRE A;  1CX8 A;  4EWT A;  2V8J A;  1FNO A;  1RQF A;  2R6M A;  3PFO A;  5A2Q f;  2F7V A;  1Z02 A;  1WCM I;  3HOZ I;  2PJ3 A;  2PJ4 A;  1F2P A;  2GTH A;  3F3F C;  3BI0 A;  2PJ7 A;  3KQX A;  1K8A 2;  5J1Q A;  3HLP A;  2Y0S A;  4E2W A;  1BAV A;  3S2D I;  3CCL Z;  3J80 b;  2W03 A;  3L2N A;  3KAS A;  2G2K A;  3GTL I;  3WC5 A;  2ZEL A;  4A3I I;  3NDI A;  2JS4 A;  3CC7 Z;  1XMB A;  1PYT B;  1TFI A;  3FX6 A;  1VQN Z;  4X6A I;  1TKJ A;  1Q82 1;  4EME A;  4MD9 A;  2GU2 A;  5IT9 f;  1KD1 1;  4DGL A;  4ZX8 A;  1ARL A;  4A3B I;  2IMO A;  2V8G A;  1KD1 2;  2Q4Z A;  3K2K A;  3DLJ A;  3PB9 X;  2PJ5 A;  2JA6 I;  4BD9 A;  5F09 A;  4P10 A;  4QTU A;  4E33 A;  3B3W A;  3BHX A;  1HEE A;  3IEH A;  3PB6 X;  3HOV I;  4P4J A;  3GTM I;  2C6P A;  4PXE A;  1VLA A;  3CCV Z;  4MD7 A;  4NJQ A;  1K73 2;  2ZOF A;  1TWA I;  3PBB A;  5C44 I;  1Q81 1;  4BXX I;  3S16 I;  1CPX A;  2AFS A;  2EGT A;  3LMS A;  4A39 A;  2V8I A;  2ZEF A;  4EFD A;  2RB7 A;  5FLX b;  3NDJ A;  2W04 A;  4OC0 A;  3BG0 B;  2C6G A;  3BG1 B;  4IHM A;  1DTD A;  1AMP A;  5HVG A;  3S2H I;  5D29 A;  4F9V A;  2HF1 A;  3IFU A;  3JAM f;  3I4M I;  3CC2 1;  2AFU A;  2PJC A;  4JZ0 A;  4R7M A;  1YIT 1;  3CCE 1;  5IP7 I;  4XX2 A;  3D68 A;  5K8O A;  1M1K 2;  1W2B Y;  2WAQ A;  4DQY B;  1I6H I;  2VUM I;  1RO4 A;  3CPW Y;  1VHO A;  2AFX A;  1X0T A;  3FQM A;  3CCV 1;  3B3C A;  2KPI A;  3G4S 1;  3MRU A;  4NBE A;  4RS4 A;  4MCQ A;  2IZ3 A;  2JEW A;  2OOX B;  3S17 I;  1YJW 1;  1YI2 1;  2QRD B;  3CXC Y;  1VHE A;  4UEZ A;  2NVX I;  4A3M I;  3D7D A;  2R93 I;  4DYO A;  4MD8 A;  1R9T I;  1YJN Z;  3FMC A;  4NBD A;  3RAM A;  1S7M A;  1RNI A;  1Z2L A;  3H8E A;  3VMH A;  3HUV A;  3JAM b;  2XEF A;  1LAM A;  2K3R A;  3GTK I;  3HOU I;  2IZ4 A;  2HC9 A;  5AN9 F;  5C4X I;  1M90 1;  1PFT A;  1NJI 2;  2RBL A;  3FVL A;  3D7H A;  4E2Z A;  3PO2 I;  4P4E A;  4F9U A;  2JBK A;  1XRY A;  3GCF A;  4IK2 A;  2RHB A;  3CCE Z;  1VQ5 Z;  1DE4 C;  3P5J B;  1VQ9 1;  3I1U A;  3S14 I;  3CMA Z;  1HDQ A;  1NP6 A;  3FEC A;  3MZL B;  2PRQ A;  4OID A;  1Z03 A;  1Z8L A;  4Q7A A;  5LRJ A;  2KI7 B;  4OC3 A;  1YI2 Z;  1YJW Z;  3ISX A;  1VGY A;  5K8P A;  4MXU A;  3VAT A;  2ZEE A;  4PXD A;  4MON A;  2DE5 A;  3J7A 4;  5HXD A;  2PCU A;  5LRK A;  2HU9 A;  4MRI A;  1OBR A;  1X3Z A;  1ZG7 A;  3D66 A;  3PEI A;  4PPZ A;  3RZA A;  5LYI A;  1RTQ A;  3H8F A;  2WB1 A;  4FBE A;  2RT9 A;  3I55 1;  3PB7 X;  1VQ6 1;  2O4H A;  3B2Y A;  3H0G I;  2I3C A;  3K7A I;  2NYQ A;  4OME A;  3KQZ A;  1VQ5 1;  5A2Q b;  1YHQ 1;  4ZX9 A;  3KIH A;  1ZH1 A;  2PVV A;  3CCJ Z;  3MN8 A;  1YLO A;  3FH4 A;  1QYP A;  4MHY A;  1JWH C;  3G71 1;  1CG2 A;  4P4D A;  4P45 A;  4H2K A;  1LAP A;  4BBS I;  2JNY A;  4RV9 A;  3IFE A;  4MHP A;  2PJ8 A;  3VMG A;  1I3Q I;  1TWC I;  1Q82 2;  4O23 A;  2OOY B;  1Q86 1;  3GTG I;  3KZW A;  4UEE A;  3I07 A;  4TNU A;  3T4N B;  5CM2 M;  4A94 A;  2OZK A;  4NOZ A;  3TE5 B;  3B7I A;  2WZN A;  4ZI6 A;  3WT4 A;  5ELY A;  2V8H A;  4R8F A;  4Z65 A;  3FJU A;  3ISZ A;  2OTL Z;  3D9X A;  2IQ6 A;  5D1P A;  2XEJ A;  3S9M A;  3RZO I;  4E31 A;  1VQ6 Z;  3BXM A;  2C6C A;  1KC8 1;  1VQN 1;  4R6T A;  3I56 Z;  1VQ4 Z;  4R76 A;  3NFZ A;  3NH8 A;  2V8V A;  1WW9 A;  3NA6 A;  4NGT A;  3CC4 1;  4MCR A;  3CCS Z;  2PMZ A;  3CPA A;  1YIT Z;  1VQO Z;  2OTJ 1;  5LYL A;  1K9M 2;  4FAI A;  4OC1 A;  2EK8 A;  3SJF A;  2LFU A;  2E2I I;  4UIB A;  1M1K 1;  2EWB A;  3G6E Z;  2QVP A;  1LFW A;  1Q7Y 1;  4MHZ A;  3G4S Z;  1YSJ A;  4P44 A;  1TWH I;  1TWF I;  4E2Y A;  1ELL P;  2BOA A;  3GLJ A;  4P4I A;  2F4M A;  3KHZ A;  2ABZ A;  3PFE A;  5FLM I;  4F8Z A;  3NH5 A;  1ZG8 A;  1USP B;  4WJB A;  1NSA A;  3GKQ A;  1QF8 A;  2OTL 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...