2O4HA

Human brain aspartoacylase complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o4hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o4hA01
3D68A 1Z2LA 4ZY0A 3GB0A 4H2KA 5D29A 3FEEA 3LWUA 2PIYA 4R8FA 2CTBA 1ZLHA 4P6YA 4OC0A 5K8MA 1ZLIA 3PB8X 3B3TA 5ELYA 1AYEA 3KR4A 3K2KA 5HVHA 3B3VA 4NFRA 3KQZA 2WYRA 2RFHA 3S9LA 3V7ZA 2CF4A 4A94A 4OC2A 4A38A 3WABA 2JBKA 2HC9A 2G9DA 4NGMA 1FT7A 3CT9A 4OC1A 1CX8A 4PXDA 1F57A 2PJBA 4NGRA 1ZG8A 3IIBA 4P4IA 5LYLA 3FF3A 2PJCA 2AFXA 3IFEA 3KR5A 4MMOA 3D66A 4OIWA 4DYOA 2IMOA 5LRJA 2PJ1A 3D7FA 1ARMA 4ZY2A 1HDUA 3FH4A 1KWMA 4MCRA 3FJUA 4UIAA 3IEHA 3K9TA 3S9NA 4UF4A 2IQ6A 1TKJA 4R6TA 1LANA 3PB4X 1XFOA 2V8GA 4P44A 3PBEA 1TKFA 1EE3P 4G1PA 2PJ7A 1YSJA 5HVGA 1XBUA 5LYDA 2C6CA 4F9VA 1PYTB 4ZYQA 2V77A 3PBBA 2AFMA 4YU9A 1IGBA 4F9UA 1F2OA 3TX8A 4ONWA 2FVGA 2GLFA 3FECA 2ZEOA 3JRUA 1LAPA 5JM6A 1BPMA 3CDXA 5IB9A 1OBRA 3BXMA 2NYQA 3RBUA 2ZENA 1ELMP 2PJ8A 4MHYA 4MHPA 3NH8A 4MCQA 1DTDA 4BD9A 3KHZA 2ANPA 1LFWA 4PXEA 1UWYA 2BCOA 3CPXA 2CTCA 2PJ3A 1BLLE 2VL1A 3BI1A 8CPAA 4MHNA 4P4JA 4IK2A 1BAVA 1IY7A 3D7HA 2PIZA 3WC5A 4UEFA 3GLJA 2QJ8A 3H8GA 1TF8A 1QQ9A 2XEJA 3TC8A 2ZEDA 4IHMA 1ELLP 2IJZA 4WWVA 2WZNA 1RTQA 2AFOA 3WT4A 2JBJA 3NA6A 2F7VA 2BO9A 2CIJA 5DS0A 4NJQA 4KSIA 1Z5RA 5D8NA 2AFUA 3PB9X 3CPAA 5K8NA 4Z65A 2ZEFA 1NSAA 1R3NA 4MCPA 3PB6X 3D4UA 1YW4A 4EMEA 4P4FA 1DE4C 1ZG9A 2PVWA 1VHEA 5LYFA 3KHXA 1Y7EA 4DUKA 4NGTA 4MHZA 2V8VA 3IJ3A 3KZWA 2JEWA 3SJXA 2AFSA 1VHOA 3LMSA 4P4BA 3D7GA 5JGFA 2I3CA 4DJLA 3H8EA 2XEIA 1Q7LA 4EWTA 2XEFA 4OP4A 4O23A 3PEIA 2C1CA 2Q4ZA 2EK8A 4X8IA 2PVVA 2EK9A 3B3WA 2QVPA 2V8HA 3SI2A 1QMUA 3RAMA 2Q51A 3MRUA 2AFWA 4JYWA 3SI0A 2ZOGA 3T8WA 4MRIA 5JH9A 2NSMA 3PFOA 2PJ4A 2O53A 2PE3A 2EWBA 4MCSA 2XEGA 1YW6A 3PFEA 1TKHA 4ZY1A 1CPXA 1YMEA 3VH9A 3WC7A 3FX6A 5LYIA 1FNOA 3VATA 2J9AA 4K3NA 4NGNA 6CPAA 3B7IA 2BOAA 1H8LA 3PB7X 2ZELA 4MXUA 4PQAA 3H8FA 2F8HA 2Q43A 1CPSA 2HB6A 1ARLA 4GM5A 2PJ5A 3ISXA 4X3RA 4OKOA 3DGVA 5CBMA 2C6PA 1CP6A 3IWWA 3L2NA 3FEDA 5CPAA 1VIXA 5HVFA 4NGSA 5HXDA 2ZEHA 1XRYA 3NFZA 1CBXA 1BPNA 3SJEA 4NGPA 4UEEA 3KGQA 3D67A 1F2PA 2PJ2A 4JZ0A 1PCAA 4Q7AA 2POKA 7CPAA 3PRTA 3BHXA 4ZI6A 5K8OA 2RB7A 1HEEA 4UIBA 1JQGA 4F8ZA 2PJ9A 2ZEEA 2GREA 1LOKA 4OC5A 3HLPA 5LRGA 5K8PA 1TXRA 3ISZA 3RZAA 1XMBA 2DEAA 3D7DA 3WC6A 4B6ZA 4PPZA 4X2TA 3QNVA 4OC3A 4NGQA 1TF9A 1CP7A 3B35A 1XJOA 4FWUA 5J1QA 4ZX9A 4FBEA 3HUVA 3NH5A 5THWA 2PCUA 1CG2A 4R7MA 4FUUA 3B3CA 4NJRA 1YLOA 1HDQA 4IAVA 3FMCA 3MN8A 4UEZA 1M4LA 2PJAA 1Z8LA 2GLJA 3KI9A 3SI1A 3KL9A 2OR4A 2PJ6A 4PXBA 4A37A 4ZX8A 5I4MA 2C6GA 1LCPA 2QYVA 4P4EA 3IC1A 4OIDA 4PXCA 1ZG7A 1GYTA 3B3SA 3KASA 3N5FA 4TWEA 3IO1A 1R43A 2O4HA 3V38A 2AFZA 3SJGA 3DLJA 4OMEA 4LQGA 5F09A 2ZEMA 3KQXA 2OOTA 4A39A 2ZEGA 1Y0RA 2PJ0A 3GUXA 3FVLA 2PRQA 3VARA 4CPAA 4P10A 2ZOFA 4TNUA 1VGYA 4W9YA 4YWYA 4P4DA 4AXVA 3S9MA 4OC4A 3B2YA 4R76A 3NH4A 5LRKA 2ZEPA 2ABZA 4WJBA 1AMPA 1LAMA 4P45A 3BI0A 3I1UA 4EFDA 4RUHA 2V8DA 1Y0YA 2GU2A 4FAIA 3SJFA
chains in the Genus database with same CATH superfamily
3D68A 4ZY0A 1KUXA 5A27A 1M4IA 3LWUA 4A95A 4JJXA 5K8MA 1ZB9A 4CRYB 3PB8X 2Z3LA 2NVXI 2WYRA 4A3LI 2RFHA 3I4NI 5J8FA 3V7ZA 2AJ6A 2JBKA 2HC9A 2G9DA 3NDJA 4NCZA 4LUAA 3CCJ1 2PJBA 3I9SA 1ZG8A 2AFXA 2G3AA 3KR5A 3PO3S 2JIMA 5LRJA 3SHPA 3D8PA 4C7IA 1NE9A 3D7FA 2E2II 1RO4A 1PUAA 3FH4A 1YGHA 2YADA 3FJUA 2OU2A 4UF4A 3S6GA 2ZXVA 2W04A 3HOWI 1LANA 3PB4X 3PBEA 5FLXb 3EC4A 2QKDA 4JWPA 5LYDA 4F0XA 1R9TI 1KUYA 4ZYQA 2AFMA 1F2OA 1KD12 4B10A 3TX8A 5G20A 4KOWA 3I551 1IOIA 4FD5A 2FVGA 2GLFA 4CAVA 3TFYA 4UWIA 5KTDA 5EC4A 3CDXA 1KUVA 1ELMP 3G3SA 1MJ9A 3NH8A 1S72Z 3KHZA 2QMLA 1LFWA 4CYOA 3G8WA 4PSXA 1RO5A 2JIPA 3CPXA 3R95A 3BI1A 4CGOA 3FB3A 4P4JA 2FSRA 3F8KA 2D4OA 4AVBA 4FD4A 2V45A 3CCE1 2JA7I 1IY7A 3D7HA 4E32A 1TF8A 3RO0A 4IHMA 4E2AA 2WZNA 1RTQA 2JBJA 2HQYA 3F5BA 2BO9A 3CCJZ 4AG7A 5DS0A 2Q4YA 1Y7RA 4KSIA 3R96A 1VQM1 3CC7Z 3CPAA 3CXSA 1K8A1 2ZEFA 3CPWZ 1NSAA 4MD7A 4EMEA 3CXCZ 3P2FA 3ZJ0A 1SIWA 5LYFA 2CNMA 1Y7EA 3DDDA 2E2HI 4X5KA 2VPZA 1VQ4Z 2ZW6A 3SJXA 2AFSA 2Z3KA 4UA3A 4JXQA 2ZW4A 2GANA 2RT9A 4PV6A 2I3CA 2EGTA 4KOSA 2EBJA 3H8EA 3NE7A 4A3CI 4B14A 5H84A 4XPKA 2JUBA 3I55Z 4O23A 1I21A 2C1CA 4PK2A 1TWGI 5F49A 3B3WA 2V8HA 2P6GA 3SI2A 3R9EA 2NVYI 2E9HA 3MRUA 4CGLA 4IF5A 3T8WA 1X10A 2H85A 1LRZA 5JH9A 3PFOA 1VQK1 2PE3A 3IFUA 3CMA1 4NBAA 4MY0A 4MCSA 4UCMA 1JJ2Y 1DL6A 1Y9KA 3CZXA 3WC7A 3FQMA 3FX6A 5LYIA 3CCEZ 4NGNA 4A33A 4XPDB 1XEBA 3D9XA 4K30A 3PB7X 2VEZA 2ZELA 4L89A 2IV2X 1N8R2 3GTMS 1KRLA 4DNCA 4CGPA 2PJ5A 1VQMZ 2C6PA 4X6AI 3IWWA 3S16I 1KD11 2PRBA 5IT9f 3LACA 4M3SA 4B5PB 1TIQA 1YLEA 5KTAA 3NFZA 3CCM1 3QAHA 2OB0A 2E2JI 3SJEA 2REFA 3S1NI 1BO4A 1ON0A 3R1KA 4Q7AA 3TE4A 3BHXA 4MD9A 4KZTA 1RO2A 4KOXA 4F8ZA 2GREA 1LOKA 4KUAA 3GYAA 2REEA 4XPLA 1QXFA 3ISZA 2DEAA 3JAMb 4MJ8A 4X2TA 4OC3A 5F46A 1ZH1A 4MBUA 3HOZI 3KIFA 1N71A 1XJOA 5J1QA 3HOVI 2AE6A 4ZX9A 5THWA 3S1QI 1CG2A 4A3MI 1VQKZ 1YLOA 4JLYA 5C3EI 1HDQA 4IAVA 3CMAZ 4RI1A 4II9A 3KI9A 3KL9A 1QSRA 1JWQA 2PJ6A 5F47A 1Q812 4ZX8A 4E2YA 2C6GA 4P4EA 1XF8A 4HNWB 2EVNA 3KASA 2B3UA 3CCV1 4TWEA 4E0AA 3V38A 1WW9A 4OMEA 4L8AA 5F09A 3U50C 2ZEGA 2GE3A 1OZPA 4DK1A 1W2BY 3GUXA 4NEXA 1QSMA 3VARA 4P10A 2ZOFA 4TNUA 1CM0A 1VGYA 1NJI2 3TO7A 4P4DA 3S9MA 3RYOA 4RV9A 2K5RA 1JJ2Z 2ZEPA 3CCMZ 4P45A 4NBEA 1Z01A 4NBHA 4RN7A 4Y52I 3H4QA 4FAIA 3SJFA 4M6GA 4A30A 1Z2LA 4M6IA 4H2KA 5D29A 3FBUA 3FEEA 2F4OA 2CTBA 1RO0A 4P6YA 1ZLIA 2KI7B 3KR4A 4CYQA 1M1K1 2CY2A 1P4NA 4B5PA 3DR6A 3S9LA 3BLNA 2RIQA 4OC2A 4AVCA 1YHQ1 4A32A 3M4OI 3KIHA 4NGMA 4AB7A 4OC1A 1CX8A 3EO4A 1M4GA 4P4IA 5LYLA 3FF3A 2PJCA 1YIJ1 3IFEA 3JUWA 4MMOA 2FE7A 4KSFA 4OIWA 2VUMI 3LD2A 2WB1A 1KC82 3QB8A 1Z8WA 3GTLI 4CS0B 1KWMA 4MCRA 2W03A 3S9NA 3T9YA 4R6TA 4HPSA 4E2WA 1YJW1 3CCVZ 4F0YA 4RVGA 2PJ7A 2PR8A 5I0CA 1QYPA 1XBUA 1PYTB 2OH1A 3PBBA 2K3RA 1M4DA 1WZNA 3IWEA 5G22A 3R9FA 4BBSI 2R93I 1VQL1 2R7ZI 4NBFA 5DWMA 4NSQA 1BPMA 5IB9A 1NMTA 4ORFA 1P0HA 2ZENA 1TWAI 3VTNA 1IIDA 4MCQA 3KKWA 4PK3A 2ANPA 3K7AI 4ZBGA 1S7MA 5FVJA 3S6FA 1UWYA 2CTCA 3LODA 2PJ3A 4A3GI 1Q821 2VL1A 1W2BZ 3S6HA 4IK2A 4MFKA 2V8IA 1I6HI 4E2ZA 3J81f 3IF8A 2VI7A 1U6MA 2PIZA 3WC5A 3GLJA 2XEJA 4Y49B 1YHQZ 2ZEDA 4WWVA 1WJ2A 3J81b 1YX0A 2DPSA 2AFOA 3NA6A 3MGDA 4NJQA 1Z5RA 1YIJZ 2AFUA 4QBJA 4GXHA 1R3NA 4B13A 3D4UA 4FD7A 4BXXI 4P4FA 5C4XI 1QSTA 2P0WA 1ZG9A 4A3KI 1KZFA 2QRDB 3KHXA 4DUKA 4BY1I 3CC71 1YJWZ 4IUSA 1VQ91 1Q862 1VHOA 1X0TA 3S17I 3M3YI 4I49A 3TT2A 3TOAA 1VQP1 4CAXA 1CJWA 3BJ7A 4DJLA 1VQ41 2DXQA 2XEIA 1Q7LA 2YU9I 4HKFA 4OP4A 3PEIA 1VQLZ 1K731 2Q4ZA 3S15I 3GIUA 4X8IA 1I50I 1S7KA 3FKII 2CXAA 1QMUA 3SI0A 2ZOGA 3TO9A 2M6NA 2JIQA 4F6AA 3VMIA 1AUGA 3CME1 3T90A 2XEGA 5H86A 1YW6A 1L0CA 1QVGZ 1CPXA 2FL4A 5KTCA 2ZAEB 4UFWA 1XOVA 2BOAA 2R92I 2Z3PA 4MXUA 2F8HA 1CPSA 4NH1C 1ARLA 2VZZA 5IB0A 1ZB8A 2VXKA 3ISXA 2OOYB 4X3RA 5CBMA 2OTJ1 2ZPAA 2HU9A 2Q44A 3L2NA 3FEDA 3FXTA 5CPAA 4B11A 1VQ81 1PU9A 2JIOA 5HXDA 4NGPA 4UEEA 3KGQA 1VQ9Z 1F2PA 1PCAA 2HF1A 2RHBA 5HH1A 3F0AA 4R3LA 4CAEA 2POKA 7CPAA 3HOXI 1VQPZ 2A4NA 1Z03A 4B12A 4NB8A 1I3QI 4BINA 2GTIA 1FDOA 4YFJA 3RZDI 5K8PA 2Z10A 3RZAA 2BEIA 1QF8A 4A3FI 4NGQA 1AA6A 1CP7A 3B35A 2R1IA 4HH4A 1Q7Y2 3EEDA 1GHEA 4FBEA 1YVKA 3OWCA 4PSWA 2PCUA 3CCU1 4FUUA 3CMEZ 2PDOA 4UEZA 2PJAA 4C7HA 1B87A 2HUZA 4NBDA 3IC1A 2ZW7A 3GTKI 2I00A 1S7FA 2WUUA 4LQGA 2DE7A 2WSAA 2ZEMA 2OOTA 4A39A 2OTJZ 3S14I 4S1TA 4UFXA 5JPHA 4YRHA 4A3BI 1VQ8Z 5T6BA 2AKLA 5FLMI 1X3WA 1YQEA 3NH4A 2QEX1 4A2ZA 2FXFA 4NBBA 4WJBA 1ZO0A 1AMPA 2JA6I 2P28A 2PC1A 2BSWA 3DSBA 4KVME 4RUHA 3G4S1 2V8DA 4AG9A 2GU2A 1LQLA 3GB0A 2YNCA 3I561 3BG1B 4A3II 2PIYA 4R8FA 5IT9b 1ZLHA 1P9NA 5IP7I 5A2Qf 2AYDA 4OC0A 5IV0A 5ELYA 1VQN1 3K2KA 3NDIA 5AG7A 3IGRA 5HVHA 5A2Qb 1X12A 3EERA 3TTHA 1YK3A 2JEVA 5E96A 2CF4A 1Z9UA 4A94A 2Z0ZA 3CCUZ 1FT7A 1VHSA 4PXDA 4NGRA 4CL1A 1I1DA 5GCNA 2Q0YA 1VQ61 3D66A 4JD6A 4HNYB 3R9GA 4MFLA 4DYOA 1XIXA 1ARMA 2FIAA 4M6HA 1HDUA 2PQ8A 3IEHA 2LEXA 3K9TA 1TWCI 1TKJA 1Q2CA 5C88A 1XFOA 2V8GA 4P44A 3A9LA 3GTGI 2H5MA 1EE3P 2VZYA 5CNPA 4G1PA 3CXQA 1VQ71 5HVGA 4F9VA 2C6CA 2VPXA 4QB9A 1A2ZA 3CC41 2F4MA 1M902 2K5TA 4KSAA 2DF5A 5AG4A 2NVTI 2Z3NA 2ZW5A 2GTHA 4NB9A 4ONWA 2QEXZ 4MFPA 1NSLA 1YR0A 3S1MI 4CYNA 1LAPA 1IYLA 1OBRA 4NOZA 2NYQA 3BXMA 2PJ8A 4MHYA 3G4SZ 4MHPA 2Y0MA 1IYKA 2CNTA 3TOBA 5C4JI 4BD9A 5A28A 3K9UA 5LL6f 3I56Z 2G2KA 1S5KA 5D1OA 2BCOA 4MI4A 3OW2Y 1VQNZ 2B63I 1BAVA 3HKZA 3GY9A 1MK4A 3D2MA 2G0BA 3H8GA 2B3VA 1QQ9A 4U9YA 4MFZA 1VKCA 4RS2A 4KOUA 1Y9WA 1ELLP 2V3VA 5CM2M 2J8NA 3B8GA 4M85A 4ONUA 1SFOI 1B6BA 4AVAA 5D8NA 4QUSA 1Q2YA 3PB9X 4Z65A 1VQ6Z 4MCPA 2PK7A 3PB6X 4C68A 4U5YA 2EO8A 3FIXA 2PVWA 1VHEA 3I07A 1N8R1 1RQFA 2V8VA 3KZWA 2JNYA 2JEWA 1Z8XA 5EBVA 2LFUA 4BBRI 1MJBA 3JVNA 2J8RA 5AN9F 3GTQI 1VQ51 2I79A 1VQ7Z 3IU2A 3D7GA 2WPWA 4EWCA 3PZJA 3CC4Z 3CXPA 2QREB 3G711 5JGFA 3GKRA 4EWTA 2OTL1 4KLWA 4ZGYB 1QVGY 2X7BA 1VLAA 1M1DA 2EK9A 4UBRA 2VBQA 2QVPA 4QVTA 3LUSA 2Q51A 4JYWA 3MZLB 3S1RI 4CAFA 2JDDA 2Z3OA 3E0KA 3P5JB 2O53A 2WAQA 2EWBA 1Z4RA 2IZ4A 1Y1VI 5D1PA 1YMEA 1YUAA 1Y8CA 2J9AA 4K3NA 6CPAA 3FRMA 2RC4A 2WPXA 2PMZA 1YJ91 1XE4A 4GM5A 1Q811 3H5ZA 3H0GI 4KLVA 4RVFA 5J8CA 1UFHA 4KORA 4RVHA 4OKOA 3J80f 4FD6A 3D6WA 1VIXA 4NGSA 2JR6A 1XRYA 3IR7A 3IX0A 3HOYI 5T67A 5JQ4A 3QAYA 3D67A 3OW2Z 2Q4VA 4OADA 3UY5A 2P3YA 1VQ5Z 2JDCA 3VWEA 1X3ZA 1NJI1 4C2ZA 3PP9A 2IL4A 2DE5A 1HEEA 1TWFI 3G71Z 3CCR1 1N2FA 3SXOA 5LRGA 2OTLZ 1TXRA 3D7DA 3WC6A 1USPB 3J7A4 2JS4A 4XNHB 1QVFZ 2LIYA 5AG6A 1IOFA 3CQZI 3HUVA 3NH5A 4R7MA 3B3CA 4NJRA 5G21A 5FLXf 2J6AA 2V8KA 3MN8A 2M48A 4A93I 3EFAA 2PM9A 3GTPI 4MH4A 1Z8LA 3SI1A 2OR4A 5G1ZA 4GS4A 2IZ3A 4PXBA 1LCPA 1WWZA 2QYVA 3FYNA 4R87A 4CGMA 2O28A 4EVYA 2Q7SA 3IO1A 4C2XA 3T4NB 4H6UA 3MONA 3GTOI 2AFZA 3SJGA 3DLJA 1YJ9Z 4OAEA 2JA5I 4AYBA 1ML8A 4MHDA 3BJ8A 1KC81 3KQXA 4HGZA 4UWJA 2R7HA 1Y0RA 3W91A 2PJ0A 4XPDC 3FVLA 4MONA 1YI21 2PSWA 4E31A 4W9YA 3D3SA 4YWYA 1S7LA 4AXVA 2QA41 3B2YA 1I12A 1VQO1 1RXTA 4KVXA 1MJAA 2ABZA 1LAMA 3BI0A 1WIIA 2NVQI 1NUIA 3RNZA 3F3FC 2B58A 3VMGA 4E2XA 1Y0YA 1IICA 3ESWA 3CCRZ 5BWAB 4E8OA 4R57A 3W6XA 1K83I 3DR8A 1YJN1 3CD61 2ARHA 3PO3I 3B3TA 1AYEA 3FQQA 4BMHA 1PFTA 3HOUI 1XMTA 2B4BA 3B3VA 4NFRA 3KQZA 4CYPA 4CRZB 3CCQ1 2FS5A 2JIRA 4A38A 3WABA 3CCL1 3D2LA 3CT9A 1F57A 1TWHI 2V8JA 3CCS1 3IIBA 2GIVA 3GCFA 1WK4A 4MD8A 2IMOA 4U9ZA 3TE5B 2PJ1A 4ZY2A 3VWDA 3NE8A 4UIAA 4E30A 2B5GB 3EXNA 2IQ6A 1USPA 1KQSY 4XX2A 1TKFA 2FT0A 4Y7NI 4R9MA 1YSJA 4KOYA 4KS9A 2GFQA 1YVOA 5F48A 2V77A 4QTTA 3VMHA 4YU9A 1IGBA 1YI2Z 4F9UA 3C26A 3H3VJ 4QTUA 3MZKB 1Q861 2QA4Z 4B5OA 2RPRA 1YIT1 1VQOZ 4A3EI 5AG5A 3FECA 4BBHA 5D1OB 4E33A 2ZEOA 3JRUA 5JM6A 2BUEA 3P2HA 2YNDA 2KCWA 4JXRA 2R6MA 1BOBA 3RBUA 1M1K2 1TFIA 1K4JA 1Z02A 3D2PA 2VQYA 1DTDA 1V0CA 4KOVA 3DNSA 2Q7BA 4NBCA 4PXEA 3G6E1 1YJNZ 5C82A 3SXNA 3CD6Z 1RLYA 1Q16A 1BLLE 8CPAA 4MHNA 1S7NA 2ODFA 4OLLA 2B4DB 2G3TA 4RVDA 2VPWA 2DPTA 1Z8TA 3CCQZ 4UEFA 2QJ8A 3Q87A 4MFQA 4CGNA 3TC8A 3TO6A 2FCKA 2IJZA 3CCLZ 3W6SA 3PO2I 3WT4A 2F7VA 2CIJA 3CCSZ 5K8NA 4H6ZA 3S2HI 1YW4A 2Y0SA 1L1OC 1DE4C 3IWGA 2Q04A 1K9M2 4YGOA 5EMIA 4NGTA 4MHZA 3JAMf 1M44A 3TDHB 3IJ3A 2J8MA 4RS4A 1SQHA 1IB1E 3LMSA 3CC21 4P4BA 2VPYA 3FNCA 2R8VA 2NAPA 1QSNA 2QR1B 3VB9A 2E7ZA 2JA8I 4Q36A 2XEFA 2BJOA 4UCPA 1YITZ 2EK8A 5T64A 3WR7A 1Z4EA 3S2DI 2PVVA 3RAMA 2B5GA 4C2YA 2AFWA 1Q822 4MFJA 2VUGA 4A3DI 1KQSZ 4MRIA 4J3GA 4NXYA 2NSMA 1J4JA 3ZZIA 2PJ4A 2QLVB 2YNEA 3GTMI 1FDIA 1RNIA 2OZKA 3G6EZ 2YGWA 3PFEA 1TKHA 2Z3MA 4ZY1A 4Q38A 1Q7Y1 3VH9A 5IP9I 3N7ZA 1FNOA 3VATA 2ATRA 3RZOI 3BG0B 2OZHA 3I3GA 3B7IA 1H8LA 4PQAA 3H8FA 2Q43A 1QSOA 2HB6A 4H89A 4DGLA 2NMTA 2FIWA 1Y1VS 3GKQA 3DGVA 1CP6A 4LQ6A 4Y49C 1FY7A 1S60A 4R3KA 5HVFA 2JMOA 3JTKA 2ZEHA 1WCMI 1YREA 4HNXB 1CBXA 1BPNA 3GTJI 2B4DA 2PJ2A 4KUBA 4JZ0A 2RBLA 4CAWA 4BY7I 2QIRA 1QVFY 2KPIA 2VF1A 4NBGA 1K732 3CC2Z 3PRTA 4ZI6A 5K8OA 2RB7A 2HV2A 4UIBA 1JQGA 2PJ9A 2ZEEA 5IX3A 4OC5A 3HLPA 1XMBA 2QRCB 4B6ZA 2P6FA 4PPZA 3QNVA 4UCNA 3TCVA 2OOXB 1TF9A 4KOTA 2EUIA 4DQYB 3I4MI 4FWUA 4XNHC 2Z11A 5C44I 2R98A 4HGYA 1R57A 3FMCA 4A31A 1M4LA 2GLJA 4A37A 5I4MA 4A3JI 3EY5A 1K9M1 4OIDA 4PXCA 4UFVA 4KVOE 3PGPA 3V8IA 1ZG7A 1GYTA 3B3SA 3N5FA 1R43A 2O4HA 2CNSA 5HMNA 4QC6A 5DWNA 2OZUA 1IU8A 1YUKA 2JLMA 4NF1A 1K8A2 2DE6A 2PRQA 2C27A 4CPAA 2F5IA 1NP6A 3IU1A 2P6EA 3QWUA 4OC4A 2OZGA 4R76A 5LRKA 5ISVA 2PR1A 2YNCC 3S6KA 2BL1A 1JWHC 3F3PC 1M901 3I1UA 4MY3A 2D4PA 2QECA 4EFDA 5AGEA 3CPWY 1Y1WI 3J80b 1Q2DA 4LX9A 1S721 3CXCY 1S3ZA
chains in the Genus database with same CATH topology
3D68A 1Z2LA 3ESWA 1LQLA 3CCRZ 4ZY0A 3GB0A 4H2KA 3I561 5D29A 3BG1B 4A3II 3FEEA 3LWUA 1K83I 2PIYA 2F4OA 2CTBA 5IT9b 1ZLHA 1P9NA 1YJN1 5IP7I 4R8FA 1RO0A 5A2Qf 4P6YA 3CD61 4OC0A 5K8MA 3PO3I 1ZB9A 1ZLIA 3PB8X 3B3TA 5ELYA 2KI7B 1VQN1 1AYEA 3KR4A 3FQQA 3K2KA 1PFTA 3NDIA 3HOUI 2NVXI 1M1K1 5HVHA 3B3VA 5A2Qb 4NFRA 3KQZA 2WYRA 4A3LI 3CCQ1 3EERA 2RFHA 3I4NI 3S9LA 3V7ZA 2RIQA 2CF4A 4A94A 4OC2A 4A38A 1YHQ1 3WABA 2JBKA 3M4OI 3CCL1 3KIHA 3CCUZ 2G9DA 3NDJA 1FT7A 2HC9A 4NGMA 3CT9A 4OC1A 1CX8A 4PXDA 1F57A 1TWHI 2V8JA 3CCJ1 2PJBA 3CCS1 4NGRA 1ZG8A 3IIBA 4P4IA 5LYLA 3GCFA 4CL1A 3FF3A 2PJCA 1YIJ1 2AFXA 3IFEA 3KR5A 4MMOA 3PO3S 3D66A 1VQ61 4OIWA 2VUMI 4MD8A 4DYOA 2IMOA 5LRJA 3TE5B 2WB1A 2PJ1A 3D7FA 1ARMA 4ZY2A 1KC82 1HDUA 2E2II 1RO4A 3FH4A 3GTLI 2YADA 1KWMA 4MCRA 2W03A 3FJUA 4UIAA 3IEHA 4E30A 3K9TA 3S9NA 4UF4A 1TWCI 1TKJA 1USPA 2IQ6A 4R6TA 2W04A 1KQSY 3HOWI 4E2WA 1LANA 1YJW1 3CCVZ 3PB4X 1XFOA 2V8GA 4P44A 3PBEA 4XX2A 1TKFA 3GTGI 1EE3P 4RVGA 5FLXb 2QKDA 4Y7NI 4G1PA 2PJ7A 1QYPA 1VQ71 1YSJA 5HVGA 1XBUA 5LYDA 2C6CA 4F9VA 1R9TI 1PYTB 4ZYQA 2V77A 3CC41 4QTTA 3PBBA 2K3RA 2F4MA 1M902 2AFMA 3VMHA 2NVTI 4YU9A 1IGBA 1YI2Z 4F9UA 1F2OA 1KD12 2GTHA 3H3VJ 3TX8A 4QTUA 3MZKB 1Q861 2QA4Z 4NB9A 4BBSI 3I551 2R93I 4ONWA 1VQL1 2FVGA 2QEXZ 2RPRA 1YIT1 2R7ZI 1VQOZ 4A3EI 2GLFA 4NBFA 3FECA 5D1OB 4E33A 3S1MI 2ZEOA 3JRUA 1LAPA 5JM6A 1BPMA 3CDXA 5IB9A 1OBRA 4NOZA 2NYQA 3BXMA 2R6MA 3RBUA 2ZENA 1TWAI 1ELMP 2PJ8A 4MHYA 3VTNA 3G4SZ 4MHPA 3NH8A 1M1K2 5C4JI 1TFIA 4MCQA 1Z02A 1S72Z 1DTDA 4BD9A 3KHZA 2ANPA 5LL6f 3I56Z 3K7AI 1LFWA 2G2KA 4NBCA 1S7MA 4PXEA 3G6E1 1YJNZ 5D1OA 3CD6Z 1UWYA 2BCOA 1RLYA 2CTCA 3CPXA 2PJ3A 4A3GI 1Q821 1BLLE 3OW2Y 1VQNZ 2VL1A 1W2BZ 3BI1A 4MHNA 8CPAA 2B63I 4P4JA 4IK2A 2V8IA 1BAVA 3HKZA 4RVDA 4E2ZA 3J81f 3CCE1 1I6HI 2JA7I 1IY7A 3IF8A 3D7HA 4E32A 2PIZA 3WC5A 3CCQZ 3GLJA 4UEFA 2QJ8A 3H8GA 3Q87A 1QQ9A 1TF8A 2XEJA 3TC8A 1YHQZ 2ZEDA 4IHMA 1ELLP 2IJZA 4WWVA 3CCLZ 2WZNA 3J81b 3PO2I 1RTQA 2AFOA 3WT4A 2JBJA 3NA6A 5CM2M 2F7VA 2BO9A 3CCJZ 2CIJA 3CCSZ 5DS0A 4NJQA 1SFOI 4KSIA 1Z5RA 1YIJZ 5D8NA 1VQM1 2AFUA 3CC7Z 3CPAA 3PB9X 5K8NA 1K8A1 4Z65A 2ZEFA 1VQ6Z 3CPWZ 1NSAA 1R3NA 4MCPA 2PK7A 3S2HI 3D4UA 4MD7A 3PB6X 1YW4A 4BXXI 2Y0SA 1L1OC 3CXCZ 4P4FA 4EMEA 1DE4C 5C4XI 1ZG9A 2PVWA 1VHEA 4A3KI 5LYFA 1K9M2 2QRDB 3I07A 3KHXA 1Y7EA 4DUKA 4BY1I 2E2HI 4NGTA 1N8R1 4MHZA 3JAMf 1RQFA 3TDHB 3CC71 2V8VA 1YJWZ 3IJ3A 3KZWA 2JNYA 2JEWA 1VQ4Z 1VQ91 4RS4A 2LFUA 1Q862 3SJXA 4BBRI 2AFSA 1VHOA 1X0TA 5AN9F 3GTQI 1VQ51 3S17I 3M3YI 1VQ7Z 3CC21 3LMSA 4P4BA 3D7GA 4EWCA 1VQP1 3CC4Z 2QR1B 2RT9A 2QREB 3G711 3VB9A 5JGFA 2I3CA 2EGTA 4DJLA 1VQ41 2JA8I 3H8EA 2XEIA 1Q7LA 2YU9I 4EWTA 2OTL1 2XEFA 4A3CI 2BJOA 2JUBA 4OP4A 3I55Z 4O23A 3PEIA 1VQLZ 1K731 2Q4ZA 1QVGY 1YITZ 3S15I 2C1CA 2EK8A 4X8IA 1TWGI 5T64A 1VLAA 3S2DI 1I50I 2PVVA 3FKII 2EK9A 3B3WA 2QVPA 2V8HA 3SI2A 3LUSA 1QMUA 3RAMA 2Q51A 2NVYI 2E9HA 3MRUA 2AFWA 4JYWA 3MZLB 1Q822 3S1RI 2ZOGA 3SI0A 2VUGA 2M6NA 4A3DI 3T8WA 1KQSZ 4MRIA 2H85A 5JH9A 3VMIA 2NSMA 3PFOA 3CME1 3P5JB 1VQK1 2PJ4A 2O53A 2PE3A 2WAQA 2EWBA 2QLVB 3GTMI 3IFUA 3CMA1 4NBAA 1RNIA 4MCSA 2XEGA 2IZ4A 2OZKA 1Y1VI 3G6EZ 1YW6A 3PFEA 5D1PA 1JJ2Y 1DL6A 1TKHA 4ZY1A 1QVGZ 1CPXA 1YMEA 1YUAA 1Q7Y1 3VH9A 3WC7A 2ZAEB 3FQMA 3FX6A 5IP9I 5LYIA 1FNOA 3VATA 2J9AA 4K3NA 3RZOI 3BG0B 3CCEZ 4NGNA 6CPAA 3B7IA 2BOAA 3D9XA 1H8LA 2R92I 3PB7X 2ZELA 4MXUA 4PQAA 3H8FA 2F8HA 2PMZA 2Q43A 1CPSA 4NH1C 2HB6A 1YJ91 4DGLA 1ARLA 4GM5A 1Q811 1N8R2 3GTMS 1KRLA 3H0GI 1ZB8A 4RVFA 2PJ5A 3ISXA 2OOYB 1Y1VS 3GKQA 4X3RA 4RVHA 1VQMZ 3DGVA 4OKOA 5CBMA 3J80f 2OTJ1 2HU9A 2C6PA 1CP6A 4X6AI 3IWWA 3L2NA 3FEDA 3D6WA 5CPAA 3S16I 1VQ81 1KD11 1VIXA 5HVFA 2JMOA 5IT9f 4NGSA 5HXDA 2JR6A 2ZEHA 1WCMI 1XRYA 3IX0A 3NFZA 3HOYI 1CBXA 5T67A 3CCM1 1BPNA 3GTJI 2E2JI 4NGPA 3SJEA 4UEEA 3KGQA 1VQ9Z 1F2PA 3OW2Z 2PJ2A 3D67A 4JZ0A 3S1NI 1PCAA 2HF1A 2RHBA 2RBLA 4BY7I 2P3YA 4Q7AA 1VQ5Z 1QVFY 2KPIA 2VF1A 4NBGA 1K732 1X3ZA 2POKA 3CC2Z 1NJI1 7CPAA 3PRTA 3BHXA 4MD9A 4ZI6A 2RB7A 5K8OA 2DE5A 1HEEA 1RO2A 1TWFI 3HOXI 1VQPZ 4UIBA 1JQGA 4F8ZA 1Z03A 2PJ9A 2ZEEA 3G71Z 3CCR1 4NB8A 2GREA 1LOKA 1I3QI 1N2FA 4OC5A 3HLPA 2GTIA 5LRGA 3RZDI 2OTLZ 5K8PA 1TXRA 3ISZA 3RZAA 1XMBA 2QRCB 2DEAA 3D7DA 3JAMb 3WC6A 4B6ZA 4PPZA 1QF8A 4A3FI 4X2TA 1USPB 3QNVA 4OC3A 1ZH1A 4NGQA 3HOZI 2OOXB 3J7A4 1TF9A 3KIFA 1CP7A 3B35A 2JS4A 1XJOA 1QVFZ 2LIYA 4HH4A 4DQYB 3I4MI 4FWUA 5J1QA 3HOVI 1Q7Y2 3CQZI 3EEDA 4ZX9A 4FBEA 3HUVA 3NH5A 5C44I 5THWA 3S1QI 2PCUA 1CG2A 3CCU1 4FUUA 4R7MA 3B3CA 4NJRA 4A3MI 3CMEZ 4HGYA 1VQKZ 1YLOA 5FLXf 5C3EI 2J6AA 1HDQA 2V8KA 4IAVA 3FMCA 3MN8A 2M48A 3CMAZ 4A93I 4UEZA 1M4LA 2PM9A 3GTPI 2PJAA 4MH4A 1Z8LA 2GLJA 3KI9A 3SI1A 3KL9A 2OR4A 2PJ6A 4PXBA 2IZ3A 4A37A 1Q812 4ZX8A 4E2YA 2C6GA 1LCPA 2QYVA 5I4MA 4A3JI 4P4EA 4NBDA 3IC1A 1K9M1 4OIDA 4PXCA 1ZG7A 1GYTA 3B3SA 3KASA 3N5FA 4TWEA 3CCV1 3IO1A 1R43A 3T4NB 3GTKI 2O4HA 3V38A 1WW9A 3MONA 3GTOI 2AFZA 3SJGA 3DLJA 1YJ9Z 4OMEA 4LQGA 2JA5I 5F09A 4AYBA 2DE7A 1ML8A 3U50C 2ZEMA 1KC81 3KQXA 2OOTA 4A39A 1YUKA 4HGZA 2ZEGA 1Y0RA 1K8A2 2PJ0A 4DK1A 2DE6A 1W2BY 3GUXA 2OTJZ 3FVLA 3S14I 4S1TA 2PRQA 3VARA 4CPAA 4MONA 1YI21 1NP6A 4E31A 4P10A 2ZOFA 4TNUA 4A3BI 1VGYA 4W9YA 3QWUA 5T6BA 1VQ8Z 1NJI2 4YWYA 2AKLA 4P4DA 2QA41 4AXVA 5FLMI 3S9MA 4OC4A 1X3WA 3B2YA 4RV9A 2K5RA 4R76A 3NH4A 2QEX1 5LRKA 1VQO1 4NBBA 1JJ2Z 2ZEPA 2ABZA 4WJBA 3CCMZ 1AMPA 1LAMA 4P45A 3BI0A 2JA6I 1JWHC 1WIIA 3F3PC 1M901 2NVQI 2P28A 1NUIA 4NBEA 3F3FC 3I1UA 1Z01A 3VMGA 4NBHA 4EFDA 4RUHA 3G4S1 4E2XA 2V8DA 3CPWY 1Y1WI 3J80b 1Y0YA 4Y52I 2GU2A 4FAIA 3SJFA 1S721 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D68 A;  1Z2L A;  4ZY0 A;  3GB0 A;  4H2K A;  5D29 A;  3FEE A;  3LWU A;  2PIY A;  4R8F A;  2CTB A;  1ZLH A;  4P6Y A;  4OC0 A;  5K8M A;  1ZLI A;  3PB8 X;  3B3T A;  5ELY A;  1AYE A;  3KR4 A;  3K2K A;  5HVH A;  3B3V A;  4NFR A;  3KQZ A;  2WYR A;  2RFH A;  3S9L A;  3V7Z A;  2CF4 A;  4A94 A;  4OC2 A;  4A38 A;  3WAB A;  2JBK A;  2HC9 A;  2G9D A;  4NGM A;  1FT7 A;  3CT9 A;  4OC1 A;  1CX8 A;  4PXD A;  1F57 A;  2PJB A;  4NGR A;  1ZG8 A;  3IIB A;  4P4I A;  5LYL A;  3FF3 A;  2PJC A;  2AFX A;  3IFE A;  3KR5 A;  4MMO A;  3D66 A;  4OIW A;  4DYO A;  2IMO A;  5LRJ A;  2PJ1 A;  3D7F A;  1ARM A;  4ZY2 A;  1HDU A;  3FH4 A;  1KWM A;  4MCR A;  3FJU A;  4UIA A;  3IEH A;  3K9T A;  3S9N A;  4UF4 A;  2IQ6 A;  1TKJ A;  4R6T A;  1LAN A;  3PB4 X;  1XFO A;  2V8G A;  4P44 A;  3PBE A;  1TKF A;  1EE3 P;  4G1P A;  2PJ7 A;  1YSJ A;  5HVG A;  1XBU A;  5LYD A;  2C6C A;  4F9V A;  1PYT B;  4ZYQ A;  2V77 A;  3PBB A;  2AFM A;  4YU9 A;  1IGB A;  4F9U A;  1F2O A;  3TX8 A;  4ONW A;  2FVG A;  2GLF A;  3FEC A;  2ZEO A;  3JRU A;  1LAP A;  5JM6 A;  1BPM A;  3CDX A;  5IB9 A;  1OBR A;  3BXM A;  2NYQ A;  3RBU A;  2ZEN A;  1ELM P;  2PJ8 A;  4MHY A;  4MHP A;  3NH8 A;  4MCQ A;  1DTD A;  4BD9 A;  3KHZ A;  2ANP A;  1LFW A;  4PXE A;  1UWY A;  2BCO A;  3CPX A;  2CTC A;  2PJ3 A;  1BLL E;  2VL1 A;  3BI1 A;  8CPA A;  4MHN A;  4P4J A;  4IK2 A;  1BAV A;  1IY7 A;  3D7H A;  2PIZ A;  3WC5 A;  4UEF A;  3GLJ A;  2QJ8 A;  3H8G A;  1TF8 A;  1QQ9 A;  2XEJ A;  3TC8 A;  2ZED A;  4IHM A;  1ELL P;  2IJZ A;  4WWV A;  2WZN A;  1RTQ A;  2AFO A;  3WT4 A;  2JBJ A;  3NA6 A;  2F7V A;  2BO9 A;  2CIJ A;  5DS0 A;  4NJQ A;  4KSI A;  1Z5R A;  5D8N A;  2AFU A;  3PB9 X;  3CPA A;  5K8N A;  4Z65 A;  2ZEF A;  1NSA A;  1R3N A;  4MCP A;  3PB6 X;  3D4U A;  1YW4 A;  4EME A;  4P4F A;  1DE4 C;  1ZG9 A;  2PVW A;  1VHE A;  5LYF A;  3KHX A;  1Y7E A;  4DUK A;  4NGT A;  4MHZ A;  2V8V A;  3IJ3 A;  3KZW A;  2JEW A;  3SJX A;  2AFS A;  1VHO A;  3LMS A;  4P4B A;  3D7G A;  5JGF A;  2I3C A;  4DJL A;  3H8E A;  2XEI A;  1Q7L A;  4EWT A;  2XEF A;  4OP4 A;  4O23 A;  3PEI A;  2C1C A;  2Q4Z A;  2EK8 A;  4X8I A;  2PVV A;  2EK9 A;  3B3W A;  2QVP A;  2V8H A;  3SI2 A;  1QMU A;  3RAM A;  2Q51 A;  3MRU A;  2AFW A;  4JYW A;  3SI0 A;  2ZOG A;  3T8W A;  4MRI A;  5JH9 A;  2NSM A;  3PFO A;  2PJ4 A;  2O53 A;  2PE3 A;  2EWB A;  4MCS A;  2XEG A;  1YW6 A;  3PFE A;  1TKH A;  4ZY1 A;  1CPX A;  1YME A;  3VH9 A;  3WC7 A;  3FX6 A;  5LYI A;  1FNO A;  3VAT A;  2J9A A;  4K3N A;  4NGN A;  6CPA A;  3B7I A;  2BOA A;  1H8L A;  3PB7 X;  2ZEL A;  4MXU A;  4PQA A;  3H8F A;  2F8H A;  2Q43 A;  1CPS A;  2HB6 A;  1ARL A;  4GM5 A;  2PJ5 A;  3ISX A;  4X3R A;  4OKO A;  3DGV A;  5CBM A;  2C6P A;  1CP6 A;  3IWW A;  3L2N A;  3FED A;  5CPA A;  1VIX A;  5HVF A;  4NGS A;  5HXD A;  2ZEH A;  1XRY A;  3NFZ A;  1CBX A;  1BPN A;  3SJE A;  4NGP A;  4UEE A;  3KGQ A;  3D67 A;  1F2P A;  2PJ2 A;  4JZ0 A;  1PCA A;  4Q7A A;  2POK A;  7CPA A;  3PRT A;  3BHX A;  4ZI6 A;  5K8O A;  2RB7 A;  1HEE A;  4UIB A;  1JQG A;  4F8Z A;  2PJ9 A;  2ZEE A;  2GRE A;  1LOK A;  4OC5 A;  3HLP A;  5LRG A;  5K8P A;  1TXR A;  3ISZ A;  3RZA A;  1XMB A;  2DEA A;  3D7D A;  3WC6 A;  4B6Z A;  4PPZ A;  4X2T A;  3QNV A;  4OC3 A;  4NGQ A;  1TF9 A;  1CP7 A;  3B35 A;  1XJO A;  4FWU A;  5J1Q A;  4ZX9 A;  4FBE A;  3HUV A;  3NH5 A;  5THW A;  2PCU A;  1CG2 A;  4R7M A;  4FUU A;  3B3C A;  4NJR A;  1YLO A;  1HDQ A;  4IAV A;  3FMC A;  3MN8 A;  4UEZ A;  1M4L A;  2PJA A;  1Z8L A;  2GLJ A;  3KI9 A;  3SI1 A;  3KL9 A;  2OR4 A;  2PJ6 A;  4PXB A;  4A37 A;  4ZX8 A;  5I4M A;  2C6G A;  1LCP A;  2QYV A;  4P4E A;  3IC1 A;  4OID A;  4PXC A;  1ZG7 A;  1GYT A;  3B3S A;  3KAS A;  3N5F A;  4TWE A;  3IO1 A;  1R43 A;  2O4H A;  3V38 A;  2AFZ A;  3SJG A;  3DLJ A;  4OME A;  4LQG A;  5F09 A;  2ZEM A;  3KQX A;  2OOT A;  4A39 A;  2ZEG A;  1Y0R A;  2PJ0 A;  3GUX A;  3FVL A;  2PRQ A;  3VAR A;  4CPA A;  4P10 A;  2ZOF A;  4TNU A;  1VGY A;  4W9Y A;  4YWY A;  4P4D A;  4AXV A;  3S9M A;  4OC4 A;  3B2Y A;  4R76 A;  3NH4 A;  5LRK A;  2ZEP A;  2ABZ A;  4WJB A;  1AMP A;  1LAM A;  4P45 A;  3BI0 A;  3I1U A;  4EFD A;  4RUH A;  2V8D A;  1Y0Y A;  2GU2 A;  4FAI A;  3SJF A; 
#chains in the Genus database with same CATH topology
 3D68 A;  4ZY0 A;  1KUX A;  5A27 A;  1M4I A;  3LWU A;  4A95 A;  4JJX A;  5K8M A;  1ZB9 A;  4CRY B;  3PB8 X;  2Z3L A;  2NVX I;  2WYR A;  4A3L I;  2RFH A;  3I4N I;  5J8F A;  3V7Z A;  2AJ6 A;  2JBK A;  2HC9 A;  2G9D A;  3NDJ A;  4NCZ A;  4LUA A;  3CCJ 1;  2PJB A;  3I9S A;  1ZG8 A;  2AFX A;  2G3A A;  3KR5 A;  3PO3 S;  2JIM A;  5LRJ A;  3SHP A;  3D8P A;  4C7I A;  1NE9 A;  3D7F A;  2E2I I;  1RO4 A;  1PUA A;  3FH4 A;  1YGH A;  2YAD A;  3FJU A;  2OU2 A;  4UF4 A;  3S6G A;  2ZXV A;  2W04 A;  3HOW I;  1LAN A;  3PB4 X;  3PBE A;  5FLX b;  3EC4 A;  2QKD A;  4JWP A;  5LYD A;  4F0X A;  1R9T I;  1KUY A;  4ZYQ A;  2AFM A;  1F2O A;  1KD1 2;  4B10 A;  3TX8 A;  5G20 A;  4KOW A;  3I55 1;  1IOI A;  4FD5 A;  2FVG A;  2GLF A;  4CAV A;  3TFY A;  4UWI A;  5KTD A;  5EC4 A;  3CDX A;  1KUV A;  1ELM P;  3G3S A;  1MJ9 A;  3NH8 A;  1S72 Z;  3KHZ A;  2QML A;  1LFW A;  4CYO A;  3G8W A;  4PSX A;  1RO5 A;  2JIP A;  3CPX A;  3R95 A;  3BI1 A;  4CGO A;  3FB3 A;  4P4J A;  2FSR A;  3F8K A;  2D4O A;  4AVB A;  4FD4 A;  2V45 A;  3CCE 1;  2JA7 I;  1IY7 A;  3D7H A;  4E32 A;  1TF8 A;  3RO0 A;  4IHM A;  4E2A A;  2WZN A;  1RTQ A;  2JBJ A;  2HQY A;  3F5B A;  2BO9 A;  3CCJ Z;  4AG7 A;  5DS0 A;  2Q4Y A;  1Y7R A;  4KSI A;  3R96 A;  1VQM 1;  3CC7 Z;  3CPA A;  3CXS A;  1K8A 1;  2ZEF A;  3CPW Z;  1NSA A;  4MD7 A;  4EME A;  3CXC Z;  3P2F A;  3ZJ0 A;  1SIW A;  5LYF A;  2CNM A;  1Y7E A;  3DDD A;  2E2H I;  4X5K A;  2VPZ A;  1VQ4 Z;  2ZW6 A;  3SJX A;  2AFS A;  2Z3K A;  4UA3 A;  4JXQ A;  2ZW4 A;  2GAN A;  2RT9 A;  4PV6 A;  2I3C A;  2EGT A;  4KOS A;  2EBJ A;  3H8E A;  3NE7 A;  4A3C I;  4B14 A;  5H84 A;  4XPK A;  2JUB A;  3I55 Z;  4O23 A;  1I21 A;  2C1C A;  4PK2 A;  1TWG I;  5F49 A;  3B3W A;  2V8H A;  2P6G A;  3SI2 A;  3R9E A;  2NVY I;  2E9H A;  3MRU A;  4CGL A;  4IF5 A;  3T8W A;  1X10 A;  2H85 A;  1LRZ A;  5JH9 A;  3PFO A;  1VQK 1;  2PE3 A;  3IFU A;  3CMA 1;  4NBA A;  4MY0 A;  4MCS A;  4UCM A;  1JJ2 Y;  1DL6 A;  1Y9K A;  3CZX A;  3WC7 A;  3FQM A;  3FX6 A;  5LYI A;  3CCE Z;  4NGN A;  4A33 A;  4XPD B;  1XEB A;  3D9X A;  4K30 A;  3PB7 X;  2VEZ A;  2ZEL A;  4L89 A;  2IV2 X;  1N8R 2;  3GTM S;  1KRL A;  4DNC A;  4CGP A;  2PJ5 A;  1VQM Z;  2C6P A;  4X6A I;  3IWW A;  3S16 I;  1KD1 1;  2PRB A;  5IT9 f;  3LAC A;  4M3S A;  4B5P B;  1TIQ A;  1YLE A;  5KTA A;  3NFZ A;  3CCM 1;  3QAH A;  2OB0 A;  2E2J I;  3SJE A;  2REF A;  3S1N I;  1BO4 A;  1ON0 A;  3R1K A;  4Q7A A;  3TE4 A;  3BHX A;  4MD9 A;  4KZT A;  1RO2 A;  4KOX A;  4F8Z A;  2GRE A;  1LOK A;  4KUA A;  3GYA A;  2REE A;  4XPL A;  1QXF A;  3ISZ A;  2DEA A;  3JAM b;  4MJ8 A;  4X2T A;  4OC3 A;  5F46 A;  1ZH1 A;  4MBU A;  3HOZ I;  3KIF A;  1N71 A;  1XJO A;  5J1Q A;  3HOV I;  2AE6 A;  4ZX9 A;  5THW A;  3S1Q I;  1CG2 A;  4A3M I;  1VQK Z;  1YLO A;  4JLY A;  5C3E I;  1HDQ A;  4IAV A;  3CMA Z;  4RI1 A;  4II9 A;  3KI9 A;  3KL9 A;  1QSR A;  1JWQ A;  2PJ6 A;  5F47 A;  1Q81 2;  4ZX8 A;  4E2Y A;  2C6G A;  4P4E A;  1XF8 A;  4HNW B;  2EVN A;  3KAS A;  2B3U A;  3CCV 1;  4TWE A;  4E0A A;  3V38 A;  1WW9 A;  4OME A;  4L8A A;  5F09 A;  3U50 C;  2ZEG A;  2GE3 A;  1OZP A;  4DK1 A;  1W2B Y;  3GUX A;  4NEX A;  1QSM A;  3VAR A;  4P10 A;  2ZOF A;  4TNU A;  1CM0 A;  1VGY A;  1NJI 2;  3TO7 A;  4P4D A;  3S9M A;  3RYO A;  4RV9 A;  2K5R A;  1JJ2 Z;  2ZEP A;  3CCM Z;  4P45 A;  4NBE A;  1Z01 A;  4NBH A;  4RN7 A;  4Y52 I;  3H4Q A;  4FAI A;  3SJF A;  4M6G A;  4A30 A;  1Z2L A;  4M6I A;  4H2K A;  5D29 A;  3FBU A;  3FEE A;  2F4O A;  2CTB A;  1RO0 A;  4P6Y A;  1ZLI A;  2KI7 B;  3KR4 A;  4CYQ A;  1M1K 1;  2CY2 A;  1P4N A;  4B5P A;  3DR6 A;  3S9L A;  3BLN A;  2RIQ A;  4OC2 A;  4AVC A;  1YHQ 1;  4A32 A;  3M4O I;  3KIH A;  4NGM A;  4AB7 A;  4OC1 A;  1CX8 A;  3EO4 A;  1M4G A;  4P4I A;  5LYL A;  3FF3 A;  2PJC A;  1YIJ 1;  3IFE A;  3JUW A;  4MMO A;  2FE7 A;  4KSF A;  4OIW A;  2VUM I;  3LD2 A;  2WB1 A;  1KC8 2;  3QB8 A;  1Z8W A;  3GTL I;  4CS0 B;  1KWM A;  4MCR A;  2W03 A;  3S9N A;  3T9Y A;  4R6T A;  4HPS A;  4E2W A;  1YJW 1;  3CCV Z;  4F0Y A;  4RVG A;  2PJ7 A;  2PR8 A;  5I0C A;  1QYP A;  1XBU A;  1PYT B;  2OH1 A;  3PBB A;  2K3R A;  1M4D A;  1WZN A;  3IWE A;  5G22 A;  3R9F A;  4BBS I;  2R93 I;  1VQL 1;  2R7Z I;  4NBF A;  5DWM A;  4NSQ A;  1BPM A;  5IB9 A;  1NMT A;  4ORF A;  1P0H A;  2ZEN A;  1TWA I;  3VTN A;  1IID A;  4MCQ A;  3KKW A;  4PK3 A;  2ANP A;  3K7A I;  4ZBG A;  1S7M A;  5FVJ A;  3S6F A;  1UWY A;  2CTC A;  3LOD A;  2PJ3 A;  4A3G I;  1Q82 1;  2VL1 A;  1W2B Z;  3S6H A;  4IK2 A;  4MFK A;  2V8I A;  1I6H I;  4E2Z A;  3J81 f;  3IF8 A;  2VI7 A;  1U6M A;  2PIZ A;  3WC5 A;  3GLJ A;  2XEJ A;  4Y49 B;  1YHQ Z;  2ZED A;  4WWV A;  1WJ2 A;  3J81 b;  1YX0 A;  2DPS A;  2AFO A;  3NA6 A;  3MGD A;  4NJQ A;  1Z5R A;  1YIJ Z;  2AFU A;  4QBJ A;  4GXH A;  1R3N A;  4B13 A;  3D4U A;  4FD7 A;  4BXX I;  4P4F A;  5C4X I;  1QST A;  2P0W A;  1ZG9 A;  4A3K I;  1KZF A;  2QRD B;  3KHX A;  4DUK A;  4BY1 I;  3CC7 1;  1YJW Z;  4IUS A;  1VQ9 1;  1Q86 2;  1VHO A;  1X0T A;  3S17 I;  3M3Y I;  4I49 A;  3TT2 A;  3TOA A;  1VQP 1;  4CAX A;  1CJW A;  3BJ7 A;  4DJL A;  1VQ4 1;  2DXQ A;  2XEI A;  1Q7L A;  2YU9 I;  4HKF A;  4OP4 A;  3PEI A;  1VQL Z;  1K73 1;  2Q4Z A;  3S15 I;  3GIU A;  4X8I A;  1I50 I;  1S7K A;  3FKI I;  2CXA A;  1QMU A;  3SI0 A;  2ZOG A;  3TO9 A;  2M6N A;  2JIQ A;  4F6A A;  3VMI A;  1AUG A;  3CME 1;  3T90 A;  2XEG A;  5H86 A;  1YW6 A;  1L0C A;  1QVG Z;  1CPX A;  2FL4 A;  5KTC A;  2ZAE B;  4UFW A;  1XOV A;  2BOA A;  2R92 I;  2Z3P A;  4MXU A;  2F8H A;  1CPS A;  4NH1 C;  1ARL A;  2VZZ A;  5IB0 A;  1ZB8 A;  2VXK A;  3ISX A;  2OOY B;  4X3R A;  5CBM A;  2OTJ 1;  2ZPA A;  2HU9 A;  2Q44 A;  3L2N A;  3FED A;  3FXT A;  5CPA A;  4B11 A;  1VQ8 1;  1PU9 A;  2JIO A;  5HXD A;  4NGP A;  4UEE A;  3KGQ A;  1VQ9 Z;  1F2P A;  1PCA A;  2HF1 A;  2RHB A;  5HH1 A;  3F0A A;  4R3L A;  4CAE A;  2POK A;  7CPA A;  3HOX I;  1VQP Z;  2A4N A;  1Z03 A;  4B12 A;  4NB8 A;  1I3Q I;  4BIN A;  2GTI A;  1FDO A;  4YFJ A;  3RZD I;  5K8P A;  2Z10 A;  3RZA A;  2BEI A;  1QF8 A;  4A3F I;  4NGQ A;  1AA6 A;  1CP7 A;  3B35 A;  2R1I A;  4HH4 A;  1Q7Y 2;  3EED A;  1GHE A;  4FBE A;  1YVK A;  3OWC A;  4PSW A;  2PCU A;  3CCU 1;  4FUU A;  3CME Z;  2PDO A;  4UEZ A;  2PJA A;  4C7H A;  1B87 A;  2HUZ A;  4NBD A;  3IC1 A;  2ZW7 A;  3GTK I;  2I00 A;  1S7F A;  2WUU A;  4LQG A;  2DE7 A;  2WSA A;  2ZEM A;  2OOT A;  4A39 A;  2OTJ Z;  3S14 I;  4S1T A;  4UFX A;  5JPH A;  4YRH A;  4A3B I;  1VQ8 Z;  5T6B A;  2AKL A;  5FLM I;  1X3W A;  1YQE A;  3NH4 A;  2QEX 1;  4A2Z A;  2FXF A;  4NBB A;  4WJB A;  1ZO0 A;  1AMP A;  2JA6 I;  2P28 A;  2PC1 A;  2BSW A;  3DSB A;  4KVM E;  4RUH A;  3G4S 1;  2V8D A;  4AG9 A;  2GU2 A;  1LQL A;  3GB0 A;  2YNC A;  3I56 1;  3BG1 B;  4A3I I;  2PIY A;  4R8F A;  5IT9 b;  1ZLH A;  1P9N A;  5IP7 I;  5A2Q f;  2AYD A;  4OC0 A;  5IV0 A;  5ELY A;  1VQN 1;  3K2K A;  3NDI A;  5AG7 A;  3IGR A;  5HVH A;  5A2Q b;  1X12 A;  3EER A;  3TTH A;  1YK3 A;  2JEV A;  5E96 A;  2CF4 A;  1Z9U A;  4A94 A;  2Z0Z A;  3CCU Z;  1FT7 A;  1VHS A;  4PXD A;  4NGR A;  4CL1 A;  1I1D A;  5GCN A;  2Q0Y A;  1VQ6 1;  3D66 A;  4JD6 A;  4HNY B;  3R9G A;  4MFL A;  4DYO A;  1XIX A;  1ARM A;  2FIA A;  4M6H A;  1HDU A;  2PQ8 A;  3IEH A;  2LEX A;  3K9T A;  1TWC I;  1TKJ A;  1Q2C A;  5C88 A;  1XFO A;  2V8G A;  4P44 A;  3A9L A;  3GTG I;  2H5M A;  1EE3 P;  2VZY A;  5CNP A;  4G1P A;  3CXQ A;  1VQ7 1;  5HVG A;  4F9V A;  2C6C A;  2VPX A;  4QB9 A;  1A2Z A;  3CC4 1;  2F4M A;  1M90 2;  2K5T A;  4KSA A;  2DF5 A;  5AG4 A;  2NVT I;  2Z3N A;  2ZW5 A;  2GTH A;  4NB9 A;  4ONW A;  2QEX Z;  4MFP A;  1NSL A;  1YR0 A;  3S1M I;  4CYN A;  1LAP A;  1IYL A;  1OBR A;  4NOZ A;  2NYQ A;  3BXM A;  2PJ8 A;  4MHY A;  3G4S Z;  4MHP A;  2Y0M A;  1IYK A;  2CNT A;  3TOB A;  5C4J I;  4BD9 A;  5A28 A;  3K9U A;  5LL6 f;  3I56 Z;  2G2K A;  1S5K A;  5D1O A;  2BCO A;  4MI4 A;  3OW2 Y;  1VQN Z;  2B63 I;  1BAV A;  3HKZ A;  3GY9 A;  1MK4 A;  3D2M A;  2G0B A;  3H8G A;  2B3V A;  1QQ9 A;  4U9Y A;  4MFZ A;  1VKC A;  4RS2 A;  4KOU A;  1Y9W A;  1ELL P;  2V3V A;  5CM2 M;  2J8N A;  3B8G A;  4M85 A;  4ONU A;  1SFO I;  1B6B A;  4AVA A;  5D8N A;  4QUS A;  1Q2Y A;  3PB9 X;  4Z65 A;  1VQ6 Z;  4MCP A;  2PK7 A;  3PB6 X;  4C68 A;  4U5Y A;  2EO8 A;  3FIX A;  2PVW A;  1VHE A;  3I07 A;  1N8R 1;  1RQF A;  2V8V A;  3KZW A;  2JNY A;  2JEW A;  1Z8X A;  5EBV A;  2LFU A;  4BBR I;  1MJB A;  3JVN A;  2J8R A;  5AN9 F;  3GTQ I;  1VQ5 1;  2I79 A;  1VQ7 Z;  3IU2 A;  3D7G A;  2WPW A;  4EWC A;  3PZJ A;  3CC4 Z;  3CXP A;  2QRE B;  3G71 1;  5JGF A;  3GKR A;  4EWT A;  2OTL 1;  4KLW A;  4ZGY B;  1QVG Y;  2X7B A;  1VLA A;  1M1D A;  2EK9 A;  4UBR A;  2VBQ A;  2QVP A;  4QVT A;  3LUS A;  2Q51 A;  4JYW A;  3MZL B;  3S1R I;  4CAF A;  2JDD A;  2Z3O A;  3E0K A;  3P5J B;  2O53 A;  2WAQ A;  2EWB A;  1Z4R A;  2IZ4 A;  1Y1V I;  5D1P A;  1YME A;  1YUA A;  1Y8C A;  2J9A A;  4K3N A;  6CPA A;  3FRM A;  2RC4 A;  2WPX A;  2PMZ A;  1YJ9 1;  1XE4 A;  4GM5 A;  1Q81 1;  3H5Z A;  3H0G I;  4KLV A;  4RVF A;  5J8C A;  1UFH A;  4KOR A;  4RVH A;  4OKO A;  3J80 f;  4FD6 A;  3D6W A;  1VIX A;  4NGS A;  2JR6 A;  1XRY A;  3IR7 A;  3IX0 A;  3HOY I;  5T67 A;  5JQ4 A;  3QAY A;  3D67 A;  3OW2 Z;  2Q4V A;  4OAD A;  3UY5 A;  2P3Y A;  1VQ5 Z;  2JDC A;  3VWE A;  1X3Z A;  1NJI 1;  4C2Z A;  3PP9 A;  2IL4 A;  2DE5 A;  1HEE A;  1TWF I;  3G71 Z;  3CCR 1;  1N2F A;  3SXO A;  5LRG A;  2OTL Z;  1TXR A;  3D7D A;  3WC6 A;  1USP B;  3J7A 4;  2JS4 A;  4XNH B;  1QVF Z;  2LIY A;  5AG6 A;  1IOF A;  3CQZ I;  3HUV A;  3NH5 A;  4R7M A;  3B3C A;  4NJR A;  5G21 A;  5FLX f;  2J6A A;  2V8K A;  3MN8 A;  2M48 A;  4A93 I;  3EFA A;  2PM9 A;  3GTP I;  4MH4 A;  1Z8L A;  3SI1 A;  2OR4 A;  5G1Z A;  4GS4 A;  2IZ3 A;  4PXB A;  1LCP A;  1WWZ A;  2QYV A;  3FYN A;  4R87 A;  4CGM A;  2O28 A;  4EVY A;  2Q7S A;  3IO1 A;  4C2X A;  3T4N B;  4H6U A;  3MON A;  3GTO I;  2AFZ A;  3SJG A;  3DLJ A;  1YJ9 Z;  4OAE A;  2JA5 I;  4AYB A;  1ML8 A;  4MHD A;  3BJ8 A;  1KC8 1;  3KQX A;  4HGZ A;  4UWJ A;  2R7H A;  1Y0R A;  3W91 A;  2PJ0 A;  4XPD C;  3FVL A;  4MON A;  1YI2 1;  2PSW A;  4E31 A;  4W9Y A;  3D3S A;  4YWY A;  1S7L A;  4AXV A;  2QA4 1;  3B2Y A;  1I12 A;  1VQO 1;  1RXT A;  4KVX A;  1MJA A;  2ABZ A;  1LAM A;  3BI0 A;  1WII A;  2NVQ I;  1NUI A;  3RNZ A;  3F3F C;  2B58 A;  3VMG A;  4E2X A;  1Y0Y A;  1IIC A;  3ESW A;  3CCR Z;  5BWA B;  4E8O A;  4R57 A;  3W6X A;  1K83 I;  3DR8 A;  1YJN 1;  3CD6 1;  2ARH A;  3PO3 I;  3B3T A;  1AYE A;  3FQQ A;  4BMH A;  1PFT A;  3HOU I;  1XMT A;  2B4B A;  3B3V A;  4NFR A;  3KQZ A;  4CYP A;  4CRZ B;  3CCQ 1;  2FS5 A;  2JIR A;  4A38 A;  3WAB A;  3CCL 1;  3D2L A;  3CT9 A;  1F57 A;  1TWH I;  2V8J A;  3CCS 1;  3IIB A;  2GIV A;  3GCF A;  1WK4 A;  4MD8 A;  2IMO A;  4U9Z A;  3TE5 B;  2PJ1 A;  4ZY2 A;  3VWD A;  3NE8 A;  4UIA A;  4E30 A;  2B5G B;  3EXN A;  2IQ6 A;  1USP A;  1KQS Y;  4XX2 A;  1TKF A;  2FT0 A;  4Y7N I;  4R9M A;  1YSJ A;  4KOY A;  4KS9 A;  2GFQ A;  1YVO A;  5F48 A;  2V77 A;  4QTT A;  3VMH A;  4YU9 A;  1IGB A;  1YI2 Z;  4F9U A;  3C26 A;  3H3V J;  4QTU A;  3MZK B;  1Q86 1;  2QA4 Z;  4B5O A;  2RPR A;  1YIT 1;  1VQO Z;  4A3E I;  5AG5 A;  3FEC A;  4BBH A;  5D1O B;  4E33 A;  2ZEO A;  3JRU A;  5JM6 A;  2BUE A;  3P2H A;  2YND A;  2KCW A;  4JXR A;  2R6M A;  1BOB A;  3RBU A;  1M1K 2;  1TFI A;  1K4J A;  1Z02 A;  3D2P A;  2VQY A;  1DTD A;  1V0C A;  4KOV A;  3DNS A;  2Q7B A;  4NBC A;  4PXE A;  3G6E 1;  1YJN Z;  5C82 A;  3SXN A;  3CD6 Z;  1RLY A;  1Q16 A;  1BLL E;  8CPA A;  4MHN A;  1S7N A;  2ODF A;  4OLL A;  2B4D B;  2G3T A;  4RVD A;  2VPW A;  2DPT A;  1Z8T A;  3CCQ Z;  4UEF A;  2QJ8 A;  3Q87 A;  4MFQ A;  4CGN A;  3TC8 A;  3TO6 A;  2FCK A;  2IJZ A;  3CCL Z;  3W6S A;  3PO2 I;  3WT4 A;  2F7V A;  2CIJ A;  3CCS Z;  5K8N A;  4H6Z A;  3S2H I;  1YW4 A;  2Y0S A;  1L1O C;  1DE4 C;  3IWG A;  2Q04 A;  1K9M 2;  4YGO A;  5EMI A;  4NGT A;  4MHZ A;  3JAM f;  1M44 A;  3TDH B;  3IJ3 A;  2J8M A;  4RS4 A;  1SQH A;  1IB1 E;  3LMS A;  3CC2 1;  4P4B A;  2VPY A;  3FNC A;  2R8V A;  2NAP A;  1QSN A;  2QR1 B;  3VB9 A;  2E7Z A;  2JA8 I;  4Q36 A;  2XEF A;  2BJO A;  4UCP A;  1YIT Z;  2EK8 A;  5T64 A;  3WR7 A;  1Z4E A;  3S2D I;  2PVV A;  3RAM A;  2B5G A;  4C2Y A;  2AFW A;  1Q82 2;  4MFJ A;  2VUG A;  4A3D I;  1KQS Z;  4MRI A;  4J3G A;  4NXY A;  2NSM A;  1J4J A;  3ZZI A;  2PJ4 A;  2QLV B;  2YNE A;  3GTM I;  1FDI A;  1RNI A;  2OZK A;  3G6E Z;  2YGW A;  3PFE A;  1TKH A;  2Z3M A;  4ZY1 A;  4Q38 A;  1Q7Y 1;  3VH9 A;  5IP9 I;  3N7Z A;  1FNO A;  3VAT A;  2ATR A;  3RZO I;  3BG0 B;  2OZH A;  3I3G A;  3B7I A;  1H8L A;  4PQA A;  3H8F A;  2Q43 A;  1QSO A;  2HB6 A;  4H89 A;  4DGL A;  2NMT A;  2FIW A;  1Y1V S;  3GKQ A;  3DGV A;  1CP6 A;  4LQ6 A;  4Y49 C;  1FY7 A;  1S60 A;  4R3K A;  5HVF A;  2JMO A;  3JTK A;  2ZEH A;  1WCM I;  1YRE A;  4HNX B;  1CBX A;  1BPN A;  3GTJ I;  2B4D A;  2PJ2 A;  4KUB A;  4JZ0 A;  2RBL A;  4CAW A;  4BY7 I;  2QIR A;  1QVF Y;  2KPI A;  2VF1 A;  4NBG A;  1K73 2;  3CC2 Z;  3PRT A;  4ZI6 A;  5K8O A;  2RB7 A;  2HV2 A;  4UIB A;  1JQG A;  2PJ9 A;  2ZEE A;  5IX3 A;  4OC5 A;  3HLP A;  1XMB A;  2QRC B;  4B6Z A;  2P6F A;  4PPZ A;  3QNV A;  4UCN A;  3TCV A;  2OOX B;  1TF9 A;  4KOT A;  2EUI A;  4DQY B;  3I4M I;  4FWU A;  4XNH C;  2Z11 A;  5C44 I;  2R98 A;  4HGY A;  1R57 A;  3FMC A;  4A31 A;  1M4L A;  2GLJ A;  4A37 A;  5I4M A;  4A3J I;  3EY5 A;  1K9M 1;  4OID A;  4PXC A;  4UFV A;  4KVO E;  3PGP A;  3V8I A;  1ZG7 A;  1GYT A;  3B3S A;  3N5F A;  1R43 A;  2O4H A;  2CNS A;  5HMN A;  4QC6 A;  5DWN A;  2OZU A;  1IU8 A;  1YUK A;  2JLM A;  4NF1 A;  1K8A 2;  2DE6 A;  2PRQ A;  2C27 A;  4CPA A;  2F5I A;  1NP6 A;  3IU1 A;  2P6E A;  3QWU A;  4OC4 A;  2OZG A;  4R76 A;  5LRK A;  5ISV A;  2PR1 A;  2YNC C;  3S6K A;  2BL1 A;  1JWH C;  3F3P C;  1M90 1;  3I1U A;  4MY3 A;  2D4P A;  2QEC A;  4EFD A;  5AGE A;  3CPW Y;  1Y1W I;  3J80 b;  1Q2D A;  4LX9 A;  1S72 1;  3CXC Y;  1S3Z A; 
#chains in the Genus database with same CATH homology
 3D68 A;  1Z2L A;  3ESW A;  1LQL A;  3CCR Z;  4ZY0 A;  3GB0 A;  4H2K A;  3I56 1;  5D29 A;  3BG1 B;  4A3I I;  3FEE A;  3LWU A;  1K83 I;  2PIY A;  2F4O A;  2CTB A;  5IT9 b;  1ZLH A;  1P9N A;  1YJN 1;  5IP7 I;  4R8F A;  1RO0 A;  5A2Q f;  4P6Y A;  3CD6 1;  4OC0 A;  5K8M A;  3PO3 I;  1ZB9 A;  1ZLI A;  3PB8 X;  3B3T A;  5ELY A;  2KI7 B;  1VQN 1;  1AYE A;  3KR4 A;  3FQQ A;  3K2K A;  1PFT A;  3NDI A;  3HOU I;  2NVX I;  1M1K 1;  5HVH A;  3B3V A;  5A2Q b;  4NFR A;  3KQZ A;  2WYR A;  4A3L I;  3CCQ 1;  3EER A;  2RFH A;  3I4N I;  3S9L A;  3V7Z A;  2RIQ A;  2CF4 A;  4A94 A;  4OC2 A;  4A38 A;  1YHQ 1;  3WAB A;  2JBK A;  3M4O I;  3CCL 1;  3KIH A;  3CCU Z;  2G9D A;  3NDJ A;  1FT7 A;  2HC9 A;  4NGM A;  3CT9 A;  4OC1 A;  1CX8 A;  4PXD A;  1F57 A;  1TWH I;  2V8J A;  3CCJ 1;  2PJB A;  3CCS 1;  4NGR A;  1ZG8 A;  3IIB A;  4P4I A;  5LYL A;  3GCF A;  4CL1 A;  3FF3 A;  2PJC A;  1YIJ 1;  2AFX A;  3IFE A;  3KR5 A;  4MMO A;  3PO3 S;  3D66 A;  1VQ6 1;  4OIW A;  2VUM I;  4MD8 A;  4DYO A;  2IMO A;  5LRJ A;  3TE5 B;  2WB1 A;  2PJ1 A;  3D7F A;  1ARM A;  4ZY2 A;  1KC8 2;  1HDU A;  2E2I I;  1RO4 A;  3FH4 A;  3GTL I;  2YAD A;  1KWM A;  4MCR A;  2W03 A;  3FJU A;  4UIA A;  3IEH A;  4E30 A;  3K9T A;  3S9N A;  4UF4 A;  1TWC I;  1TKJ A;  1USP A;  2IQ6 A;  4R6T A;  2W04 A;  1KQS Y;  3HOW I;  4E2W A;  1LAN A;  1YJW 1;  3CCV Z;  3PB4 X;  1XFO A;  2V8G A;  4P44 A;  3PBE A;  4XX2 A;  1TKF A;  3GTG I;  1EE3 P;  4RVG A;  5FLX b;  2QKD A;  4Y7N I;  4G1P A;  2PJ7 A;  1QYP A;  1VQ7 1;  1YSJ A;  5HVG A;  1XBU A;  5LYD A;  2C6C A;  4F9V A;  1R9T I;  1PYT B;  4ZYQ A;  2V77 A;  3CC4 1;  4QTT A;  3PBB A;  2K3R A;  2F4M A;  1M90 2;  2AFM A;  3VMH A;  2NVT I;  4YU9 A;  1IGB A;  1YI2 Z;  4F9U A;  1F2O A;  1KD1 2;  2GTH A;  3H3V J;  3TX8 A;  4QTU A;  3MZK B;  1Q86 1;  2QA4 Z;  4NB9 A;  4BBS I;  3I55 1;  2R93 I;  4ONW A;  1VQL 1;  2FVG A;  2QEX Z;  2RPR A;  1YIT 1;  2R7Z I;  1VQO Z;  4A3E I;  2GLF A;  4NBF A;  3FEC A;  5D1O B;  4E33 A;  3S1M I;  2ZEO A;  3JRU A;  1LAP A;  5JM6 A;  1BPM A;  3CDX A;  5IB9 A;  1OBR A;  4NOZ A;  2NYQ A;  3BXM A;  2R6M A;  3RBU A;  2ZEN A;  1TWA I;  1ELM P;  2PJ8 A;  4MHY A;  3VTN A;  3G4S Z;  4MHP A;  3NH8 A;  1M1K 2;  5C4J I;  1TFI A;  4MCQ A;  1Z02 A;  1S72 Z;  1DTD A;  4BD9 A;  3KHZ A;  2ANP A;  5LL6 f;  3I56 Z;  3K7A I;  1LFW A;  2G2K A;  4NBC A;  1S7M A;  4PXE A;  3G6E 1;  1YJN Z;  5D1O A;  3CD6 Z;  1UWY A;  2BCO A;  1RLY A;  2CTC A;  3CPX A;  2PJ3 A;  4A3G I;  1Q82 1;  1BLL E;  3OW2 Y;  1VQN Z;  2VL1 A;  1W2B Z;  3BI1 A;  4MHN A;  8CPA A;  2B63 I;  4P4J A;  4IK2 A;  2V8I A;  1BAV A;  3HKZ A;  4RVD A;  4E2Z A;  3J81 f;  3CCE 1;  1I6H I;  2JA7 I;  1IY7 A;  3IF8 A;  3D7H A;  4E32 A;  2PIZ A;  3WC5 A;  3CCQ Z;  3GLJ A;  4UEF A;  2QJ8 A;  3H8G A;  3Q87 A;  1QQ9 A;  1TF8 A;  2XEJ A;  3TC8 A;  1YHQ Z;  2ZED A;  4IHM A;  1ELL P;  2IJZ A;  4WWV A;  3CCL Z;  2WZN A;  3J81 b;  3PO2 I;  1RTQ A;  2AFO A;  3WT4 A;  2JBJ A;  3NA6 A;  5CM2 M;  2F7V A;  2BO9 A;  3CCJ Z;  2CIJ A;  3CCS Z;  5DS0 A;  4NJQ A;  1SFO I;  4KSI A;  1Z5R A;  1YIJ Z;  5D8N A;  1VQM 1;  2AFU A;  3CC7 Z;  3CPA A;  3PB9 X;  5K8N A;  1K8A 1;  4Z65 A;  2ZEF A;  1VQ6 Z;  3CPW Z;  1NSA A;  1R3N A;  4MCP A;  2PK7 A;  3S2H I;  3D4U A;  4MD7 A;  3PB6 X;  1YW4 A;  4BXX I;  2Y0S A;  1L1O C;  3CXC Z;  4P4F A;  4EME A;  1DE4 C;  5C4X I;  1ZG9 A;  2PVW A;  1VHE A;  4A3K I;  5LYF A;  1K9M 2;  2QRD B;  3I07 A;  3KHX A;  1Y7E A;  4DUK A;  4BY1 I;  2E2H I;  4NGT A;  1N8R 1;  4MHZ A;  3JAM f;  1RQF A;  3TDH B;  3CC7 1;  2V8V A;  1YJW Z;  3IJ3 A;  3KZW A;  2JNY A;  2JEW A;  1VQ4 Z;  1VQ9 1;  4RS4 A;  2LFU A;  1Q86 2;  3SJX A;  4BBR I;  2AFS A;  1VHO A;  1X0T A;  5AN9 F;  3GTQ I;  1VQ5 1;  3S17 I;  3M3Y I;  1VQ7 Z;  3CC2 1;  3LMS A;  4P4B A;  3D7G A;  4EWC A;  1VQP 1;  3CC4 Z;  2QR1 B;  2RT9 A;  2QRE B;  3G71 1;  3VB9 A;  5JGF A;  2I3C A;  2EGT A;  4DJL A;  1VQ4 1;  2JA8 I;  3H8E A;  2XEI A;  1Q7L A;  2YU9 I;  4EWT A;  2OTL 1;  2XEF A;  4A3C I;  2BJO A;  2JUB A;  4OP4 A;  3I55 Z;  4O23 A;  3PEI A;  1VQL Z;  1K73 1;  2Q4Z A;  1QVG Y;  1YIT Z;  3S15 I;  2C1C A;  2EK8 A;  4X8I A;  1TWG I;  5T64 A;  1VLA A;  3S2D I;  1I50 I;  2PVV A;  3FKI I;  2EK9 A;  3B3W A;  2QVP A;  2V8H A;  3SI2 A;  3LUS A;  1QMU A;  3RAM A;  2Q51 A;  2NVY I;  2E9H A;  3MRU A;  2AFW A;  4JYW A;  3MZL B;  1Q82 2;  3S1R I;  2ZOG A;  3SI0 A;  2VUG A;  2M6N A;  4A3D I;  3T8W A;  1KQS Z;  4MRI A;  2H85 A;  5JH9 A;  3VMI A;  2NSM A;  3PFO A;  3CME 1;  3P5J B;  1VQK 1;  2PJ4 A;  2O53 A;  2PE3 A;  2WAQ A;  2EWB A;  2QLV B;  3GTM I;  3IFU A;  3CMA 1;  4NBA A;  1RNI A;  4MCS A;  2XEG A;  2IZ4 A;  2OZK A;  1Y1V I;  3G6E Z;  1YW6 A;  3PFE A;  5D1P A;  1JJ2 Y;  1DL6 A;  1TKH A;  4ZY1 A;  1QVG Z;  1CPX A;  1YME A;  1YUA A;  1Q7Y 1;  3VH9 A;  3WC7 A;  2ZAE B;  3FQM A;  3FX6 A;  5IP9 I;  5LYI A;  1FNO A;  3VAT A;  2J9A A;  4K3N A;  3RZO I;  3BG0 B;  3CCE Z;  4NGN A;  6CPA A;  3B7I A;  2BOA A;  3D9X A;  1H8L A;  2R92 I;  3PB7 X;  2ZEL A;  4MXU A;  4PQA A;  3H8F A;  2F8H A;  2PMZ A;  2Q43 A;  1CPS A;  4NH1 C;  2HB6 A;  1YJ9 1;  4DGL A;  1ARL A;  4GM5 A;  1Q81 1;  1N8R 2;  3GTM S;  1KRL A;  3H0G I;  1ZB8 A;  4RVF A;  2PJ5 A;  3ISX A;  2OOY B;  1Y1V S;  3GKQ A;  4X3R A;  4RVH A;  1VQM Z;  3DGV A;  4OKO A;  5CBM A;  3J80 f;  2OTJ 1;  2HU9 A;  2C6P A;  1CP6 A;  4X6A I;  3IWW A;  3L2N A;  3FED A;  3D6W A;  5CPA A;  3S16 I;  1VQ8 1;  1KD1 1;  1VIX A;  5HVF A;  2JMO A;  5IT9 f;  4NGS A;  5HXD A;  2JR6 A;  2ZEH A;  1WCM I;  1XRY A;  3IX0 A;  3NFZ A;  3HOY I;  1CBX A;  5T67 A;  3CCM 1;  1BPN A;  3GTJ I;  2E2J I;  4NGP A;  3SJE A;  4UEE A;  3KGQ A;  1VQ9 Z;  1F2P A;  3OW2 Z;  2PJ2 A;  3D67 A;  4JZ0 A;  3S1N I;  1PCA A;  2HF1 A;  2RHB A;  2RBL A;  4BY7 I;  2P3Y A;  4Q7A A;  1VQ5 Z;  1QVF Y;  2KPI A;  2VF1 A;  4NBG A;  1K73 2;  1X3Z A;  2POK A;  3CC2 Z;  1NJI 1;  7CPA A;  3PRT A;  3BHX A;  4MD9 A;  4ZI6 A;  2RB7 A;  5K8O A;  2DE5 A;  1HEE A;  1RO2 A;  1TWF I;  3HOX I;  1VQP Z;  4UIB A;  1JQG A;  4F8Z A;  1Z03 A;  2PJ9 A;  2ZEE A;  3G71 Z;  3CCR 1;  4NB8 A;  2GRE A;  1LOK A;  1I3Q I;  1N2F A;  4OC5 A;  3HLP A;  2GTI A;  5LRG A;  3RZD I;  2OTL Z;  5K8P A;  1TXR A;  3ISZ A;  3RZA A;  1XMB A;  2QRC B;  2DEA A;  3D7D A;  3JAM b;  3WC6 A;  4B6Z A;  4PPZ A;  1QF8 A;  4A3F I;  4X2T A;  1USP B;  3QNV A;  4OC3 A;  1ZH1 A;  4NGQ A;  3HOZ I;  2OOX B;  3J7A 4;  1TF9 A;  3KIF A;  1CP7 A;  3B35 A;  2JS4 A;  1XJO A;  1QVF Z;  2LIY A;  4HH4 A;  4DQY B;  3I4M I;  4FWU A;  5J1Q A;  3HOV I;  1Q7Y 2;  3CQZ I;  3EED A;  4ZX9 A;  4FBE A;  3HUV A;  3NH5 A;  5C44 I;  5THW A;  3S1Q I;  2PCU A;  1CG2 A;  3CCU 1;  4FUU A;  4R7M A;  3B3C A;  4NJR A;  4A3M I;  3CME Z;  4HGY A;  1VQK Z;  1YLO A;  5FLX f;  5C3E I;  2J6A A;  1HDQ A;  2V8K A;  4IAV A;  3FMC A;  3MN8 A;  2M48 A;  3CMA Z;  4A93 I;  4UEZ A;  1M4L A;  2PM9 A;  3GTP I;  2PJA A;  4MH4 A;  1Z8L A;  2GLJ A;  3KI9 A;  3SI1 A;  3KL9 A;  2OR4 A;  2PJ6 A;  4PXB A;  2IZ3 A;  4A37 A;  1Q81 2;  4ZX8 A;  4E2Y A;  2C6G A;  1LCP A;  2QYV A;  5I4M A;  4A3J I;  4P4E A;  4NBD A;  3IC1 A;  1K9M 1;  4OID A;  4PXC A;  1ZG7 A;  1GYT A;  3B3S A;  3KAS A;  3N5F A;  4TWE A;  3CCV 1;  3IO1 A;  1R43 A;  3T4N B;  3GTK I;  2O4H A;  3V38 A;  1WW9 A;  3MON A;  3GTO I;  2AFZ A;  3SJG A;  3DLJ A;  1YJ9 Z;  4OME A;  4LQG A;  2JA5 I;  5F09 A;  4AYB A;  2DE7 A;  1ML8 A;  3U50 C;  2ZEM A;  1KC8 1;  3KQX A;  2OOT A;  4A39 A;  1YUK A;  4HGZ A;  2ZEG A;  1Y0R A;  1K8A 2;  2PJ0 A;  4DK1 A;  2DE6 A;  1W2B Y;  3GUX A;  2OTJ Z;  3FVL A;  3S14 I;  4S1T A;  2PRQ A;  3VAR A;  4CPA A;  4MON A;  1YI2 1;  1NP6 A;  4E31 A;  4P10 A;  2ZOF A;  4TNU A;  4A3B I;  1VGY A;  4W9Y A;  3QWU A;  5T6B A;  1VQ8 Z;  1NJI 2;  4YWY A;  2AKL A;  4P4D A;  2QA4 1;  4AXV A;  5FLM I;  3S9M A;  4OC4 A;  1X3W A;  3B2Y A;  4RV9 A;  2K5R A;  4R76 A;  3NH4 A;  2QEX 1;  5LRK A;  1VQO 1;  4NBB A;  1JJ2 Z;  2ZEP A;  2ABZ A;  4WJB A;  3CCM Z;  1AMP A;  1LAM A;  4P45 A;  3BI0 A;  2JA6 I;  1JWH C;  1WII A;  3F3P C;  1M90 1;  2NVQ I;  2P28 A;  1NUI A;  4NBE A;  3F3F C;  3I1U A;  1Z01 A;  3VMG A;  4NBH A;  4EFD A;  4RUH A;  3G4S 1;  4E2X A;  2V8D A;  3CPW Y;  1Y1W I;  3J80 b;  1Y0Y A;  4Y52 I;  2GU2 A;  4FAI A;  3SJF A;  1S72 1;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...