2O4HA

Human brain aspartoacylase complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspartoacylase
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o4hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o4hA01
2ZELA 4OC0A 3QNVA 3PBBA 3KR5A 1TF8A 3HUVA 4X2TA 3PB7X 3MRUA 4FWUA 4OIDA 2WYRA 4PXCA 1HDQA 1M4LA 4F9UA 2BCOA 2RFHA 2CIJA 4P10A 4NGRA 1XMBA 3WT4A 1NSAA 2AFWA 1KWMA 2Q51A 5K8PA 3BXMA 2C6GA 4OC5A 4A37A 2V8VA 3CT9A 4OP4A 4NGNA 3HLPA 3FVLA 1XBUA 5CPAA 3BHXA 4P6YA 3PEIA 2O53A 1ELMP 4R76A 3SI2A 2XEJA 1ZG7A 1YSJA 4Z65A 4X8IA 3PB4X 1PYTB 2I3CA 1YW6A 4A94A 3IFEA 2ZEFA 2V77A 4ZY0A 1IGBA 1LOKA 4DYOA 2HC9A 2V8HA 1ELLP 4KSIA 1ZG9A 2QYVA 5JGFA 4IHMA 1ARLA 4PQAA 3B3WA 4A39A 5LYFA 5JH9A 4EMEA 1LFWA 3S9NA 4P4IA 2CTCA 4MCRA 3PFOA 2J9AA 1YW4A 3SJGA 1Y7EA 1CP6A 2AFOA 2JBJA 3B3SA 3NFZA 4P4BA 2XEFA 2PCUA 3FJUA 1LANA 2IJZA 1UWYA 3NH8A 2NSMA 3KGQA 1ZLHA 2EK9A 3D7GA 3KR4A 3RAMA 4ZY1A 4X3RA 2PIYA 3S9MA 4GM5A 3PBEA 5LYLA 5D29A 2ZENA 3IIBA 4YWYA 3PRTA 5DS0A 1YMEA 4OC2A 2AFSA 4FUUA 4W9YA 2JBKA 1TKJA 1Z2LA 4MHNA 2ZEOA 5F09A 3DLJA 2BOAA 1YLOA 3WABA 4NFRA 4P4JA 4ZX8A 4UF4A 2QJ8A 3SJFA 3VATA 2C6PA 3SJXA 3L2NA 4OC1A 3FEEA 2ZEGA 2OOTA 3WC7A 4FBEA 5J1QA 3IWWA 4UIAA 1TF9A 1Q7LA 2V8DA 5LRJA 5IB9A 2CF4A 2PJ6A 2AFXA 3VH9A 2Q43A 5JM6A 3H8GA 1OBRA 4NGPA 3ISXA 5D8NA 3KHZA 1DE4C 3PB8X 3IEHA 3PB6X 3FX6A 2V8GA 3SJEA 4F8ZA 2HB6A 5I4MA 1LCPA 2O4HA 1ZG8A 1XRYA 3KZWA 2GLJA 4NGQA 4K3NA 3KASA 4P4DA 3FECA 2RB7A 4JYWA 4MCQA 2JEWA 4B6ZA 5CBMA 4MMOA 2C1CA 1Y0YA 1LAPA 3KL9A 2IMOA 2PJCA 1EE3P 2GLFA 2BO9A 4Q7AA 2GREA 2GU2A 4ZI6A 4AXVA 1CPSA 3D68A 2FVGA 2PJ5A 4G1PA 1HEEA 3B3VA 4WJBA 3NH5A 1ARMA 3FH4A 1H8LA 3PFEA 3NH4A 1LAMA 3KI9A 4P44A 4H2KA 4ZX9A 3IC1A 3B35A 3IO1A 1QMUA 2PJ9A 4P4EA 2ZEPA 4PPZA 3BI0A 5THWA 1IY7A 2XEGA 4MXUA 4TNUA 1HDUA 4MHZA 7CPAA 1R43A 5ELYA 3CDXA 1XFOA 2PJ1A 3I1UA 2PJ2A 3B2YA 3WC5A 5HVGA 2XEIA 2PJBA 4LQGA 3RBUA 3FEDA 4TWEA 2ZOGA 4ZY2A 3MN8A 3GLJA 4R8FA 3D7HA 3JRUA 4OC4A 2PJ4A 2WZNA 2NYQA 3D67A 5LYIA 3BI1A 3B3CA 4MHYA 4IK2A 1PCAA 1VIXA 2PJ8A 2ZEHA 5K8MA 1TXRA 3KHXA 4YU9A 4EFDA 2PIZA 1RTQA 3H8EA 1CG2A 2Q4ZA 2ZOFA 4EWTA 2OR4A 1AYEA 1BLLE 3B7IA 5HXDA 5LRGA 3B3TA 4F9VA 3LWUA 1QQ9A 3D7DA 2AFUA 4P4FA 6CPAA 4MCPA 2VL1A 4P45A 5HVFA 3D7FA 3V38A 1R3NA 2PJ3A 3FMCA 4JZ0A 1CP7A 4NJRA 3K2KA 2CTBA 3VARA 2PRQA 5K8OA 3KQXA 2PE3A 3DGVA 2EWBA 1CPXA 4FAIA 1Y0RA 3GB0A 2F7VA 4DUKA 1VHEA 1DTDA 4O23A 3K9TA 3CPAA 3SI1A 2AFZA 1ZLIA 1Z8LA 2ZEEA 4PXDA 2PJ0A 4RUHA 1CX8A 2AFMA 4CPAA 4NJQA 3TC8A 4DJLA 1BPMA 2PVWA 3IJ3A 4NGSA 5LYDA 3GUXA 4R6TA 4UIBA 3RZAA 1VGYA 5K8NA 1Z5RA 4WWVA 2PJAA 4UEZA 4NGTA 1F2OA 5LRKA 3S9LA 1FT7A 4BD9A 1F2PA 2PJ7A 1JQGA 2PVVA 3N5FA 4OKOA 4ZYQA 4PXBA 3CPXA 1F57A 1TKFA 4R7MA 3NA6A 3SI0A 1FNOA 2G9DA 2EK8A 3TX8A 4PXEA 4UEFA 3WC6A 2QVPA 2F8HA 2ABZA 3H8FA 1CBXA 4UEEA 5HVHA 4MRIA 1TKHA 2POKA 4IAVA 1GYTA 4OIWA 2ZEMA 1AMPA 1VHOA 2IQ6A 2ANPA 4OC3A 3ISZA 1XJOA 2C6CA 4A38A 3PB9X 2ZEDA 4NGMA 3T8WA 4OMEA 3V7ZA 3LMSA 3D4UA 4ONWA 4MCSA 3D66A 1BAVA 3KQZA 8CPAA 2DEAA 1BPNA 3FF3A 4MHPA
chains in the Genus database with same CATH superfamily
1RLYA 4OC0A 3QNVA 1U6MA 2VUGA 3HUVA 2E2HI 4LQ6A 3MRUA 4KVME 1PU9A 4OIDA 1HDQA 1WZNA 1M4LA 2YNEA 5IT9b 4F9UA 3LACA 3CCQZ 4KLWA 4QTTA 3S17I 1QSTA 2Y0SA 5EC4A 3WT4A 2AFWA 1Q821 3S6KA 4OC5A 3CXCY 2V8VA 4PSWA 4JWPA 3ZJ0A 3BHXA 3CQZI 4KSFA 3SI2A 3PZJA 1YUAA 4CAFA 4UFWA 4RVFA 4A94A 3IFEA 3TO7A 2V77A 1IGBA 4DYOA 4MHDA 1Z8WA 2NVQI 4LX9A 1J4JA 3S1NI 3GYAA 5JGFA 2YADA 1Y1WI 1ARLA 3D2MA 4L89A 1Z01A 1LFWA 3S9NA 1YK3A 3PFOA 5C88A 4QTUA 1USPB 2Z3PA 3SHPA 1M1DA 1B6BA 1Y7EA 3EEDA 1CP6A 2AFOA 2JBJA 4KSAA 1Z8XA 4CAWA 3VMIA 4M6HA 2WUUA 2Q04A 4H6ZA 1Z8TA 4UFVA 1M4GA 1UWYA 1I12A 2QR1B 3VTNA 2HV2A 4JJXA 1MJBA 1Y1VS 1I6HI 5D29A 3IIBA 1YLEA 3PP9A 4CRYB 4FUUA 3R9EA 3W91A 2IL4A 3NE8A 2QMLA 1VQ91 1MK4A 5FVJA 2BJOA 4UF4A 3TDHB 2QJ8A 3SJFA 3L2NA 4H89A 2JS4A 1M4IA 1Q822 3WC7A 4AYBA 4FBEA 4UIAA 1S72Z 1TF9A 5LRJA 2QECA 4ORFA 1QYPA 4KVOE 2CF4A 3UY5A 4NGPA 5D8NA 4A3DI 3KHZA 3PB8X 2VUMI 3S2DI 3IEHA 2V8GA 3SJEA 2VZYA 4F8ZA 4ZGYB 1XRYA 3KASA 4NXYA 4Y49B 5A27A 2P3YA 4P4DA 1KUYA 2C1CA 2G3TA 2DPTA 2PJCA 3HOWI 2BO9A 1IU8A 4AVCA 4C68A 4A3BI 2GREA 1NSLA 5AG4A 5KTCA 3CC4Z 4B14A 2JIRA 2ZAEB 2I79A 2B4DA 1KD11 3PFEA 5JQ4A 1YJN1 2YU9I 2WPXA 3CMA1 3B35A 1QMUA 2PJ9A 3G6E1 4P4EA 4AG7A 2XEGA 1OZPA 4RVDA 2Q7BA 3CXCZ 1IOIA 3I1UA 2Z11A 3G3SA 3HOXI 4MH4A 3FEDA 1NP6A 4TWEA 1L1OC 4ZY2A 3GLJA 2G0BA 2W03A 2PJ4A 1VQ7Z 2NYQA 3D67A 2WPWA 4B12A 3LODA 4NEXA 1AA6A 5F48A 1VQNZ 4IK2A 4CRZB 1PCAA 4OADA 2PJ8A 1Q861 3GIUA 5LL6f 1YJ91 5AG7A 4CYQA 2J8RA 2Q4ZA 1S7KA 1PUAA 2Q4YA 1UFHA 3B7IA 4CGNA 1QSMA 3B3TA 4IF5A 2CNTA 3LWUA 4F6AA 1QQ9A 4NH1C 2AFUA 1TWAI 3BG1B 5HVFA 4A3KI 1RO5A 3V38A 4R9MA 2PJ3A 3H5ZA 2PRBA 4A31A 4NBFA 1CP7A 4M85A 3K2KA 1VQ4Z 4F0YA 3CCQ1 4FD4A 3CD6Z 3RZDI 2NVYI 3IU1A 4FD5A 1ZLIA 1IB1E 1AUGA 1YQEA 4RUHA 4RV9A 5IP7I 3PO2I 1CX8A 4A2ZA 3F5BA 4CPAA 3DR6A 1QVGZ 1KD12 1I21A 2RC4A 4DJLA 4CAEA 1B87A 3GUXA 5F47A 1VGYA 2AJ6A 4A33A 3I07A 4AVAA 3S9LA 2OB0A 4B5PB 2IZ3A 4UFXA 4BD9A 2YNCA 4NBAA 4R87A 2PJ7A 3S1MI 1K83I 4ZYQA 4PXBA 2WAQA 1VQPZ 1Z9UA 4R7MA 4CYPA 3D2LA 3FQQA 1FNOA 4UEFA 2QVPA 4CL1A 4QUSA 2R98A 3K7AI 1CBXA 2VPXA 3G71Z 3RYOA 4UEEA 2B3VA 4MRIA 2POKA 1Q862 4BXXI 4XPDB 4B13A 1IYLA 1VQ9Z 3I4NI 2C6CA 2OZHA 2LEXA 2B5GA 1BOBA 4OMEA 8CPAA 3FF3A 2JIOA 3S1QI 3PBBA 4X2TA 1TF8A 3PB7X 5ISVA 1JJ2Z 3IFUA 4C2ZA 1CJWA 4PXCA 4PSXA 4A3CI 1NMTA 2D4PA 1X3ZA 1S721 4NBGA 4NGRA 2R92I 1XMBA 2NVTI 3I9SA 4HPSA 3CXQA 5K8PA 2B58A 3G4SZ 3M3YI 4A37A 4BINA 3FRMA 2NMTA 3FVLA 5CPAA 4R76A 1YSJA 5D1OA 3PB4X 1PYTB 2I3CA 4U5YA 2ZEFA 2R7ZI 2HC9A 5A2Qf 1ON0A 1ELLP 4MJ8A 2K5TA 2JEVA 2JIPA 2V8KA 1RQFA 3FXTA 1I1DA 4PQAA 3PO3S 3B3WA 5JPHA 4MFQA 3CC41 3TFYA 4NBEA 2QEX1 1KQSY 2CTCA 1VLAA 4L8AA 1WW9A 3IWGA 2YGWA 3SJGA 4AB7A 1WJ2A 3B3SA 2XEFA 3M4OI 2PCUA 3FJUA 1S5KA 2IJZA 2Z0ZA 1YHQ1 4R57A 1LRZA 3TO6A 3KGQA 4RI1A 4DGLA 2FS5A 5BWAB 4A3MI 2OZUA 2KCWA 3PRTA 5DS0A 1JWHC 5EMIA 2JIQA 1WCMI 3CCU1 2AFSA 4W9YA 1ZB9A 2JBKA 3W6XA 1VQ71 1K4JA 2P0WA 5GCNA 1TKJA 1Z2LA 1VQN1 1YJWZ 4C7HA 5F09A 4E2WA 1IYKA 2WB1A 2R93I 5CNPA 4ZX8A 1S60A 4KOWA 2JDCA 2RHBA 3T90A 4Q38A 3SJXA 1I3QI 2Z3LA 4OC1A 3FEEA 1QVFZ 5DWMA 1X12A 2ZEGA 2D4OA 1I50I 1K9M1 5A2Qb 3EFAA 5J1QA 5IB9A 3IWEA 3TTHA 1XE4A 4KVXA 4RVGA 3DSBA 4DK1A 1R9TI 1VQ41 3S1RI 2ZW7A 3H4QA 3R95A 2QREB 5T6BA 3EERA 4FD7A 3CD61 2HB6A 1M1K1 4R3LA 3JUWA 2GLJA 1YVOA 2BEIA 4E2ZA 2Z3MA 4JYWA 2JEWA 1JWQA 5CBMA 3EY5A 4MMOA 1Y0YA 5F49A 2V3VA 1EE3P 4RS4A 4Q7AA 2BUEA 3GTLI 3MGDA 3V8IA 2GU2A 4AXVA 2ZW5A 2GFQA 3D68A 2PR8A 1TWFI 4M3SA 2Z10A 4QVTA 4UA3A 2QRCB 3NH5A 1H8LA 5IB0A 4NB8A 1LAMA 3QAYA 1X3WA 4ZX9A 4KORA 2FXFA 5FLXf 3IO1A 2P6FA 3R1KA 2JIMA 4PPZA 3CXPA 1IY7A 1Q2DA 2KPIA 3KIFA 4MXUA 1VQP1 4BBSI 7CPAA 4RS2A 1R43A 5ELYA 2FCKA 5IX3A 1RNIA 1XFOA 3WC5A 3B2YA 3S6FA 2JMOA 2XEIA 1Z03A 4LQGA 2K3RA 3RBUA 3D2PA 3G711 4R8FA 2PM9A 3JRUA 2FSRA 2JNYA 3BI1A 4I49A 2NVXI 4LUAA 4ZBGA 1VIXA 3EC4A 2ZEHA 1FY7A 5K8MA 4B11A 1QXFA 1TXRA 5T67A 1K9M2 3KHXA 5A28A 4KS9A 2PIZA 3H8EA 1CG2A 1AYEA 4UWJA 3IX0A 3CZXA 4F9VA 4HNXB 3D7DA 1BO4A 1VQLZ 2PDOA 1YITZ 2R6MA 2J8NA 4M6IA 1R3NA 1M1K2 1KRLA 2VZZA 4NJRA 3FQMA 3I56Z 3WR7A 2PE3A 2Z3OA 3DGVA 3CC2Z 1Z4RA 1Y0RA 2IV2X 3GB0A 3G4S1 5FLXb 1Y7RA 4MY0A 2FT0A 3SI1A 2AFZA 4PV6A 4PXDA 4AVBA 3R96A 2AFMA 3TC8A 1K8A1 3CCJZ 2Z3KA 3S6HA 4NGSA 2QEXZ 2B63I 1WK4A 3JVNA 4R6TA 1TWGI 1P9NA 4MFZA 4JLYA 4XPLA 1Z5RA 3GY9A 4OLLA 4UEZA 4NGTA 3JAMf 5HMNA 4E2YA 3H3VJ 1WWZA 2YNCC 2PVVA 3U50C 1YHQZ 4UCNA 3IF8A 1F57A 1TKFA 5IV0A 2WSAA 3F3PC 2F8HA 2CY2A 3H8FA 4YRHA 4BY1I 3HOUI 2R7HA 3VWDA 4BMHA 3CCUZ 4C2YA 3VMHA 4OIWA 2ODFA 5IP9I 1VHOA 2IQ6A 3ISZA 2ZW6A 4A38A 3PB9X 1Z02A 1R57A 4NGMA 3T8WA 2PMZA 2F4MA 4ONWA 4Q36A 1BAVA 2F4OA 3KIHA 1YJW1 2DEAA 2OH1A 3D8PA 4P10A 4MHPA 3ESWA 1QSRA 3KR5A 5T64A 1M44A 4KOXA 2Q0YA 1Q2YA 4CGPA 4FWUA 2WYRA 3CCVZ 3CCLZ 2E9HA 4E8OA 1P4NA 4BBHA 4PK3A 2FE7A 1NSAA 3HOYI 1KWMA 3JAMb 1Q811 3BXMA 2C6GA 1K8A2 2B3UA 4HH4A 3CT9A 4NGNA 4OP4A 1XBUA 2REEA 4P6YA 2CNSA 1M4DA 2O53A 2XEJA 1ZG7A 4Z65A 5G21A 4MD9A 4X8IA 4DNCA 2JUBA 1Q7Y1 5G22A 2J6AA 1N2FA 3FBUA 1YW6A 4UWIA 4Y7NI 4X6AI 4ZY0A 3OW2Y 1LOKA 5DWNA 2E2JI 2QRDB 2V8HA 2V8JA 4KSIA 1ZG9A 1YUKA 4A39A 5JH9A 4E30A 3F8KA 3R9GA 3BLNA 4MCRA 2NAPA 1YW4A 4A3FI 2P6GA 3DR8A 2VPWA 3S15I 4NSQA 4HGYA 4UCMA 2NSMA 3NH8A 3J80f 2REFA 2W04A 3NDJA 1ZLHA 2EK9A 4ZY1A 5J8FA 3RNZA 3IU2A 4K30A 3CCRZ 1RO4A 4NCZA 3TE5B 3DDDA 3S6GA 4KOVA 4A3GI 4MHNA 2ZEOA 1VHSA 2BL1A 4NFRA 2V45A 1IOFA 1VQ5Z 4NBDA 1TWCI 3VATA 2H5MA 1KUVA 5C4XI 1KUXA 3CC7Z 1VKCA 3T4NB 1Q812 2OOTA 3IWWA 1P0HA 1FDOA 1Q7LA 2V8DA 1VQL1 3T9YA 2PJ6A 1YIT1 2J8MA 5JM6A 3H8GA 3D6WA 2B4BA 1OBRA 3Q87A 1YREA 3LUSA 1Q7Y2 3ISXA 1DE4C 4U9YA 3I561 4MFLA 3PB6X 3CC21 4DQYB 1LCPA 1ZG8A 4NGQA 4K3NA 4NBHA 4MCQA 2OTJZ 2OOXB 3TO9A 3J80b 3HOVI 1LAPA 2Q4VA 3KL9A 3IR7A 3CCJ1 1VQ61 2ZXVA 3GTMI 2DXQA 1NUIA 3I55Z 1CPSA 4U9ZA 2FVGA 4Y49C 4MBUA 5J8CA 2JA8I 3TOAA 3VB9A 1HEEA 4WJBA 1ARMA 3NH4A 3B8GA 4UCPA 4P44A 4E33A 4H2KA 3IC1A 2G3AA 2EBJA 3FNCA 1NE9A 4F0XA 5THWA 3BI0A 3MZLB 3S16I 4TNUA 1W2BY 1VQK1 3LD2A 2EO8A 4X5KA 1USPA 2QA4Z 5HVGA 4B10A 1Q16A 3CCSZ 3SXNA 4MD7A 3BG0B 2O28A 2ZOGA 2P28A 3MN8A 1RO0A 3D7HA 2I00A 4OC4A 4M6GA 1S7NA 1VQ8Z 5D1PA 1QSNA 3BJ7A 3P5JB 3OW2Z 3SXOA 2ARHA 1XOVA 5F46A 1Q2CA 4HNYB 3QB8A 4YU9A 2A4NA 1RTQA 2DF5A 5I0CA 4EWTA 2OR4A 2V8IA 1BLLE 1S7MA 5LRGA 2VF1A 3ZZIA 2YNDA 4CAXA 4KOSA 4P4FA 4JXRA 1DL6A 4MCPA 3CCMZ 2VXKA 4P45A 4YFJA 3D7FA 1ZB8A 2HQYA 2AE6A 5CM2M 4RN7A 3H0GI 3CCV1 3DNSA 3CCL1 4MFKA 5E96A 5K8OA 4PK2A 4CAVA 5H84A 5D1OB 1KZFA 3I3GA 2EWBA 3KKWA 1CPXA 2VBQA 1VHEA 4O23A 1YGHA 1X10A 3CPAA 1SFOI 1Z8LA 4QB9A 4C7IA 1A2ZA 4IUSA 3GKRA 3MONA 2R8VA 5H86A 4EWCA 3S14I 4MD8A 4RVHA 3RZAA 5K8NA 4WWVA 1XF8A 3RZOI 2ZPAA 5LRKA 3CMEZ 2PC1A 3EXNA 3N5FA 2EVNA 3CPXA 3D3SA 3NA6A 4BY7I 2G9DA 2EK8A 1YX0A 4PXEA 3WC6A 2ABZA 4NOZA 5HVHA 1TKHA 4IAVA 4KOUA 4CYNA 2ZEMA 4JXQA 4OC3A 3QWUA 2ZEDA 2RBLA 4A32A 3CCR1 1QF8A 1Y1VI 4HGZA 5AG6A 3I4MI 3D4UA 4MCSA 1IICA 3D66A 3KQZA 1QVGY 3N7ZA 3GKQA 1BPNA 1KQSZ 4XPDC 2ZELA 4C2XA 2P6EA 2C27A 1VQ51 3TCVA 3BJ8A 1YIJ1 1WIIA 1M901 2QKDA 3CC71 4KLVA 2BCOA 2RFHA 2JLMA 3NDIA 2CIJA 2OOYB 2JDDA 1W2BZ 2Q51A 4B5OA 1MJ9A 3FIXA 4A3JI 3HLPA 1FDIA 4E2XA 3CXSA 3PEIA 1ELMP 1YI2Z 5KTAA 4A3EI 2BSWA 3HOZI 2KI7B 1VQ6Z 3GTJI 1CM0A 3QAHA 2OTJ1 2FIAA 4AG9A 2GTIA 4QBJA 4QC6A 1SQHA 1VQO1 4A95A 2QYVA 2F5IA 4IHMA 1LQLA 5LYFA 4EMEA 4MI4A 1Y9WA 4P4IA 3I551 1Z4EA 2J9AA 3FKII 4XNHC 1VQKZ 1JJ2Y 5C82A 1MJAA 3S2HI 2CXAA 1K731 2OTLZ 2DPSA 4P4BA 3NFZA 3A9LA 4EVYA 1LANA 1TFIA 4B5PA 2GTHA 2Q44A 4GS4A 3IGRA 3D7GA 3KR4A 3RAMA 2GIVA 5EBVA 2QA41 4X3RA 2H85A 2PIYA 3S9MA 3VMGA 1VQMZ 4GM5A 3PBEA 2M6NA 5LYLA 3CCS1 2ZENA 4YWYA 1YMEA 2JA5I 4OC2A 3J81f 2ZW4A 4HKFA 5G1ZA 1VQ81 4XX2A 3DLJA 5HH1A 2BOAA 1M902 3CCE1 4KZTA 1YLOA 3WABA 4P4JA 4CS0B 1ML8A 4CGMA 1QSOA 2E7ZA 2C6PA 3VWEA 1S7FA 1L0CA 2DE7A 3CPWY 4OAEA 3OWCA 3CCM1 1NJI1 4MFJA 2AFXA 3D9XA 3VH9A 2Q43A 4A3LI 1XMTA 4JD6A 2RIQA 1S3ZA 3GCFA 4MY3A 1N8R1 1YR0A 4MFPA 3FX6A 5I4MA 2O4HA 3KZWA 2IZ4A 1TIQA 2E2II 4S1TA 3FECA 3GTOI 2B4DB 2RB7A 3HKZA 2FL4A 4B6ZA 4NF1A 4E2AA 4KOYA 2IMOA 2GLFA 4R3KA 5C44I 1K732 2VI7A 2EUIA 3TOBA 1KC81 3W6SA 4ZI6A 2GANA 4KUAA 3J81b 2PJ5A 2OU2A 2GE3A 4G1PA 3B3VA 2CNMA 1Y9KA 3FH4A 2AYDA 3KI9A 2G2KA 1YVKA 4Y52I 1QVFY 3CME1 3FYNA 3GTKI 2ZEPA 4CYOA 3GTGI 1HDUA 4MHZA 4A30A 4A93I 4KOTA 3P2HA 4J3GA 3J7A4 5AN9F 2VQYA 3CDXA 2PJ1A 2PJ2A 3G8WA 2PJBA 1RXTA 1SIWA 2VPYA 2HU9A 4CGOA 1IIDA 3PGPA 2VEZA 2WZNA 5AGEA 5LYIA 4FD6A 3B3CA 4MHYA 2RPRA 4BBRI 2JA6I 3E0KA 4EFDA 2X7BA 2DE5A 1Y8CA 1XIXA 1RO2A 5KTDA 1YIJZ 2LFUA 1NJI2 2ZOFA 1GHEA 5C4JI 2ATRA 1ZH1A 5HXDA 4E31A 3R9FA 4E32A 2JA7I 4NBCA 2DE6A 3TT2A 6CPAA 2HF1A 1N8R2 2VL1A 3F0AA 3FB3A 2R1IA 2VPZA 3FMCA 4JZ0A 1ZO0A 2CTBA 3VARA 2PRQA 2PSWA 3GTPI 2HUZA 3KQXA 4ONUA 4FAIA 4DUKA 2F7VA 1DTDA 3RO0A 3K9TA 4MONA 2JR6A 2RT9A 2EGTA 2ZEEA 2PJ0A 2K5RA 1KC82 1YI21 1VQOZ 2M48A 1XEBA 2OZKA 4UBRA 2FIWA 4NJQA 2QLVB 5AG5A 4HNWB 3GTMS 1BPMA 3F3FC 4GXHA 3P2FA 2PVWA 3IJ3A 5LYDA 1PFTA 5IT9f 3JTKA 4XNHB 4UIBA 4KUBA 5C3EI 1YJNZ 2PJAA 1F2OA 3CMAZ 3TE4A 2PK7A 1FT7A 3CPWZ 1F2PA 3G6EZ 3PO3I 3MZKB 1JQGA 4OKOA 2PQ8A 3EO4A 4E0AA 1X0TA 3SI0A 4YGOA 4A3II 2OTL1 3TX8A 2B5GB 4NBBA 1S7LA 4NB9A 4H6UA 1V0CA 2Z3NA 1N71A 2LIYA 1GYTA 3GTQI 1AMPA 2ANPA 2AKLA 2Y0MA 1TWHI 3NE7A 1XJOA 3CCEZ 1VQM1 2OZGA 5FLMI 5G20A 1YJ9Z 2Q7SA 2PR1A 3V7ZA 3LMSA 4CGLA 4XPKA 3K9UA 4II9A 2QIRA 3C26A
chains in the Genus database with same CATH topology
1KQSZ 1RLYA 2ZELA 3ESWA 4OC0A 3QNVA 3S1QI 2VUGA 3PBBA 1VQ51 3KR5A 1TF8A 3HUVA 4X2TA 5T64A 3PB7X 1JJ2Z 2E2HI 3IFUA 1YIJ1 3MRUA 4FWUA 4OIDA 1WIIA 2WYRA 4PXCA 1HDQA 1M901 3CCVZ 2QKDA 1M4LA 3CC71 4A3CI 3CCLZ 2E9HA 5IT9b 4F9UA 2BCOA 3CCQZ 2RFHA 1X3ZA 4QTTA 3NDIA 1S721 4NBGA 2OOYB 3S17I 2CIJA 4NGRA 4P10A 2Y0SA 2R92I 1XMBA 2NVTI 3WT4A 1NSAA 1W2BZ 3HOYI 2AFWA 1KWMA 2Q51A 5K8PA 3JAMb 1Q811 3G4SZ 3BXMA 1Q821 4A3JI 2C6GA 1K8A2 3M3YI 3CXCY 2V8VA 4OC5A 4A37A 3CT9A 4HH4A 4OP4A 4NGNA 3HLPA 3FVLA 1XBUA 5CPAA 3BHXA 4P6YA 4E2XA 3CQZI 3PEIA 2O53A 1ELMP 4R76A 1YI2Z 4A3EI 2XEJA 3SI2A 1ZG7A 3HOZI 1YSJA 4Z65A 4MD9A 2KI7B 4X8IA 5D1OA 3PB4X 1VQ6Z 1PYTB 3GTJI 1YUAA 2JUBA 1Q7Y1 2I3CA 2J6AA 1N2FA 4RVFA 1YW6A 4A94A 3IFEA 2ZEFA 4Y7NI 4X6AI 2V77A 4ZY0A 1IGBA 3OW2Y 2R7ZI 1LOKA 4DYOA 2HC9A 2OTJ1 2E2JI 2QRDB 2NVQI 2GTIA 5A2Qf 2V8HA 2V8JA 1VQO1 1ELLP 4KSIA 1ZG9A 3S1NI 2QYVA 5JGFA 2V8KA 2YADA 1Y1WI 1YUKA 4IHMA 1RQFA 1ARLA 4PQAA 1LQLA 3PO3S 3B3WA 4A39A 1Z01A 5LYFA 5JH9A 4E30A 3CC41 4EMEA 1LFWA 3S9NA 4NBEA 2QEX1 1KQSY 2CTCA 3I551 4P4IA 1VLAA 4MCRA 3PFOA 4QTUA 2J9AA 1USPB 1YW4A 3FKII 1WW9A 1VQKZ 1JJ2Y 4A3FI 3S2HI 1K731 2OTLZ 3SJGA 1Y7EA 3EEDA 1CP6A 2AFOA 2JBJA 3B3SA 3NFZA 4P4BA 2XEFA 3VMIA 3S15I 3M4OI 2PCUA 3FJUA 1LANA 2IJZA 1TFIA 4HGYA 2GTHA 1YHQ1 1UWYA 3NH8A 3J80f 2NSMA 2W04A 3NDJA 3KGQA 1ZLHA 2EK9A 3D7GA 3KR4A 2QR1B 3VTNA 3RAMA 4DGLA 4ZY1A 2QA41 4X3RA 2H85A 2PIYA 3S9MA 3VMGA 1VQMZ 4GM5A 1Y1VS 1I6HI 3PBEA 4A3MI 2M6NA 5LYLA 3CCS1 2ZENA 3IIBA 5D29A 4YWYA 3PRTA 3CCRZ 5DS0A 1JWHC 1RO4A 1YMEA 1WCMI 2JA5I 4OC2A 3CCU1 2AFSA 4FUUA 4W9YA 3TE5B 1ZB9A 2JBKA 3J81f 1VQ71 1VQ81 1TKJA 1Z2LA 4XX2A 1VQN1 1VQ91 1YJWZ 4A3GI 4MHNA 2ZEOA 5F09A 3DLJA 4E2WA 1M902 2BOAA 2WB1A 3CCE1 2R93I 1YLOA 3WABA 4NFRA 4P4JA 4ZX8A 2BJOA 1ML8A 1VQ5Z 4NBDA 1TWCI 2RHBA 4UF4A 3TDHB 2QJ8A 3SJFA 3VATA 2C6PA 3SJXA 3L2NA 1I3QI 4OC1A 5C4XI 3FEEA 1QVFZ 3CC7Z 3T4NB 1Q812 2JS4A 2ZEGA 1Q822 2DE7A 2OOTA 1I50I 1K9M1 5A2Qb 3WC7A 4AYBA 3CPWY 4FBEA 5J1QA 3IWWA 4UIAA 1S72Z 1TF9A 1Q7LA 2V8DA 3CCM1 5LRJA 1VQL1 5IB9A 1NJI1 1QYPA 2CF4A 2PJ6A 2AFXA 3D9XA 3VH9A 1YIT1 2Q43A 4A3LI 5JM6A 4RVGA 3H8GA 3D6WA 1OBRA 2RIQA 3Q87A 4NGPA 4DK1A 1R9TI 3LUSA 1Q7Y2 3ISXA 5D8NA 3GCFA 4A3DI 1VQ41 1N8R1 3S1RI 1DE4C 3KHZA 3PB8X 2VUMI 2QREB 3I561 5T6BA 3EERA 3S2DI 3IEHA 3PB6X 3CD61 3FX6A 2V8GA 3SJEA 3CC21 4F8ZA 2HB6A 4DQYB 1M1K1 5I4MA 1LCPA 2O4HA 1ZG8A 1XRYA 3KZWA 2GLJA 4NGQA 4K3NA 2IZ4A 3KASA 2E2II 4S1TA 2P3YA 4E2ZA 3FECA 4P4DA 3GTOI 4NBHA 2RB7A 4JYWA 4MCQA 2OTJZ 2JEWA 3HKZA 2OOXB 4B6ZA 5CBMA 3J80b 3HOVI 2C1CA 1Y0YA 4MMOA 1LAPA 3KL9A 2IMOA 2PJCA 3HOWI 1EE3P 2GLFA 2BO9A 4RS4A 1VQ61 3CCJ1 5C44I 4Q7AA 4A3BI 3GTLI 1K732 2GREA 3CC4Z 3GTMI 1KC81 2GU2A 4ZI6A 1NUIA 3I55Z 4AXVA 1CPSA 3D68A 2FVGA 1TWFI 2ZAEB 3J81b 2JA8I 2PJ5A 4G1PA 3VB9A 1HEEA 3B3VA 2QRCB 4WJBA 3NH5A 1KD11 1ARMA 3FH4A 1H8LA 3PFEA 3NH4A 4NB8A 1YJN1 2YU9I 1LAMA 1X3WA 3KI9A 4P44A 2G2KA 4E33A 4H2KA 4ZX9A 3CMA1 3IC1A 4Y52I 1QVFY 3B35A 5FLXf 3CME1 3IO1A 1QMUA 2PJ9A 3G6E1 3GTKI 4P4EA 2ZEPA 4PPZA 3BI0A 5THWA 1IY7A 3MZLB 2KPIA 3KIFA 3GTGI 3S16I 2XEGA 4MXUA 4TNUA 1VQP1 1W2BY 4BBSI 1HDUA 1VQK1 4MHZA 7CPAA 1R43A 5ELYA 4RVDA 4A93I 1USPA 3CXCZ 2QA4Z 3J7A4 1RNIA 5AN9F 3CDXA 1XFOA 2PJ1A 3I1UA 2PJ2A 3B2YA 3WC5A 5HVGA 2JMOA 2XEIA 3CCSZ 2PJBA 1Z03A 3HOXI 4LQGA 2K3RA 3RBUA 4MH4A 3FEDA 4MD7A 1NP6A 3BG0B 2HU9A 3G711 4TWEA 2ZOGA 2P28A 1L1OC 4ZY2A 3MN8A 1RO0A 3GLJA 3D7HA 4R8FA 2PM9A 2W03A 3JRUA 4OC4A 2PJ4A 1VQ7Z 2WZNA 2JNYA 2NYQA 3D67A 5LYIA 1VQ8Z 3BI1A 3B3CA 4MHYA 2RPRA 1VQNZ 2NVXI 5D1PA 4BBRI 4IK2A 2JA6I 1PCAA 3P5JB 3OW2Z 1VIXA 2PJ8A 2ZEHA 5K8MA 1TXRA 5T67A 1K9M2 3KHXA 4YU9A 1Q861 4EFDA 2PIZA 2DE5A 5LL6f 1YJ91 1RTQA 3H8EA 1RO2A 1YIJZ 2LFUA 1CG2A 1NJI2 2Q4ZA 2ZOFA 4EWTA 2OR4A 1AYEA 2V8IA 5C4JI 1BLLE 3B7IA 1ZH1A 5HXDA 4E31A 1S7MA 5LRGA 2VF1A 3B3TA 3IX0A 4E32A 4F9VA 3LWUA 2JA7I 1QQ9A 4NH1C 3D7DA 2AFUA 4NBCA 2DE6A 4P4FA 6CPAA 2HF1A 1N8R2 1DL6A 4MCPA 3CCMZ 2VL1A 1VQLZ 4P45A 1TWAI 3BG1B 5HVFA 4A3KI 1ZB8A 1YITZ 3D7FA 5CM2M 2R6MA 3V38A 1R3NA 1M1K2 2PJ3A 1KRLA 3H0GI 3FMCA 4JZ0A 3CCV1 4NBFA 1CP7A 4NJRA 3CCL1 3K2KA 2CTBA 3VARA 3FQMA 1VQ4Z 2PRQA 5K8OA 3GTPI 3CCQ1 3KQXA 3I56Z 5D1OB 2PE3A 3CD6Z 3DGVA 3CC2Z 2EWBA 1CPXA 4FAIA 1Y0RA 3RZDI 2F7VA 3GB0A 1VHEA 4DUKA 1DTDA 2NVYI 4O23A 3G4S1 3K9TA 5FLXb 3CPAA 4MONA 2JR6A 1SFOI 3SI1A 2RT9A 2AFZA 1ZLIA 1Z8LA 2EGTA 2ZEEA 4PXDA 2PJ0A 2K5RA 4RUHA 1KC82 4RV9A 5IP7I 3PO2I 1CX8A 1YI21 1VQOZ 2M48A 3MONA 2OZKA 2AFMA 4CPAA 4NJQA 2QLVB 3TC8A 4EWCA 1K8A1 3CCJZ 1QVGZ 1KD12 3GTMS 4DJLA 3S14I 1BPMA 3F3FC 2PVWA 3IJ3A 4NGSA 4MD8A 2QEXZ 3GUXA 2B63I 1PFTA 5LYDA 4RVHA 4R6TA 5IT9f 1TWGI 4UIBA 3RZAA 1P9NA 1VGYA 5K8NA 1Z5RA 4WWVA 3I07A 5C3EI 1YJNZ 2PJAA 3RZOI 4UEZA 4NGTA 1F2OA 3CMAZ 3JAMf 5LRKA 2PK7A 3S9LA 4E2YA 3CMEZ 3H3VJ 1FT7A 2IZ3A 4BD9A 4NBAA 3CPWZ 3G6EZ 3PO3I 1F2PA 3MZKB 2PJ7A 3S1MI 1JQGA 1K83I 2PVVA 3U50C 1YHQZ 3IF8A 3N5FA 4OKOA 4ZYQA 4PXBA 3CPXA 2WAQA 1VQPZ 1F57A 1TKFA 4R7MA 1X0TA 3NA6A 3SI0A 4A3II 4BY7I 3FQQA 2OTL1 1FNOA 2EK8A 2G9DA 3TX8A 4NBBA 3F3PC 4PXEA 4UEFA 4NB9A 2QVPA 4CL1A 3WC6A 2F8HA 2ABZA 3H8FA 3K7AI 1CBXA 4NOZA 4BY1I 3HOUI 3G71Z 4UEEA 5HVHA 4MRIA 3CCUZ 1TKHA 2POKA 4IAVA 2LIYA 1Q862 1GYTA 3VMHA 4OIWA 2ZEMA 3GTQI 4BXXI 1AMPA 5IP9I 1VHOA 2IQ6A 2ANPA 2AKLA 1VQ9Z 4OC3A 1TWHI 3I4NI 3ISZA 3QWUA 1XJOA 3CCEZ 2C6CA 1VQM1 3PB9X 4A38A 2ZEDA 1Z02A 2RBLA 5FLMI 3CCR1 1QF8A 1Y1VI 4HGZA 1YJ9Z 4NGMA 3T8WA 3I4MI 2PMZA 2F4MA 4OMEA 3V7ZA 3LMSA 3D4UA 4ONWA 4MCSA 3D66A 1BAVA 3KQZA 1QVGY 2F4OA 3KIHA 8CPAA 1YJW1 3GKQA 2DEAA 1BPNA 3FF3A 4MHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEL A;  4OC0 A;  3QNV A;  3PBB A;  3KR5 A;  1TF8 A;  3HUV A;  4X2T A;  3PB7 X;  3MRU A;  4FWU A;  4OID A;  2WYR A;  4PXC A;  1HDQ A;  1M4L A;  4F9U A;  2BCO A;  2RFH A;  2CIJ A;  4P10 A;  4NGR A;  1XMB A;  3WT4 A;  1NSA A;  2AFW A;  1KWM A;  2Q51 A;  5K8P A;  3BXM A;  2C6G A;  4OC5 A;  4A37 A;  2V8V A;  3CT9 A;  4OP4 A;  4NGN A;  3HLP A;  3FVL A;  1XBU A;  5CPA A;  3BHX A;  4P6Y A;  3PEI A;  2O53 A;  1ELM P;  4R76 A;  3SI2 A;  2XEJ A;  1ZG7 A;  1YSJ A;  4Z65 A;  4X8I A;  3PB4 X;  1PYT B;  2I3C A;  1YW6 A;  4A94 A;  3IFE A;  2ZEF A;  2V77 A;  4ZY0 A;  1IGB A;  1LOK A;  4DYO A;  2HC9 A;  2V8H A;  1ELL P;  4KSI A;  1ZG9 A;  2QYV A;  5JGF A;  4IHM A;  1ARL A;  4PQA A;  3B3W A;  4A39 A;  5LYF A;  5JH9 A;  4EME A;  1LFW A;  3S9N A;  4P4I A;  2CTC A;  4MCR A;  3PFO A;  2J9A A;  1YW4 A;  3SJG A;  1Y7E A;  1CP6 A;  2AFO A;  2JBJ A;  3B3S A;  3NFZ A;  4P4B A;  2XEF A;  2PCU A;  3FJU A;  1LAN A;  2IJZ A;  1UWY A;  3NH8 A;  2NSM A;  3KGQ A;  1ZLH A;  2EK9 A;  3D7G A;  3KR4 A;  3RAM A;  4ZY1 A;  4X3R A;  2PIY A;  3S9M A;  4GM5 A;  3PBE A;  5LYL A;  5D29 A;  2ZEN A;  3IIB A;  4YWY A;  3PRT A;  5DS0 A;  1YME A;  4OC2 A;  2AFS A;  4FUU A;  4W9Y A;  2JBK A;  1TKJ A;  1Z2L A;  4MHN A;  2ZEO A;  5F09 A;  3DLJ A;  2BOA A;  1YLO A;  3WAB A;  4NFR A;  4P4J A;  4ZX8 A;  4UF4 A;  2QJ8 A;  3SJF A;  3VAT A;  2C6P A;  3SJX A;  3L2N A;  4OC1 A;  3FEE A;  2ZEG A;  2OOT A;  3WC7 A;  4FBE A;  5J1Q A;  3IWW A;  4UIA A;  1TF9 A;  1Q7L A;  2V8D A;  5LRJ A;  5IB9 A;  2CF4 A;  2PJ6 A;  2AFX A;  3VH9 A;  2Q43 A;  5JM6 A;  3H8G A;  1OBR A;  4NGP A;  3ISX A;  5D8N A;  3KHZ A;  1DE4 C;  3PB8 X;  3IEH A;  3PB6 X;  3FX6 A;  2V8G A;  3SJE A;  4F8Z A;  2HB6 A;  5I4M A;  1LCP A;  2O4H A;  1ZG8 A;  1XRY A;  3KZW A;  2GLJ A;  4NGQ A;  4K3N A;  3KAS A;  4P4D A;  3FEC A;  2RB7 A;  4JYW A;  4MCQ A;  2JEW A;  4B6Z A;  5CBM A;  4MMO A;  2C1C A;  1Y0Y A;  1LAP A;  3KL9 A;  2IMO A;  2PJC A;  1EE3 P;  2GLF A;  2BO9 A;  4Q7A A;  2GRE A;  2GU2 A;  4ZI6 A;  4AXV A;  1CPS A;  3D68 A;  2FVG A;  2PJ5 A;  4G1P A;  1HEE A;  3B3V A;  4WJB A;  3NH5 A;  1ARM A;  3FH4 A;  1H8L A;  3PFE A;  3NH4 A;  1LAM A;  3KI9 A;  4P44 A;  4H2K A;  4ZX9 A;  3IC1 A;  3B35 A;  3IO1 A;  1QMU A;  2PJ9 A;  4P4E A;  2ZEP A;  4PPZ A;  3BI0 A;  5THW A;  1IY7 A;  2XEG A;  4MXU A;  4TNU A;  1HDU A;  4MHZ A;  7CPA A;  1R43 A;  5ELY A;  3CDX A;  1XFO A;  2PJ1 A;  3I1U A;  2PJ2 A;  3B2Y A;  3WC5 A;  5HVG A;  2XEI A;  2PJB A;  4LQG A;  3RBU A;  3FED A;  4TWE A;  2ZOG A;  4ZY2 A;  3MN8 A;  3GLJ A;  4R8F A;  3D7H A;  3JRU A;  4OC4 A;  2PJ4 A;  2WZN A;  2NYQ A;  3D67 A;  5LYI A;  3BI1 A;  3B3C A;  4MHY A;  4IK2 A;  1PCA A;  1VIX A;  2PJ8 A;  2ZEH A;  5K8M A;  1TXR A;  3KHX A;  4YU9 A;  4EFD A;  2PIZ A;  1RTQ A;  3H8E A;  1CG2 A;  2Q4Z A;  2ZOF A;  4EWT A;  2OR4 A;  1AYE A;  1BLL E;  3B7I A;  5HXD A;  5LRG A;  3B3T A;  4F9V A;  3LWU A;  1QQ9 A;  3D7D A;  2AFU A;  4P4F A;  6CPA A;  4MCP A;  2VL1 A;  4P45 A;  5HVF A;  3D7F A;  3V38 A;  1R3N A;  2PJ3 A;  3FMC A;  4JZ0 A;  1CP7 A;  4NJR A;  3K2K A;  2CTB A;  3VAR A;  2PRQ A;  5K8O A;  3KQX A;  2PE3 A;  3DGV A;  2EWB A;  1CPX A;  4FAI A;  1Y0R A;  3GB0 A;  2F7V A;  4DUK A;  1VHE A;  1DTD A;  4O23 A;  3K9T A;  3CPA A;  3SI1 A;  2AFZ A;  1ZLI A;  1Z8L A;  2ZEE A;  4PXD A;  2PJ0 A;  4RUH A;  1CX8 A;  2AFM A;  4CPA A;  4NJQ A;  3TC8 A;  4DJL A;  1BPM A;  2PVW A;  3IJ3 A;  4NGS A;  5LYD A;  3GUX A;  4R6T A;  4UIB A;  3RZA A;  1VGY A;  5K8N A;  1Z5R A;  4WWV A;  2PJA A;  4UEZ A;  4NGT A;  1F2O A;  5LRK A;  3S9L A;  1FT7 A;  4BD9 A;  1F2P A;  2PJ7 A;  1JQG A;  2PVV A;  3N5F A;  4OKO A;  4ZYQ A;  4PXB A;  3CPX A;  1F57 A;  1TKF A;  4R7M A;  3NA6 A;  3SI0 A;  1FNO A;  2G9D A;  2EK8 A;  3TX8 A;  4PXE A;  4UEF A;  3WC6 A;  2QVP A;  2F8H A;  2ABZ A;  3H8F A;  1CBX A;  4UEE A;  5HVH A;  4MRI A;  1TKH A;  2POK A;  4IAV A;  1GYT A;  4OIW A;  2ZEM A;  1AMP A;  1VHO A;  2IQ6 A;  2ANP A;  4OC3 A;  3ISZ A;  1XJO A;  2C6C A;  4A38 A;  3PB9 X;  2ZED A;  4NGM A;  3T8W A;  4OME A;  3V7Z A;  3LMS A;  3D4U A;  4ONW A;  4MCS A;  3D66 A;  1BAV A;  3KQZ A;  8CPA A;  2DEA A;  1BPN A;  3FF3 A;  4MHP A; 
#chains in the Genus database with same CATH topology
 1RLY A;  4OC0 A;  3QNV A;  1U6M A;  2VUG A;  3HUV A;  2E2H I;  4LQ6 A;  3MRU A;  4KVM E;  1PU9 A;  4OID A;  1HDQ A;  1WZN A;  1M4L A;  2YNE A;  5IT9 b;  4F9U A;  3LAC A;  3CCQ Z;  4KLW A;  4QTT A;  3S17 I;  1QST A;  2Y0S A;  5EC4 A;  3WT4 A;  2AFW A;  1Q82 1;  3S6K A;  4OC5 A;  3CXC Y;  2V8V A;  4PSW A;  4JWP A;  3ZJ0 A;  3BHX A;  3CQZ I;  4KSF A;  3SI2 A;  3PZJ A;  1YUA A;  4CAF A;  4UFW A;  4RVF A;  4A94 A;  3IFE A;  3TO7 A;  2V77 A;  1IGB A;  4DYO A;  4MHD A;  1Z8W A;  2NVQ I;  4LX9 A;  1J4J A;  3S1N I;  3GYA A;  5JGF A;  2YAD A;  1Y1W I;  1ARL A;  3D2M A;  4L89 A;  1Z01 A;  1LFW A;  3S9N A;  1YK3 A;  3PFO A;  5C88 A;  4QTU A;  1USP B;  2Z3P A;  3SHP A;  1M1D A;  1B6B A;  1Y7E A;  3EED A;  1CP6 A;  2AFO A;  2JBJ A;  4KSA A;  1Z8X A;  4CAW A;  3VMI A;  4M6H A;  2WUU A;  2Q04 A;  4H6Z A;  1Z8T A;  4UFV A;  1M4G A;  1UWY A;  1I12 A;  2QR1 B;  3VTN A;  2HV2 A;  4JJX A;  1MJB A;  1Y1V S;  1I6H I;  5D29 A;  3IIB A;  1YLE A;  3PP9 A;  4CRY B;  4FUU A;  3R9E A;  3W91 A;  2IL4 A;  3NE8 A;  2QML A;  1VQ9 1;  1MK4 A;  5FVJ A;  2BJO A;  4UF4 A;  3TDH B;  2QJ8 A;  3SJF A;  3L2N A;  4H89 A;  2JS4 A;  1M4I A;  1Q82 2;  3WC7 A;  4AYB A;  4FBE A;  4UIA A;  1S72 Z;  1TF9 A;  5LRJ A;  2QEC A;  4ORF A;  1QYP A;  4KVO E;  2CF4 A;  3UY5 A;  4NGP A;  5D8N A;  4A3D I;  3KHZ A;  3PB8 X;  2VUM I;  3S2D I;  3IEH A;  2V8G A;  3SJE A;  2VZY A;  4F8Z A;  4ZGY B;  1XRY A;  3KAS A;  4NXY A;  4Y49 B;  5A27 A;  2P3Y A;  4P4D A;  1KUY A;  2C1C A;  2G3T A;  2DPT A;  2PJC A;  3HOW I;  2BO9 A;  1IU8 A;  4AVC A;  4C68 A;  4A3B I;  2GRE A;  1NSL A;  5AG4 A;  5KTC A;  3CC4 Z;  4B14 A;  2JIR A;  2ZAE B;  2I79 A;  2B4D A;  1KD1 1;  3PFE A;  5JQ4 A;  1YJN 1;  2YU9 I;  2WPX A;  3CMA 1;  3B35 A;  1QMU A;  2PJ9 A;  3G6E 1;  4P4E A;  4AG7 A;  2XEG A;  1OZP A;  4RVD A;  2Q7B A;  3CXC Z;  1IOI A;  3I1U A;  2Z11 A;  3G3S A;  3HOX I;  4MH4 A;  3FED A;  1NP6 A;  4TWE A;  1L1O C;  4ZY2 A;  3GLJ A;  2G0B A;  2W03 A;  2PJ4 A;  1VQ7 Z;  2NYQ A;  3D67 A;  2WPW A;  4B12 A;  3LOD A;  4NEX A;  1AA6 A;  5F48 A;  1VQN Z;  4IK2 A;  4CRZ B;  1PCA A;  4OAD A;  2PJ8 A;  1Q86 1;  3GIU A;  5LL6 f;  1YJ9 1;  5AG7 A;  4CYQ A;  2J8R A;  2Q4Z A;  1S7K A;  1PUA A;  2Q4Y A;  1UFH A;  3B7I A;  4CGN A;  1QSM A;  3B3T A;  4IF5 A;  2CNT A;  3LWU A;  4F6A A;  1QQ9 A;  4NH1 C;  2AFU A;  1TWA I;  3BG1 B;  5HVF A;  4A3K I;  1RO5 A;  3V38 A;  4R9M A;  2PJ3 A;  3H5Z A;  2PRB A;  4A31 A;  4NBF A;  1CP7 A;  4M85 A;  3K2K A;  1VQ4 Z;  4F0Y A;  3CCQ 1;  4FD4 A;  3CD6 Z;  3RZD I;  2NVY I;  3IU1 A;  4FD5 A;  1ZLI A;  1IB1 E;  1AUG A;  1YQE A;  4RUH A;  4RV9 A;  5IP7 I;  3PO2 I;  1CX8 A;  4A2Z A;  3F5B A;  4CPA A;  3DR6 A;  1QVG Z;  1KD1 2;  1I21 A;  2RC4 A;  4DJL A;  4CAE A;  1B87 A;  3GUX A;  5F47 A;  1VGY A;  2AJ6 A;  4A33 A;  3I07 A;  4AVA A;  3S9L A;  2OB0 A;  4B5P B;  2IZ3 A;  4UFX A;  4BD9 A;  2YNC A;  4NBA A;  4R87 A;  2PJ7 A;  3S1M I;  1K83 I;  4ZYQ A;  4PXB A;  2WAQ A;  1VQP Z;  1Z9U A;  4R7M A;  4CYP A;  3D2L A;  3FQQ A;  1FNO A;  4UEF A;  2QVP A;  4CL1 A;  4QUS A;  2R98 A;  3K7A I;  1CBX A;  2VPX A;  3G71 Z;  3RYO A;  4UEE A;  2B3V A;  4MRI A;  2POK A;  1Q86 2;  4BXX I;  4XPD B;  4B13 A;  1IYL A;  1VQ9 Z;  3I4N I;  2C6C A;  2OZH A;  2LEX A;  2B5G A;  1BOB A;  4OME A;  8CPA A;  3FF3 A;  2JIO A;  3S1Q I;  3PBB A;  4X2T A;  1TF8 A;  3PB7 X;  5ISV A;  1JJ2 Z;  3IFU A;  4C2Z A;  1CJW A;  4PXC A;  4PSX A;  4A3C I;  1NMT A;  2D4P A;  1X3Z A;  1S72 1;  4NBG A;  4NGR A;  2R92 I;  1XMB A;  2NVT I;  3I9S A;  4HPS A;  3CXQ A;  5K8P A;  2B58 A;  3G4S Z;  3M3Y I;  4A37 A;  4BIN A;  3FRM A;  2NMT A;  3FVL A;  5CPA A;  4R76 A;  1YSJ A;  5D1O A;  3PB4 X;  1PYT B;  2I3C A;  4U5Y A;  2ZEF A;  2R7Z I;  2HC9 A;  5A2Q f;  1ON0 A;  1ELL P;  4MJ8 A;  2K5T A;  2JEV A;  2JIP A;  2V8K A;  1RQF A;  3FXT A;  1I1D A;  4PQA A;  3PO3 S;  3B3W A;  5JPH A;  4MFQ A;  3CC4 1;  3TFY A;  4NBE A;  2QEX 1;  1KQS Y;  2CTC A;  1VLA A;  4L8A A;  1WW9 A;  3IWG A;  2YGW A;  3SJG A;  4AB7 A;  1WJ2 A;  3B3S A;  2XEF A;  3M4O I;  2PCU A;  3FJU A;  1S5K A;  2IJZ A;  2Z0Z A;  1YHQ 1;  4R57 A;  1LRZ A;  3TO6 A;  3KGQ A;  4RI1 A;  4DGL A;  2FS5 A;  5BWA B;  4A3M I;  2OZU A;  2KCW A;  3PRT A;  5DS0 A;  1JWH C;  5EMI A;  2JIQ A;  1WCM I;  3CCU 1;  2AFS A;  4W9Y A;  1ZB9 A;  2JBK A;  3W6X A;  1VQ7 1;  1K4J A;  2P0W A;  5GCN A;  1TKJ A;  1Z2L A;  1VQN 1;  1YJW Z;  4C7H A;  5F09 A;  4E2W A;  1IYK A;  2WB1 A;  2R93 I;  5CNP A;  4ZX8 A;  1S60 A;  4KOW A;  2JDC A;  2RHB A;  3T90 A;  4Q38 A;  3SJX A;  1I3Q I;  2Z3L A;  4OC1 A;  3FEE A;  1QVF Z;  5DWM A;  1X12 A;  2ZEG A;  2D4O A;  1I50 I;  1K9M 1;  5A2Q b;  3EFA A;  5J1Q A;  5IB9 A;  3IWE A;  3TTH A;  1XE4 A;  4KVX A;  4RVG A;  3DSB A;  4DK1 A;  1R9T I;  1VQ4 1;  3S1R I;  2ZW7 A;  3H4Q A;  3R95 A;  2QRE B;  5T6B A;  3EER A;  4FD7 A;  3CD6 1;  2HB6 A;  1M1K 1;  4R3L A;  3JUW A;  2GLJ A;  1YVO A;  2BEI A;  4E2Z A;  2Z3M A;  4JYW A;  2JEW A;  1JWQ A;  5CBM A;  3EY5 A;  4MMO A;  1Y0Y A;  5F49 A;  2V3V A;  1EE3 P;  4RS4 A;  4Q7A A;  2BUE A;  3GTL I;  3MGD A;  3V8I A;  2GU2 A;  4AXV A;  2ZW5 A;  2GFQ A;  3D68 A;  2PR8 A;  1TWF I;  4M3S A;  2Z10 A;  4QVT A;  4UA3 A;  2QRC B;  3NH5 A;  1H8L A;  5IB0 A;  4NB8 A;  1LAM A;  3QAY A;  1X3W A;  4ZX9 A;  4KOR A;  2FXF A;  5FLX f;  3IO1 A;  2P6F A;  3R1K A;  2JIM A;  4PPZ A;  3CXP A;  1IY7 A;  1Q2D A;  2KPI A;  3KIF A;  4MXU A;  1VQP 1;  4BBS I;  7CPA A;  4RS2 A;  1R43 A;  5ELY A;  2FCK A;  5IX3 A;  1RNI A;  1XFO A;  3WC5 A;  3B2Y A;  3S6F A;  2JMO A;  2XEI A;  1Z03 A;  4LQG A;  2K3R A;  3RBU A;  3D2P A;  3G71 1;  4R8F A;  2PM9 A;  3JRU A;  2FSR A;  2JNY A;  3BI1 A;  4I49 A;  2NVX I;  4LUA A;  4ZBG A;  1VIX A;  3EC4 A;  2ZEH A;  1FY7 A;  5K8M A;  4B11 A;  1QXF A;  1TXR A;  5T67 A;  1K9M 2;  3KHX A;  5A28 A;  4KS9 A;  2PIZ A;  3H8E A;  1CG2 A;  1AYE A;  4UWJ A;  3IX0 A;  3CZX A;  4F9V A;  4HNX B;  3D7D A;  1BO4 A;  1VQL Z;  2PDO A;  1YIT Z;  2R6M A;  2J8N A;  4M6I A;  1R3N A;  1M1K 2;  1KRL A;  2VZZ A;  4NJR A;  3FQM A;  3I56 Z;  3WR7 A;  2PE3 A;  2Z3O A;  3DGV A;  3CC2 Z;  1Z4R A;  1Y0R A;  2IV2 X;  3GB0 A;  3G4S 1;  5FLX b;  1Y7R A;  4MY0 A;  2FT0 A;  3SI1 A;  2AFZ A;  4PV6 A;  4PXD A;  4AVB A;  3R96 A;  2AFM A;  3TC8 A;  1K8A 1;  3CCJ Z;  2Z3K A;  3S6H A;  4NGS A;  2QEX Z;  2B63 I;  1WK4 A;  3JVN A;  4R6T A;  1TWG I;  1P9N A;  4MFZ A;  4JLY A;  4XPL A;  1Z5R A;  3GY9 A;  4OLL A;  4UEZ A;  4NGT A;  3JAM f;  5HMN A;  4E2Y A;  3H3V J;  1WWZ A;  2YNC C;  2PVV A;  3U50 C;  1YHQ Z;  4UCN A;  3IF8 A;  1F57 A;  1TKF A;  5IV0 A;  2WSA A;  3F3P C;  2F8H A;  2CY2 A;  3H8F A;  4YRH A;  4BY1 I;  3HOU I;  2R7H A;  3VWD A;  4BMH A;  3CCU Z;  4C2Y A;  3VMH A;  4OIW A;  2ODF A;  5IP9 I;  1VHO A;  2IQ6 A;  3ISZ A;  2ZW6 A;  4A38 A;  3PB9 X;  1Z02 A;  1R57 A;  4NGM A;  3T8W A;  2PMZ A;  2F4M A;  4ONW A;  4Q36 A;  1BAV A;  2F4O A;  3KIH A;  1YJW 1;  2DEA A;  2OH1 A;  3D8P A;  4P10 A;  4MHP A;  3ESW A;  1QSR A;  3KR5 A;  5T64 A;  1M44 A;  4KOX A;  2Q0Y A;  1Q2Y A;  4CGP A;  4FWU A;  2WYR A;  3CCV Z;  3CCL Z;  2E9H A;  4E8O A;  1P4N A;  4BBH A;  4PK3 A;  2FE7 A;  1NSA A;  3HOY I;  1KWM A;  3JAM b;  1Q81 1;  3BXM A;  2C6G A;  1K8A 2;  2B3U A;  4HH4 A;  3CT9 A;  4NGN A;  4OP4 A;  1XBU A;  2REE A;  4P6Y A;  2CNS A;  1M4D A;  2O53 A;  2XEJ A;  1ZG7 A;  4Z65 A;  5G21 A;  4MD9 A;  4X8I A;  4DNC A;  2JUB A;  1Q7Y 1;  5G22 A;  2J6A A;  1N2F A;  3FBU A;  1YW6 A;  4UWI A;  4Y7N I;  4X6A I;  4ZY0 A;  3OW2 Y;  1LOK A;  5DWN A;  2E2J I;  2QRD B;  2V8H A;  2V8J A;  4KSI A;  1ZG9 A;  1YUK A;  4A39 A;  5JH9 A;  4E30 A;  3F8K A;  3R9G A;  3BLN A;  4MCR A;  2NAP A;  1YW4 A;  4A3F I;  2P6G A;  3DR8 A;  2VPW A;  3S15 I;  4NSQ A;  4HGY A;  4UCM A;  2NSM A;  3NH8 A;  3J80 f;  2REF A;  2W04 A;  3NDJ A;  1ZLH A;  2EK9 A;  4ZY1 A;  5J8F A;  3RNZ A;  3IU2 A;  4K30 A;  3CCR Z;  1RO4 A;  4NCZ A;  3TE5 B;  3DDD A;  3S6G A;  4KOV A;  4A3G I;  4MHN A;  2ZEO A;  1VHS A;  2BL1 A;  4NFR A;  2V45 A;  1IOF A;  1VQ5 Z;  4NBD A;  1TWC I;  3VAT A;  2H5M A;  1KUV A;  5C4X I;  1KUX A;  3CC7 Z;  1VKC A;  3T4N B;  1Q81 2;  2OOT A;  3IWW A;  1P0H A;  1FDO A;  1Q7L A;  2V8D A;  1VQL 1;  3T9Y A;  2PJ6 A;  1YIT 1;  2J8M A;  5JM6 A;  3H8G A;  3D6W A;  2B4B A;  1OBR A;  3Q87 A;  1YRE A;  3LUS A;  1Q7Y 2;  3ISX A;  1DE4 C;  4U9Y A;  3I56 1;  4MFL A;  3PB6 X;  3CC2 1;  4DQY B;  1LCP A;  1ZG8 A;  4NGQ A;  4K3N A;  4NBH A;  4MCQ A;  2OTJ Z;  2OOX B;  3TO9 A;  3J80 b;  3HOV I;  1LAP A;  2Q4V A;  3KL9 A;  3IR7 A;  3CCJ 1;  1VQ6 1;  2ZXV A;  3GTM I;  2DXQ A;  1NUI A;  3I55 Z;  1CPS A;  4U9Z A;  2FVG A;  4Y49 C;  4MBU A;  5J8C A;  2JA8 I;  3TOA A;  3VB9 A;  1HEE A;  4WJB A;  1ARM A;  3NH4 A;  3B8G A;  4UCP A;  4P44 A;  4E33 A;  4H2K A;  3IC1 A;  2G3A A;  2EBJ A;  3FNC A;  1NE9 A;  4F0X A;  5THW A;  3BI0 A;  3MZL B;  3S16 I;  4TNU A;  1W2B Y;  1VQK 1;  3LD2 A;  2EO8 A;  4X5K A;  1USP A;  2QA4 Z;  5HVG A;  4B10 A;  1Q16 A;  3CCS Z;  3SXN A;  4MD7 A;  3BG0 B;  2O28 A;  2ZOG A;  2P28 A;  3MN8 A;  1RO0 A;  3D7H A;  2I00 A;  4OC4 A;  4M6G A;  1S7N A;  1VQ8 Z;  5D1P A;  1QSN A;  3BJ7 A;  3P5J B;  3OW2 Z;  3SXO A;  2ARH A;  1XOV A;  5F46 A;  1Q2C A;  4HNY B;  3QB8 A;  4YU9 A;  2A4N A;  1RTQ A;  2DF5 A;  5I0C A;  4EWT A;  2OR4 A;  2V8I A;  1BLL E;  1S7M A;  5LRG A;  2VF1 A;  3ZZI A;  2YND A;  4CAX A;  4KOS A;  4P4F A;  4JXR A;  1DL6 A;  4MCP A;  3CCM Z;  2VXK A;  4P45 A;  4YFJ A;  3D7F A;  1ZB8 A;  2HQY A;  2AE6 A;  5CM2 M;  4RN7 A;  3H0G I;  3CCV 1;  3DNS A;  3CCL 1;  4MFK A;  5E96 A;  5K8O A;  4PK2 A;  4CAV A;  5H84 A;  5D1O B;  1KZF A;  3I3G A;  2EWB A;  3KKW A;  1CPX A;  2VBQ A;  1VHE A;  4O23 A;  1YGH A;  1X10 A;  3CPA A;  1SFO I;  1Z8L A;  4QB9 A;  4C7I A;  1A2Z A;  4IUS A;  3GKR A;  3MON A;  2R8V A;  5H86 A;  4EWC A;  3S14 I;  4MD8 A;  4RVH A;  3RZA A;  5K8N A;  4WWV A;  1XF8 A;  3RZO I;  2ZPA A;  5LRK A;  3CME Z;  2PC1 A;  3EXN A;  3N5F A;  2EVN A;  3CPX A;  3D3S A;  3NA6 A;  4BY7 I;  2G9D A;  2EK8 A;  1YX0 A;  4PXE A;  3WC6 A;  2ABZ A;  4NOZ A;  5HVH A;  1TKH A;  4IAV A;  4KOU A;  4CYN A;  2ZEM A;  4JXQ A;  4OC3 A;  3QWU A;  2ZED A;  2RBL A;  4A32 A;  3CCR 1;  1QF8 A;  1Y1V I;  4HGZ A;  5AG6 A;  3I4M I;  3D4U A;  4MCS A;  1IIC A;  3D66 A;  3KQZ A;  1QVG Y;  3N7Z A;  3GKQ A;  1BPN A;  1KQS Z;  4XPD C;  2ZEL A;  4C2X A;  2P6E A;  2C27 A;  1VQ5 1;  3TCV A;  3BJ8 A;  1YIJ 1;  1WII A;  1M90 1;  2QKD A;  3CC7 1;  4KLV A;  2BCO A;  2RFH A;  2JLM A;  3NDI A;  2CIJ A;  2OOY B;  2JDD A;  1W2B Z;  2Q51 A;  4B5O A;  1MJ9 A;  3FIX A;  4A3J I;  3HLP A;  1FDI A;  4E2X A;  3CXS A;  3PEI A;  1ELM P;  1YI2 Z;  5KTA A;  4A3E I;  2BSW A;  3HOZ I;  2KI7 B;  1VQ6 Z;  3GTJ I;  1CM0 A;  3QAH A;  2OTJ 1;  2FIA A;  4AG9 A;  2GTI A;  4QBJ A;  4QC6 A;  1SQH A;  1VQO 1;  4A95 A;  2QYV A;  2F5I A;  4IHM A;  1LQL A;  5LYF A;  4EME A;  4MI4 A;  1Y9W A;  4P4I A;  3I55 1;  1Z4E A;  2J9A A;  3FKI I;  4XNH C;  1VQK Z;  1JJ2 Y;  5C82 A;  1MJA A;  3S2H I;  2CXA A;  1K73 1;  2OTL Z;  2DPS A;  4P4B A;  3NFZ A;  3A9L A;  4EVY A;  1LAN A;  1TFI A;  4B5P A;  2GTH A;  2Q44 A;  4GS4 A;  3IGR A;  3D7G A;  3KR4 A;  3RAM A;  2GIV A;  5EBV A;  2QA4 1;  4X3R A;  2H85 A;  2PIY A;  3S9M A;  3VMG A;  1VQM Z;  4GM5 A;  3PBE A;  2M6N A;  5LYL A;  3CCS 1;  2ZEN A;  4YWY A;  1YME A;  2JA5 I;  4OC2 A;  3J81 f;  2ZW4 A;  4HKF A;  5G1Z A;  1VQ8 1;  4XX2 A;  3DLJ A;  5HH1 A;  2BOA A;  1M90 2;  3CCE 1;  4KZT A;  1YLO A;  3WAB A;  4P4J A;  4CS0 B;  1ML8 A;  4CGM A;  1QSO A;  2E7Z A;  2C6P A;  3VWE A;  1S7F A;  1L0C A;  2DE7 A;  3CPW Y;  4OAE A;  3OWC A;  3CCM 1;  1NJI 1;  4MFJ A;  2AFX A;  3D9X A;  3VH9 A;  2Q43 A;  4A3L I;  1XMT A;  4JD6 A;  2RIQ A;  1S3Z A;  3GCF A;  4MY3 A;  1N8R 1;  1YR0 A;  4MFP A;  3FX6 A;  5I4M A;  2O4H A;  3KZW A;  2IZ4 A;  1TIQ A;  2E2I I;  4S1T A;  3FEC A;  3GTO I;  2B4D B;  2RB7 A;  3HKZ A;  2FL4 A;  4B6Z A;  4NF1 A;  4E2A A;  4KOY A;  2IMO A;  2GLF A;  4R3K A;  5C44 I;  1K73 2;  2VI7 A;  2EUI A;  3TOB A;  1KC8 1;  3W6S A;  4ZI6 A;  2GAN A;  4KUA A;  3J81 b;  2PJ5 A;  2OU2 A;  2GE3 A;  4G1P A;  3B3V A;  2CNM A;  1Y9K A;  3FH4 A;  2AYD A;  3KI9 A;  2G2K A;  1YVK A;  4Y52 I;  1QVF Y;  3CME 1;  3FYN A;  3GTK I;  2ZEP A;  4CYO A;  3GTG I;  1HDU A;  4MHZ A;  4A30 A;  4A93 I;  4KOT A;  3P2H A;  4J3G A;  3J7A 4;  5AN9 F;  2VQY A;  3CDX A;  2PJ1 A;  2PJ2 A;  3G8W A;  2PJB A;  1RXT A;  1SIW A;  2VPY A;  2HU9 A;  4CGO A;  1IID A;  3PGP A;  2VEZ A;  2WZN A;  5AGE A;  5LYI A;  4FD6 A;  3B3C A;  4MHY A;  2RPR A;  4BBR I;  2JA6 I;  3E0K A;  4EFD A;  2X7B A;  2DE5 A;  1Y8C A;  1XIX A;  1RO2 A;  5KTD A;  1YIJ Z;  2LFU A;  1NJI 2;  2ZOF A;  1GHE A;  5C4J I;  2ATR A;  1ZH1 A;  5HXD A;  4E31 A;  3R9F A;  4E32 A;  2JA7 I;  4NBC A;  2DE6 A;  3TT2 A;  6CPA A;  2HF1 A;  1N8R 2;  2VL1 A;  3F0A A;  3FB3 A;  2R1I A;  2VPZ A;  3FMC A;  4JZ0 A;  1ZO0 A;  2CTB A;  3VAR A;  2PRQ A;  2PSW A;  3GTP I;  2HUZ A;  3KQX A;  4ONU A;  4FAI A;  4DUK A;  2F7V A;  1DTD A;  3RO0 A;  3K9T A;  4MON A;  2JR6 A;  2RT9 A;  2EGT A;  2ZEE A;  2PJ0 A;  2K5R A;  1KC8 2;  1YI2 1;  1VQO Z;  2M48 A;  1XEB A;  2OZK A;  4UBR A;  2FIW A;  4NJQ A;  2QLV B;  5AG5 A;  4HNW B;  3GTM S;  1BPM A;  3F3F C;  4GXH A;  3P2F A;  2PVW A;  3IJ3 A;  5LYD A;  1PFT A;  5IT9 f;  3JTK A;  4XNH B;  4UIB A;  4KUB A;  5C3E I;  1YJN Z;  2PJA A;  1F2O A;  3CMA Z;  3TE4 A;  2PK7 A;  1FT7 A;  3CPW Z;  1F2P A;  3G6E Z;  3PO3 I;  3MZK B;  1JQG A;  4OKO A;  2PQ8 A;  3EO4 A;  4E0A A;  1X0T A;  3SI0 A;  4YGO A;  4A3I I;  2OTL 1;  3TX8 A;  2B5G B;  4NBB A;  1S7L A;  4NB9 A;  4H6U A;  1V0C A;  2Z3N A;  1N71 A;  2LIY A;  1GYT A;  3GTQ I;  1AMP A;  2ANP A;  2AKL A;  2Y0M A;  1TWH I;  3NE7 A;  1XJO A;  3CCE Z;  1VQM 1;  2OZG A;  5FLM I;  5G20 A;  1YJ9 Z;  2Q7S A;  2PR1 A;  3V7Z A;  3LMS A;  4CGL A;  4XPK A;  3K9U A;  4II9 A;  2QIR A;  3C26 A; 
#chains in the Genus database with same CATH homology
 1KQS Z;  1RLY A;  2ZEL A;  3ESW A;  4OC0 A;  3QNV A;  3S1Q I;  2VUG A;  3PBB A;  1VQ5 1;  3KR5 A;  1TF8 A;  3HUV A;  4X2T A;  5T64 A;  3PB7 X;  1JJ2 Z;  2E2H I;  3IFU A;  1YIJ 1;  3MRU A;  4FWU A;  4OID A;  1WII A;  2WYR A;  4PXC A;  1HDQ A;  1M90 1;  3CCV Z;  2QKD A;  1M4L A;  3CC7 1;  4A3C I;  3CCL Z;  2E9H A;  5IT9 b;  4F9U A;  2BCO A;  3CCQ Z;  2RFH A;  1X3Z A;  4QTT A;  3NDI A;  1S72 1;  4NBG A;  2OOY B;  3S17 I;  2CIJ A;  4NGR A;  4P10 A;  2Y0S A;  2R92 I;  1XMB A;  2NVT I;  3WT4 A;  1NSA A;  1W2B Z;  3HOY I;  2AFW A;  1KWM A;  2Q51 A;  5K8P A;  3JAM b;  1Q81 1;  3G4S Z;  3BXM A;  1Q82 1;  4A3J I;  2C6G A;  1K8A 2;  3M3Y I;  3CXC Y;  2V8V A;  4OC5 A;  4A37 A;  3CT9 A;  4HH4 A;  4OP4 A;  4NGN A;  3HLP A;  3FVL A;  1XBU A;  5CPA A;  3BHX A;  4P6Y A;  4E2X A;  3CQZ I;  3PEI A;  2O53 A;  1ELM P;  4R76 A;  1YI2 Z;  4A3E I;  2XEJ A;  3SI2 A;  1ZG7 A;  3HOZ I;  1YSJ A;  4Z65 A;  4MD9 A;  2KI7 B;  4X8I A;  5D1O A;  3PB4 X;  1VQ6 Z;  1PYT B;  3GTJ I;  1YUA A;  2JUB A;  1Q7Y 1;  2I3C A;  2J6A A;  1N2F A;  4RVF A;  1YW6 A;  4A94 A;  3IFE A;  2ZEF A;  4Y7N I;  4X6A I;  2V77 A;  4ZY0 A;  1IGB A;  3OW2 Y;  2R7Z I;  1LOK A;  4DYO A;  2HC9 A;  2OTJ 1;  2E2J I;  2QRD B;  2NVQ I;  2GTI A;  5A2Q f;  2V8H A;  2V8J A;  1VQO 1;  1ELL P;  4KSI A;  1ZG9 A;  3S1N I;  2QYV A;  5JGF A;  2V8K A;  2YAD A;  1Y1W I;  1YUK A;  4IHM A;  1RQF A;  1ARL A;  4PQA A;  1LQL A;  3PO3 S;  3B3W A;  4A39 A;  1Z01 A;  5LYF A;  5JH9 A;  4E30 A;  3CC4 1;  4EME A;  1LFW A;  3S9N A;  4NBE A;  2QEX 1;  1KQS Y;  2CTC A;  3I55 1;  4P4I A;  1VLA A;  4MCR A;  3PFO A;  4QTU A;  2J9A A;  1USP B;  1YW4 A;  3FKI I;  1WW9 A;  1VQK Z;  1JJ2 Y;  4A3F I;  3S2H I;  1K73 1;  2OTL Z;  3SJG A;  1Y7E A;  3EED A;  1CP6 A;  2AFO A;  2JBJ A;  3B3S A;  3NFZ A;  4P4B A;  2XEF A;  3VMI A;  3S15 I;  3M4O I;  2PCU A;  3FJU A;  1LAN A;  2IJZ A;  1TFI A;  4HGY A;  2GTH A;  1YHQ 1;  1UWY A;  3NH8 A;  3J80 f;  2NSM A;  2W04 A;  3NDJ A;  3KGQ A;  1ZLH A;  2EK9 A;  3D7G A;  3KR4 A;  2QR1 B;  3VTN A;  3RAM A;  4DGL A;  4ZY1 A;  2QA4 1;  4X3R A;  2H85 A;  2PIY A;  3S9M A;  3VMG A;  1VQM Z;  4GM5 A;  1Y1V S;  1I6H I;  3PBE A;  4A3M I;  2M6N A;  5LYL A;  3CCS 1;  2ZEN A;  3IIB A;  5D29 A;  4YWY A;  3PRT A;  3CCR Z;  5DS0 A;  1JWH C;  1RO4 A;  1YME A;  1WCM I;  2JA5 I;  4OC2 A;  3CCU 1;  2AFS A;  4FUU A;  4W9Y A;  3TE5 B;  1ZB9 A;  2JBK A;  3J81 f;  1VQ7 1;  1VQ8 1;  1TKJ A;  1Z2L A;  4XX2 A;  1VQN 1;  1VQ9 1;  1YJW Z;  4A3G I;  4MHN A;  2ZEO A;  5F09 A;  3DLJ A;  4E2W A;  1M90 2;  2BOA A;  2WB1 A;  3CCE 1;  2R93 I;  1YLO A;  3WAB A;  4NFR A;  4P4J A;  4ZX8 A;  2BJO A;  1ML8 A;  1VQ5 Z;  4NBD A;  1TWC I;  2RHB A;  4UF4 A;  3TDH B;  2QJ8 A;  3SJF A;  3VAT A;  2C6P A;  3SJX A;  3L2N A;  1I3Q I;  4OC1 A;  5C4X I;  3FEE A;  1QVF Z;  3CC7 Z;  3T4N B;  1Q81 2;  2JS4 A;  2ZEG A;  1Q82 2;  2DE7 A;  2OOT A;  1I50 I;  1K9M 1;  5A2Q b;  3WC7 A;  4AYB A;  3CPW Y;  4FBE A;  5J1Q A;  3IWW A;  4UIA A;  1S72 Z;  1TF9 A;  1Q7L A;  2V8D A;  3CCM 1;  5LRJ A;  1VQL 1;  5IB9 A;  1NJI 1;  1QYP A;  2CF4 A;  2PJ6 A;  2AFX A;  3D9X A;  3VH9 A;  1YIT 1;  2Q43 A;  4A3L I;  5JM6 A;  4RVG A;  3H8G A;  3D6W A;  1OBR A;  2RIQ A;  3Q87 A;  4NGP A;  4DK1 A;  1R9T I;  3LUS A;  1Q7Y 2;  3ISX A;  5D8N A;  3GCF A;  4A3D I;  1VQ4 1;  1N8R 1;  3S1R I;  1DE4 C;  3KHZ A;  3PB8 X;  2VUM I;  2QRE B;  3I56 1;  5T6B A;  3EER A;  3S2D I;  3IEH A;  3PB6 X;  3CD6 1;  3FX6 A;  2V8G A;  3SJE A;  3CC2 1;  4F8Z A;  2HB6 A;  4DQY B;  1M1K 1;  5I4M A;  1LCP A;  2O4H A;  1ZG8 A;  1XRY A;  3KZW A;  2GLJ A;  4NGQ A;  4K3N A;  2IZ4 A;  3KAS A;  2E2I I;  4S1T A;  2P3Y A;  4E2Z A;  3FEC A;  4P4D A;  3GTO I;  4NBH A;  2RB7 A;  4JYW A;  4MCQ A;  2OTJ Z;  2JEW A;  3HKZ A;  2OOX B;  4B6Z A;  5CBM A;  3J80 b;  3HOV I;  2C1C A;  1Y0Y A;  4MMO A;  1LAP A;  3KL9 A;  2IMO A;  2PJC A;  3HOW I;  1EE3 P;  2GLF A;  2BO9 A;  4RS4 A;  1VQ6 1;  3CCJ 1;  5C44 I;  4Q7A A;  4A3B I;  3GTL I;  1K73 2;  2GRE A;  3CC4 Z;  3GTM I;  1KC8 1;  2GU2 A;  4ZI6 A;  1NUI A;  3I55 Z;  4AXV A;  1CPS A;  3D68 A;  2FVG A;  1TWF I;  2ZAE B;  3J81 b;  2JA8 I;  2PJ5 A;  4G1P A;  3VB9 A;  1HEE A;  3B3V A;  2QRC B;  4WJB A;  3NH5 A;  1KD1 1;  1ARM A;  3FH4 A;  1H8L A;  3PFE A;  3NH4 A;  4NB8 A;  1YJN 1;  2YU9 I;  1LAM A;  1X3W A;  3KI9 A;  4P44 A;  2G2K A;  4E33 A;  4H2K A;  4ZX9 A;  3CMA 1;  3IC1 A;  4Y52 I;  1QVF Y;  3B35 A;  5FLX f;  3CME 1;  3IO1 A;  1QMU A;  2PJ9 A;  3G6E 1;  3GTK I;  4P4E A;  2ZEP A;  4PPZ A;  3BI0 A;  5THW A;  1IY7 A;  3MZL B;  2KPI A;  3KIF A;  3GTG I;  3S16 I;  2XEG A;  4MXU A;  4TNU A;  1VQP 1;  1W2B Y;  4BBS I;  1HDU A;  1VQK 1;  4MHZ A;  7CPA A;  1R43 A;  5ELY A;  4RVD A;  4A93 I;  1USP A;  3CXC Z;  2QA4 Z;  3J7A 4;  1RNI A;  5AN9 F;  3CDX A;  1XFO A;  2PJ1 A;  3I1U A;  2PJ2 A;  3B2Y A;  3WC5 A;  5HVG A;  2JMO A;  2XEI A;  3CCS Z;  2PJB A;  1Z03 A;  3HOX I;  4LQG A;  2K3R A;  3RBU A;  4MH4 A;  3FED A;  4MD7 A;  1NP6 A;  3BG0 B;  2HU9 A;  3G71 1;  4TWE A;  2ZOG A;  2P28 A;  1L1O C;  4ZY2 A;  3MN8 A;  1RO0 A;  3GLJ A;  3D7H A;  4R8F A;  2PM9 A;  2W03 A;  3JRU A;  4OC4 A;  2PJ4 A;  1VQ7 Z;  2WZN A;  2JNY A;  2NYQ A;  3D67 A;  5LYI A;  1VQ8 Z;  3BI1 A;  3B3C A;  4MHY A;  2RPR A;  1VQN Z;  2NVX I;  5D1P A;  4BBR I;  4IK2 A;  2JA6 I;  1PCA A;  3P5J B;  3OW2 Z;  1VIX A;  2PJ8 A;  2ZEH A;  5K8M A;  1TXR A;  5T67 A;  1K9M 2;  3KHX A;  4YU9 A;  1Q86 1;  4EFD A;  2PIZ A;  2DE5 A;  5LL6 f;  1YJ9 1;  1RTQ A;  3H8E A;  1RO2 A;  1YIJ Z;  2LFU A;  1CG2 A;  1NJI 2;  2Q4Z A;  2ZOF A;  4EWT A;  2OR4 A;  1AYE A;  2V8I A;  5C4J I;  1BLL E;  3B7I A;  1ZH1 A;  5HXD A;  4E31 A;  1S7M A;  5LRG A;  2VF1 A;  3B3T A;  3IX0 A;  4E32 A;  4F9V A;  3LWU A;  2JA7 I;  1QQ9 A;  4NH1 C;  3D7D A;  2AFU A;  4NBC A;  2DE6 A;  4P4F A;  6CPA A;  2HF1 A;  1N8R 2;  1DL6 A;  4MCP A;  3CCM Z;  2VL1 A;  1VQL Z;  4P45 A;  1TWA I;  3BG1 B;  5HVF A;  4A3K I;  1ZB8 A;  1YIT Z;  3D7F A;  5CM2 M;  2R6M A;  3V38 A;  1R3N A;  1M1K 2;  2PJ3 A;  1KRL A;  3H0G I;  3FMC A;  4JZ0 A;  3CCV 1;  4NBF A;  1CP7 A;  4NJR A;  3CCL 1;  3K2K A;  2CTB A;  3VAR A;  3FQM A;  1VQ4 Z;  2PRQ A;  5K8O A;  3GTP I;  3CCQ 1;  3KQX A;  3I56 Z;  5D1O B;  2PE3 A;  3CD6 Z;  3DGV A;  3CC2 Z;  2EWB A;  1CPX A;  4FAI A;  1Y0R A;  3RZD I;  2F7V A;  3GB0 A;  1VHE A;  4DUK A;  1DTD A;  2NVY I;  4O23 A;  3G4S 1;  3K9T A;  5FLX b;  3CPA A;  4MON A;  2JR6 A;  1SFO I;  3SI1 A;  2RT9 A;  2AFZ A;  1ZLI A;  1Z8L A;  2EGT A;  2ZEE A;  4PXD A;  2PJ0 A;  2K5R A;  4RUH A;  1KC8 2;  4RV9 A;  5IP7 I;  3PO2 I;  1CX8 A;  1YI2 1;  1VQO Z;  2M48 A;  3MON A;  2OZK A;  2AFM A;  4CPA A;  4NJQ A;  2QLV B;  3TC8 A;  4EWC A;  1K8A 1;  3CCJ Z;  1QVG Z;  1KD1 2;  3GTM S;  4DJL A;  3S14 I;  1BPM A;  3F3F C;  2PVW A;  3IJ3 A;  4NGS A;  4MD8 A;  2QEX Z;  3GUX A;  2B63 I;  1PFT A;  5LYD A;  4RVH A;  4R6T A;  5IT9 f;  1TWG I;  4UIB A;  3RZA A;  1P9N A;  1VGY A;  5K8N A;  1Z5R A;  4WWV A;  3I07 A;  5C3E I;  1YJN Z;  2PJA A;  3RZO I;  4UEZ A;  4NGT A;  1F2O A;  3CMA Z;  3JAM f;  5LRK A;  2PK7 A;  3S9L A;  4E2Y A;  3CME Z;  3H3V J;  1FT7 A;  2IZ3 A;  4BD9 A;  4NBA A;  3CPW Z;  3G6E Z;  3PO3 I;  1F2P A;  3MZK B;  2PJ7 A;  3S1M I;  1JQG A;  1K83 I;  2PVV A;  3U50 C;  1YHQ Z;  3IF8 A;  3N5F A;  4OKO A;  4ZYQ A;  4PXB A;  3CPX A;  2WAQ A;  1VQP Z;  1F57 A;  1TKF A;  4R7M A;  1X0T A;  3NA6 A;  3SI0 A;  4A3I I;  4BY7 I;  3FQQ A;  2OTL 1;  1FNO A;  2EK8 A;  2G9D A;  3TX8 A;  4NBB A;  3F3P C;  4PXE A;  4UEF A;  4NB9 A;  2QVP A;  4CL1 A;  3WC6 A;  2F8H A;  2ABZ A;  3H8F A;  3K7A I;  1CBX A;  4NOZ A;  4BY1 I;  3HOU I;  3G71 Z;  4UEE A;  5HVH A;  4MRI A;  3CCU Z;  1TKH A;  2POK A;  4IAV A;  2LIY A;  1Q86 2;  1GYT A;  3VMH A;  4OIW A;  2ZEM A;  3GTQ I;  4BXX I;  1AMP A;  5IP9 I;  1VHO A;  2IQ6 A;  2ANP A;  2AKL A;  1VQ9 Z;  4OC3 A;  1TWH I;  3I4N I;  3ISZ A;  3QWU A;  1XJO A;  3CCE Z;  2C6C A;  1VQM 1;  3PB9 X;  4A38 A;  2ZED A;  1Z02 A;  2RBL A;  5FLM I;  3CCR 1;  1QF8 A;  1Y1V I;  4HGZ A;  1YJ9 Z;  4NGM A;  3T8W A;  3I4M I;  2PMZ A;  2F4M A;  4OME A;  3V7Z A;  3LMS A;  3D4U A;  4ONW A;  4MCS A;  3D66 A;  1BAV A;  3KQZ A;  1QVG Y;  2F4O A;  3KIH A;  8CPA A;  1YJW 1;  3GKQ A;  2DEA A;  1BPN A;  3FF3 A;  4MHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...