2O4HA

Human brain aspartoacylase complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Examination of the Mechanism of Human Brain Aspartoacylase through the Binding of an Intermediate Analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 93
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2006-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2o4hA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2o4hA01
3PB4X 3CPAA 3NH4A 1YW4A 3WABA 1KWMA 1AYEA 4NGQA 3VARA 4MHYA 3BHXA 4EWTA 1LANA 4PXEA 5HXDA 1NSAA 3ISZA 4PQAA 1VIXA 1Z2LA 2ZEMA 4MMOA 4K3NA 5LRJA 2PRQA 4DJLA 2Q51A 2ZEGA 4AXVA 3CPXA 1TKJA 4WWVA 4P4BA 4OMEA 5DS0A 3KR5A 1LAMA 3PB6X 5K8NA 3RBUA 2PE3A 4ZI6A 4JYWA 2BOAA 3KI9A 4OC1A 4UEEA 3FMCA 3MN8A 8CPAA 3PRTA 5JM6A 4MHZA 4MCPA 1H8LA 1TF9A 1HDQA 3NA6A 3CT9A 3HLPA 4A94A 3RZAA 1FT7A 3RAMA 4OIDA 1QMUA 4P10A 4R76A 1OBRA 4MHPA 3FVLA 1CBXA 1ZG9A 3SJEA 1Z8LA 4MCRA 4NFRA 1CPSA 1XJOA 3PEIA 5CBMA 1CPXA 3HUVA 1LFWA 3WC6A 1R43A 3MRUA 4P4IA 4FAIA 2PJ3A 3SJGA 1BAVA 2PIZA 3D7FA 3KGQA 3IC1A 4WJBA 3S9LA 5D29A 2PJCA 2O4HA 4OC3A 4G1PA 1DTDA 1XMBA 3NH5A 1PCAA 4W9YA 2QJ8A 2CTCA 5K8OA 4P45A 3PB9X 2GLFA 1HEEA 2VL1A 4NJRA 4NGPA 1Y7EA 1VGYA 4B6ZA 2PJ5A 2JBKA 2F7VA 3IO1A 2ABZA 3SJXA 1GYTA 1ARMA 5THWA 4ONWA 2V8GA 4ZY2A 4F9UA 5K8MA 1CP6A 4RUHA 3WC5A 3PBBA 1BPMA 2NYQA 3PB8X 1F57A 3K9TA 3KZWA 4OC0A 1LAPA 3T8WA 4NGRA 1M4LA 5LYLA 5J1QA 3WC7A 4JZ0A 1TKHA 4PXDA 2V8VA 4OP4A 5LYDA 2DEAA 2AFWA 2XEJA 2ZOFA 1YLOA 3SI1A 4PPZA 3D7HA 4H2KA 2G9DA 1CX8A 4X8IA 5LYIA 3PFOA 3WT4A 3KQZA 3TX8A 3VH9A 3IWWA 2EK9A 3FECA 1TKFA 3PB7X 4OKOA 1LCPA 4NJQA 2V77A 2ZEEA 4NGSA 4ZY0A 3FEDA 4NGMA 1VHOA 2ZEDA 1Y0RA 2PIYA 2Q4ZA 4DYOA 1VHEA 5LYFA 4KSIA 4OIWA 2PCUA 4ZYQA 3H8FA 4PXBA 5D8NA 4NGTA 3FF3A 4A38A 3IIBA 2WYRA 2V8HA 4A37A 2ANPA 4A39A 5HVHA 2AFMA 2POKA 2QYVA 1IGBA 4GM5A 2IJZA 3V38A 4ZY1A 6CPAA 4FUUA 4P4EA 4Z65A 1ZLHA 4MXUA 2CIJA 3B3TA 2O53A 2QVPA 3K2KA 7CPAA 2PJ0A 2PJ7A 2PVVA 3I1UA 3D4UA 2XEIA 1ZG7A 1UWYA 2CTBA 1JQGA 4ZX8A 3B35A 4X2TA 3SI2A 2Q43A 2JBJA 4R7MA 3B3SA 3B3CA 5F09A 4R8FA 3KASA 1TXRA 4F8ZA 5LRGA 2ZENA 2RFHA 1ELLP 4P4DA 1F2OA 4MCSA 4OC2A 3BI0A 1YW6A 2ZEFA 5CPAA 4YU9A 2PJ4A 2ZOGA 3FJUA 2AFZA 4P44A 4R6TA 3ISXA 3L2NA 3KL9A 1YSJA 2PJ2A 1CP7A 4MCQA 3SJFA 2NSMA 4EFDA 4ZX9A 3H8EA 2IQ6A 2FVGA 2AFUA 4IHMA 3KHXA 3PBEA 4IK2A 4TWEA 2C6PA 4MRIA 3D67A 2I3CA 2GU2A 4X3RA 2C1CA 3GB0A 1LOKA 2CF4A 1YMEA 2PJ6A 4P4FA 1DE4C 3CDXA 2WZNA 2PJ1A 1Q7LA 1BLLE 4UIAA 1ELMP 1FNOA 1RTQA 2J9AA 1BPNA 4TNUA 4OC5A 2AFSA 4UEZA 3V7ZA 2EWBA 1ARLA 2OR4A 4FWUA 3TC8A 2HC9A 3DLJA 3S9MA 3GUXA 1QQ9A 4F9VA 1R3NA 3FEEA 3FX6A 1Z5RA 4CPAA 1IY7A 3S9NA 5I4MA 4MHNA 2ZEHA 1XBUA 2F8HA 2PVWA 3NFZA 2EK8A 2C6GA 2HB6A 2ZEOA 3D66A 3JRUA 4OC4A 3B3WA 4YWYA 3B3VA 3IFEA 1AMPA 4P4JA 2BCOA 4IAVA 2ZEPA 3QNVA 3B2YA 3SI0A 5K8PA 4BD9A 3BI1A 5ELYA 2PJAA 1HDUA 3DGVA 3D7GA 3NH8A 3IEHA 5JH9A 3D7DA 2ZELA 1Y0YA 3BXMA 3LMSA 2IMOA 2AFOA 1XFOA 5LRKA 3KR4A 5HVGA 4FBEA 4O23A 3FH4A 2PJBA 1CG2A 2AFXA 2C6CA 3N5FA 1EE3P 3B7IA 4EMEA 4DUKA 4Q7AA 2JEWA 4UIBA 3LWUA 1PYTB 3VATA 2OOTA 3D68A 2XEGA 5JGFA 2RB7A 4LQGA 1ZG8A 2V8DA 3GLJA 5HVFA 4UF4A 2GLJA 3KHZA 1XRYA 1ZLIA 1F2PA 2PJ9A 2BO9A 3IJ3A 3KQXA 1TF8A 3H8GA 4UEFA 4PXCA 2PJ8A 2GREA 3PFEA 4NGNA 5IB9A 4P6YA 2XEFA
chains in the Genus database with same CATH superfamily
3PB4X 4NEXA 4QB9A 2LEXA 2YU9I 1YW4A 2BSWA 3VARA 5A27A 3BHXA 1XOVA 2F5IA 4Y49B 4NBHA 1VQ7Z 4OADA 4XNHC 3F5BA 1YJ9Z 4GS4A 4RI1A 1YJNZ 3QAHA 4JXRA 4DQYB 1UFHA 3CD61 1KQSY 1X3ZA 4E2ZA 3JAMf 3CCR1 2B3VA 4MMOA 5F47A 1M44A 1VQ41 3CPXA 3DDDA 2W03A 3KIHA 4PSWA 2F4MA 1LAMA 2VXKA 1YIJZ 2PE3A 4A3II 1MJBA 2QA4Z 4MFZA 1Z8XA 8CPAA 5FLXb 5JM6A 3HOZI 2P0WA 1H8LA 4A94A 3RZAA 2VI7A 1YVKA 3A9LA 5AG7A 2QKDA 4B13A 4B10A 2C27A 2Q4YA 2YNDA 2YGWA 1Z8LA 1YJWZ 1N2FA 3G8WA 1M901 4MCRA 4NFRA 3PEIA 5CBMA 3WC6A 1R43A 2V8JA 1IB1E 1AA6A 3BG1B 4M6IA 1K8A1 3SJGA 2PIZA 3TO6A 4KORA 1KD11 4MFPA 5A28A 4WJBA 5LL6f 5D29A 2PDOA 1WIIA 4G1PA 1XMBA 3H3VJ 1PCAA 4P45A 3PB9X 4A3LI 4UFVA 2KI7B 2VL1A 3I9SA 1K4JA 3JTKA 2JR6A 1YHQ1 4B6ZA 4KSFA 3D2MA 4CAEA 4A31A 2E7ZA 1NJI1 4ONWA 5FLXf 4ZY2A 2DF5A 2VZZA 3ZJ0A 1CP6A 3J7A4 3RO0A 2EGTA 4MJ8A 3S1NI 3PB8X 3PO3I 3R96A 3GTMS 2Z11A 4NGRA 1N71A 3VTNA 5LYLA 5J1QA 1RO0A 4JZ0A 1TKHA 2V8VA 1BOBA 2DEAA 3I3GA 2XEJA 2ZOFA 2R1IA 1TIQA 3D7HA 4H2KA 3W6XA 3M3YI 2PR1A 1CX8A 2FCKA 4BY1I 1NE9A 4F0YA 3WT4A 3TX8A 4E33A 1XEBA 4C2YA 4ZBGA 4A33A 1LCPA 4NJQA 4NBBA 3G71Z 2ZEEA 4CAFA 1KZFA 2QEXZ 3CC2Z 4OAEA 3IR7A 2V3VA 2ARHA 2JIRA 3GTGI 3EFAA 4AVBA 3W6SA 4ZYQA 1I1DA 2J8MA 4NBCA 3PP9A 3SXNA 1VKCA 4A37A 2ANPA 1Q861 4HGYA 4E30A 2F4OA 2BJOA 3B3TA 2O53A 2REFA 3K2KA 3LUSA 3RNZA 3R9EA 3SHPA 2XEIA 1ZG7A 1Y7RA 4ZX8A 3SI2A 1IICA 2Q43A 3VB9A 4KS9A 3CXSA 4XX2A 2ZW7A 1L1OC 1VQN1 4CGNA 3I551 4MCSA 1YW6A 4YU9A 2PJ4A 2ZOGA 4P44A 1Y8CA 3GTJI 3GTMI 4M6HA 1CP7A 1PUAA 4MCQA 1MK4A 1J4JA 3CCL1 2AFUA 2Z0ZA 2GU2A 4X3RA 2R6MA 2CF4A 2WSAA 1VQ91 2O28A 3U50C 1Q7LA 2IZ4A 1ELMP 2VPXA 4XNHB 1QVGY 2JLMA 3PO3S 2OZHA 3S2HI 1TWGI 4AYBA 3NE8A 1FY7A 4MY0A 3V7ZA 3CC4Z 3P2FA 3HKZA 1S72Z 4A3MI 4FWUA 2HV2A 3CCV1 4F9VA 1VQ61 4CYNA 2YNEA 1IY7A 5C4JI 3S17I 2Z3NA 2ZEHA 2CY2A 3EY5A 1ML8A 1Q811 3NFZA 1S721 2HB6A 4KOYA 4YWYA 2YNCC 1LQLA 3HOXI 4E8OA 5GCNA 4IAVA 2ZXVA 4BBSI 1RO4A 1JJ2Y 5ISVA 3G3SA 3IEHA 3D7DA 4I49A 5F48A 2JA7I 2IMOA 1QXFA 1Q2DA 3VMIA 4IUSA 4UCPA 2PJBA 1CG2A 3CXPA 3PO2I 4R9MA 1VQNZ 4NF1A 2B5GA 3PGPA 3LWUA 1XMTA 1PYTB 2B3UA 1ZG8A 2VPZA 4UF4A 4CRYB 1VQP1 3TCVA 2PJ9A 4MH4A 3SXOA 1TF8A 2HUZA 1Z9UA 2D4OA 2GREA 1VQK1 5G22A 4NGNA 2JDDA 4P6YA 1M1K1 3NH4A 1WCMI 2B4BA 3WABA 4EVYA 4EWTA 1LANA 2HQYA 2JIPA 4PXEA 1QVGZ 1NP6A 2E2JI 3DNSA 3S6GA 4DNCA 1X0TA 1VIXA 5FLMI 4MD7A 2BUEA 4BMHA 3HOWI 1Z2LA 2ZEMA 2K3RA 3GIUA 2ZEGA 4P4BA 3FYNA 2ATRA 3PB6X 5K8NA 3RBUA 4OC1A 1QSMA 4DK1A 4LQ6A 3PRTA 1SQHA 4HPSA 2OB0A 3CT9A 3HLPA 4Y49C 4JLYA 1FT7A 4CGPA 2HU9A 4U9YA 4HNYB 1YUAA 3CMEZ 3FVLA 1CBXA 4A2ZA 3W91A 3SJEA 1K732 3S1MI 1CPSA 3FRMA 5C4XI 1CPXA 3HUVA 1CM0A 2E2II 3LACA 3KGQA 3R9GA 3IC1A 2JDCA 3K9UA 2P3YA 2EBJA 2H5MA 4CAXA 2PJCA 3D3SA 4C2XA 4AVCA 1Q16A 1Z02A 1VQ5Z 1I3QI 1DTDA 4E32A 3NH5A 3CPWY 3CCEZ 4ONUA 2QREB 4NGPA 4BINA 1VGYA 2WPWA 2JBKA 4MFJA 1XIXA 2F7VA 3TT2A 1Q862 4QUSA 5IP9I 2VBQA 2FS5A 2VEZA 5J8FA 5THWA 4CL1A 2V8GA 2ZW4A 4MFKA 4MBUA 1PFTA 1YX0A 5K8MA 3WC5A 4E2AA 2NYQA 4KOSA 1M4IA 2G2KA 1F57A 1S7NA 1YIT1 1LAPA 2K5RA 3MGDA 3I07A 4RVDA 4XPKA 5LYDA 4NBEA 4YFJA 1N8R1 4XPLA 4LUAA 1YJN1 2NMTA 1B6BA 1VQO1 4X8IA 2WUUA 1YIJ1 3PFOA 3J80f 3KQZA 1S7LA 3BJ8A 3G4SZ 2Z3KA 4NBGA 4E2WA 1Y0RA 4DYOA 4QTTA 2JEVA 2JIMA 3FNCA 1YJW1 5CM2M 2DPTA 2OOXB 4OIWA 5A2Qb 2IZ3A 3H8FA 2DE5A 4JXQA 4KUBA 4NGTA 1Y1VI 4A38A 3IIBA 2WYRA 1ZO0A 4A39A 2Y0SA 2GTHA 4E31A 4A3DI 4KVOE 2AFMA 2POKA 3CXCY 2X7BA 4R57A 2VZYA 2IJZA 4ZY1A 4YGOA 4P4EA 5KTAA 4MXUA 4XPDC 2CIJA 3M4OI 2QVPA 3EC4A 2PJ7A 4QC6A 2Q4VA 3FQQA 1JQGA 3B35A 2JBJA 5H84A 2FT0A 3I55Z 3B3CA 2B4DA 5T64A 1VQ4Z 5T6BA 1WK4A 4F8ZA 2RHBA 5LRGA 1TFIA 2RFHA 1F2OA 4OC2A 5CPAA 2AFZA 2Q44A 3D2PA 3L2NA 1YREA 2ZW5A 4OLLA 1MJAA 3SJFA 2NSMA 3P2HA 4M3SA 3D6WA 4FD7A 2AYDA 1M902 3D8PA 1IOFA 2RBLA 1KC82 3KIFA 3RZDI 1WJ2A 3GTKI 4KOTA 1ZB8A 2GANA 4MONA 1USPA 2I3CA 1VHSA 2CNMA 4CGLA 2DE6A 4A93I 2I00A 1I6HI 1I50I 1Z4EA 3DR6A 1VLAA 3CDXA 2WZNA 3TTHA 2PJ1A 1V0CA 2BL1A 3R1KA 4QBJA 2Z3PA 1Y9WA 5AG6A 5JQ4A 3IF8A 3S16I 2W04A 3UY5A 1VQM1 1ARLA 4ORFA 1YHQZ 2CNTA 3QAYA 3CD6Z 3H4QA 3FX6A 1Z4RA 1FDIA 4CPAA 2FE7A 2BEIA 3S9NA 1M1DA 5C82A 5I4MA 3I561 4H6ZA 1X10A 2F8HA 5H86A 3R95A 2EK8A 4Q38A 2NVTI 2NVXI 3D66A 1VQPZ 5G20A 2BCOA 2OTL1 2ZEPA 1TWFI 3B2YA 2PQ8A 3SI0A 3CC7Z 5K8PA 1RNIA 3CCM1 4BD9A 5ELYA 3DGVA 1S3ZA 3TOAA 1KUVA 2ZELA 1Y0YA 1USPB 2OZUA 1YI2Z 2OU2A 5LRKA 3IWGA 3R9FA 1IYKA 4KVME 5HVGA 4FBEA 2PSWA 5BWAB 5E96A 3FH4A 2C6CA 2LIYA 2J8RA 2OOTA 5DWNA 2DXQA 3F3PC 4KVXA 2XEGA 2R7HA 5JGFA 2OTJZ 2V8DA 1OZPA 5HVFA 3MZKB 2GLJA 3KHZA 2Q04A 1ZLIA 5EMIA 2PR8A 2BO9A 3IJ3A 1Q7Y2 4C7IA 5KTDA 2B4DB 3FB3A 4R87A 4UEFA 2PJ8A 3BLNA 2WB1A 2LFUA 1CJWA 2XEFA 3CPAA 1L0CA 3PZJA 3OW2Y 2QMLA 2IV2X 1KWMA 2G3AA 5EBVA 2V8KA 3TE4A 1P0HA 3GKRA 2P6GA 5HXDA 2B5GB 3FIXA 1VQOZ 4PQAA 1LRZA 2K5TA 1VQ8Z 4J3GA 1Z01A 1VQ9Z 2RPRA 1SIWA 4II9A 1KD12 4K3NA 5LRJA 2FSRA 4CYQA 2PRQA 4DJLA 2Q51A 4MY3A 1TKJA 4C2ZA 1YQEA 4OMEA 2FIWA 5D1PA 4B5PB 4ZI6A 4JYWA 2BOAA 4UEEA 3FMCA 3MN8A 2R98A 4MHZA 1TF9A 3GTLI 1VQMZ 3E0KA 1Z03A 4CAWA 3RAMA 4UWJA 2QRCB 4MD8A 1QMUA 4P10A 4R76A 1OBRA 2V8IA 1Q822 4Y52I 4U9ZA 4FD5A 4H89A 1XJOA 3S2DI 1LFWA 3MRUA 1WZNA 1GHEA 2PJ3A 1I12A 3H5ZA 5EC4A 2H85A 4BBHA 4M6GA 1M4GA 1YITZ 2AKLA 3CCJZ 2M48A 2O4HA 2B58A 3HOVI 4R3LA 3I56Z 3CPWZ 3VMGA 3J81b 5IX3A 4W9YA 2QJ8A 2CTCA 5K8OA 3TDHB 1K9M2 1ON0A 2Z3LA 1S5KA 2CXAA 4NJRA 1FDOA 2PJ5A 2OZGA 2ABZA 1M1K2 1GYTA 2NVYI 1ARMA 4GXHA 4UCNA 4QTUA 5J8CA 4F9UA 4DGLA 4BY7I 4CRZB 1Y9KA 2NVQI 2EUIA 2PMZA 3K9TA 3KZWA 1YGHA 2JA6I 4OC0A 2AJ6A 1M4LA 3CC41 3CCU1 3WC7A 4R3KA 5AG4A 2Z10A 4PXDA 5AGEA 3T9YA 2AFWA 2R8VA 3VWEA 4CYPA 1YLOA 1YVOA 4NH1C 2V45A 1JWQA 2G0BA 2EVNA 3WR7A 2ZAEB 2G9DA 3GY9A 4KOUA 4M85A 1W2BZ 1W2BY 1R57A 1IYLA 3VH9A 3IWWA 1JWHC 2EK9A 2DPSA 1QSNA 1VQ51 4JD6A 1TKFA 3PB7X 2J6AA 2V77A 4ZY0A 3CCSZ 2PM9A 3FEDA 4NGMA 2IL4A 2Q4ZA 3CZXA 1RO5A 2EO8A 4KSIA 3OWCA 4AG9A 2OZKA 5HMNA 4CGOA 1MJ9A 2V8HA 4A32A 5HVHA 2QYVA 4KOWA 1IGBA 4GM5A 3V38A 6CPAA 4FUUA 4RVHA 2JIOA 2KCWA 3S14I 7CPAA 3I1UA 3D4UA 1K9M1 1UWYA 2CTBA 4A30A 4R7MA 3B3SA 5F09A 4R8FA 2PRBA 2ODFA 1TXRA 2WAQA 5I0CA 3BG0B 3I4NI 4PSXA 4B12A 1ELLP 2OH1A 2R92I 1YK3A 1Q812 3QWUA 2ZEFA 4NCZA 3JAMb 1JJ2Z 3IX0A 3TO9A 1TWHI 2ZW6A 3KL9A 1YSJA 2PJ2A 1K83I 4RVGA 5C3EI 3H8EA 2IQ6A 4QVTA 2FVGA 5D1OB 3KHXA 3IGRA 3PBEA 2KPIA 4IK2A 4TWEA 2C6PA 3JVNA 4MRIA 2CNSA 4MFLA 2ZPAA 4A3BI 3GTQI 2VUGA 3GB0A 1LOKA 1VQKZ 1YMEA 3CCLZ 1DE4C 1S7KA 2JS4A 2JA5I 1BLLE 4UIAA 3T90A 1RTQA 2J9AA 1BPNA 2B63I 1B87A 2E9HA 4HNXB 4PK2A 1KC81 2OR4A 4BBRI 3CXCZ 2HC9A 2VPYA 3DLJA 3S9MA 5CNPA 1Q2YA 2Q7BA 1R3NA 3FEEA 1Z8TA 2Z3OA 1RO2A 4MHNA 2C6GA 2ZEOA 4MI4A 3JRUA 4OC4A 4C7HA 5AN9F 1YUKA 3B3VA 3IFEA 3V8IA 1AMPA 1P9NA 4E2XA 3QNVA 2P6EA 4B5OA 5IT9b 3J80b 4HKFA 3F0AA 1HDUA 3D7GA 3GTOI 4CYOA 3MZLB 1YR0A 5JH9A 3GKQA 4RVFA 2AFOA 3N7ZA 3KR4A 4KOXA 3CME1 3N5FA 1XE4A 2REEA 5JPHA 4A3CI 2GFQA 3B7IA 4Q7AA 2JEWA 4UIBA 4KUAA 4MFQA 3VATA 4KOVA 3D68A 2RB7A 2M6NA 3GLJA 3CMA1 1F2PA 2YADA 1RQFA 1S7MA 3KQXA 3CMAZ 3H8GA 5G21A 3D9XA 1KRLA 2FXFA 4JWPA 4PK3A 4KLWA 5IB9A 3G6EZ 4RS4A 4NB8A 2VUMI 3D2LA 1AYEA 4NGQA 4MHYA 1NMTA 1PU9A 4X5KA 4B11A 5DWMA 2FIAA 1NSAA 3ISZA 1IOIA 1SFOI 4NOZA 4KLVA 3ESWA 2Q0YA 4AXVA 4WWVA 5DS0A 3KR5A 4UFWA 4Q36A 3S6HA 3KI9A 4KZTA 1I21A 5F49A 4EWCA 1S60A 1RLYA 4U5YA 4MCPA 1NJI2 1HDQA 3NA6A 3G711 1Q7Y1 2JUBA 4E2YA 1ZB9A 2PK7A 3CCUZ 3TOBA 4RN7A 4B5PA 4OIDA 4LX9A 4NXYA 2VQYA 4MHPA 3CQZI 5HH1A 3CXQA 5C88A 1ZG9A 3OW2Z 2Y0MA 3Q87A 3RZOI 4P4IA 4FAIA 1QSTA 4B14A 1BAVA 4HGZA 3D7FA 2QIRA 4XPDB 1Y1VS 3K7AI 2WPXA 5FVJA 3S9LA 3QB8A 3C26A 1K8A2 3P5JB 4CGMA 4OC3A 3DR8A 5F46A 5G1ZA 2R7ZI 1NUIA 4L8AA 5IV0A 2FL4A 3FBUA 1A2ZA 2P6FA 1Z8WA 1ZH1A 1P4NA 3HOYI 2GLFA 4S1TA 1HEEA 1Y7EA 3IO1A 2OTLZ 3SJXA 1VQL1 4CS0B 5IP7I 3EEDA 2P28A 2OOYB 1RXTA 1DL6A 4AG7A 4CAVA 3G4S1 1IU8A 4F0XA 3VMHA 2AE6A 3FQMA 4RUHA 3H0GI 2GTIA 3PBBA 1BPMA 1TWCI 4A3EI 3CC21 4UWIA 3LD2A 1NSLA 4UBRA 3T8WA 3EO4A 3I4MI 4YRHA 4OP4A 1QSOA 4A95A 1S7FA 4PV6A 1YLEA 2NAPA 3SI1A 3LODA 4PPZA 4RV9A 2QA41 2JA8I 5D1OA 3CCQZ 1VQ6Z 5LYIA 1QF8A 3ZZIA 2QEX1 1WWZA 4Y7NI 2GIVA 3TO7A 3FECA 2OTJ1 4OKOA 3FXTA 4A3JI 1KUXA 2QECA 1Q2CA 4NGSA 3GCFA 4K30A 4JJXA 1VHOA 4A3FI 2ZEDA 4L89A 2PIYA 2RIQA 4NB9A 4FD6A 1VHEA 5LYFA 1U6MA 1XF8A 2PCUA 1KQSZ 2A4NA 4PXBA 2VF1A 5D8NA 5A2Qf 3FF3A 1X12A 5IB0A 2R93I 1Y1WI 2I79A 3B8GA 5KTCA 2J8NA 4Z65A 1ZLHA 3S6FA 3S1RI 2RT9A 2PJ0A 2PVVA 4HNWB 4X2TA 1TWAI 3F8KA 4X6AI 4F6AA 3KASA 4UCMA 2ZENA 4IF5A 2JIQA 4P4DA 2YNCA 3BI0A 4MHDA 3VWDA 3FJUA 4R6TA 3IFUA 3ISXA 2GE3A 3KKWA 4EFDA 3CCQ1 2Z3MA 4ZX9A 3TFYA 2QLVB 4A3GI 4UA3A 2VPWA 4IHMA 3T4NB 3CCS1 1R9TI 3F3FC 3HOUI 3D67A 5T67A 1BO4A 3EERA 5C44I 3CCRZ 2C1CA 3IU2A 2PJ6A 1VQ81 4P4FA 2RC4A 2JNYA 3BJ7A 1VQ71 3GYAA 2Q7SA 3NE7A 1QSRA 1FNOA 3CCVZ 3CC71 4TNUA 1IIDA 4ZGYB 3MONA 4OC5A 4NSQA 2AFSA 4UEZA 2EWBA 3S6KA 4C68A 3IWEA 1WW9A 3TC8A 1X3WA 2DE7A 3FKII 3G6E1 2D4PA 3GUXA 4MD9A 3NDJA 1QQ9A 2QRDB 3IU1A 4FD4A 1N8R2 1Z5RA 1YI21 5AG5A 3S1QI 4BXXI 1XBUA 2PVWA 1Q821 4UFXA 3EXNA 1QYPA 3B3WA 3JUWA 4P4JA 4HH4A 3GTPI 3RYOA 3BI1A 2PJAA 1YJ91 2E2HI 3NH8A 1QVFZ 1QVFY 3BXMA 3LMSA 2PC1A 1AUGA 1XFOA 2QR1B 3DSBA 4E0AA 4O23A 2AFXA 3CCMZ 1EE3P 3CCJ1 1K731 4EMEA 4DUKA 4A3KI 1VQLZ 2G3TA 4LQGA 4AB7A 1KUYA 5IT9f 4AVAA 2JMOA 3S15I 1XRYA 4NBAA 4H6UA 3NDIA 4KSAA 4RS2A 3TE5B 4NBFA 2HF1A 3CCE1 4PXCA 3PFEA 3J81f 1M4DA 4NBDA
chains in the Genus database with same CATH topology
3G6EZ 3PB4X 3CPAA 4RS4A 3NH4A 3OW2Y 4NB8A 1WCMI 2YU9I 1YW4A 2VUMI 3WABA 1KWMA 1AYEA 4NGQA 3VARA 2V8KA 4MHYA 3BHXA 4EWTA 1LANA 4PXEA 1QVGZ 1NP6A 5HXDA 4NBHA 2E2JI 1NSAA 1VQ7Z 3ISZA 1VQOZ 4PQAA 1YJ9Z 1VQ8Z 1YJNZ 1Z01A 1VQ9Z 1SFOI 4DQYB 1X0TA 2RPRA 4NOZA 3CD61 1KQSY 1X3ZA 4E2ZA 3JAMf 3CCR1 1VIXA 5FLMI 4MD7A 3HOWI 1Z2LA 1KD12 2ZEMA 4MMOA 4K3NA 5LRJA 2K3RA 3ESWA 2PRQA 4DJLA 2Q51A 2ZEGA 4AXVA 1VQ41 3CPXA 1TKJA 2W03A 4WWVA 4P4BA 4OMEA 5DS0A 3KR5A 3KIHA 2F4MA 5D1PA 1LAMA 3PB6X 1YIJZ 5K8NA 3RBUA 2PE3A 4ZI6A 4JYWA 4A3II 2BOAA 3KI9A 4OC1A 4UEEA 2QA4Z 3FMCA 3MN8A 4DK1A 8CPAA 3PRTA 5FLXb 4EWCA 5JM6A 1RLYA 4MHZA 3HOZI 4MCPA 1H8LA 1TF9A 1NJI2 1HDQA 3NA6A 3CT9A 3HLPA 3GTLI 4A94A 1VQMZ 3G711 3RZAA 1Q7Y1 1Z03A 1FT7A 2JUBA 4E2YA 1ZB9A 2PK7A 2HU9A 3CCUZ 3RAMA 1YUAA 2QRCB 4OIDA 4MD8A 1QMUA 2QKDA 4P10A 4R76A 1OBRA 4MHPA 3CMEZ 3FVLA 1CBXA 3CQZI 1ZG9A 3SJEA 3OW2Z 1Z8LA 1YJWZ 1N2FA 1Q822 2V8IA 4Y52I 1K732 3S1MI 1M901 4MCRA 4NFRA 1CPSA 1XJOA 3PEIA 3Q87A 5CBMA 3RZOI 5C4XI 1CPXA 3S2DI 1LFWA 3HUVA 1R43A 3MRUA 3WC6A 2V8JA 4P4IA 4FAIA 2E2II 2PJ3A 3BG1B 1K8A1 3SJGA 1BAVA 2PIZA 4HGZA 3D7FA 3KGQA 1KD11 3IC1A 1Y1VS 3K7AI 2H85A 4WJBA 3S9LA 1YITZ 5LL6f 1K8A2 2AKLA 2P3YA 1WIIA 5D29A 3P5JB 3CCJZ 2PJCA 2M48A 2O4HA 1Z02A 4OC3A 1VQ5Z 4G1PA 1I3QI 1DTDA 2R7ZI 3HOVI 1NUIA 4E32A 1XMBA 3NH5A 3CPWY 3I56Z 3H3VJ 3CCEZ 3CPWZ 3VMGA 1PCAA 3J81b 1ZH1A 4W9YA 2QJ8A 2CTCA 5K8OA 3TDHB 1K9M2 4P45A 3PB9X 4A3LI 2QREB 3HOYI 2GLFA 4S1TA 1HEEA 2KI7B 2VL1A 4NJRA 4NGPA 1Y7EA 1VGYA 2JR6A 1YHQ1 4B6ZA 2PJ5A 2JBKA 2F7VA 3IO1A 2ABZA 2OTLZ 1M1K2 3SJXA 1VQL1 1Q862 5IP7I 1GYTA 5IP9I 2NVYI 3EEDA 1NJI1 2P28A 2OOYB 1ARMA 3TC8A 5THWA 4CL1A 4ONWA 2V8GA 4QTUA 5FLXf 1DL6A 4ZY2A 3G4S1 1PFTA 4F9UA 4DGLA 3VMHA 5K8MA 4BY7I 1CP6A 3FQMA 4RUHA 3J7A4 2EGTA 3WC5A 3H0GI 3S1NI 2GTIA 3PBBA 2NVQI 2PMZA 1BPMA 2NYQA 1TWCI 4A3EI 2G2KA 3CC21 3PB8X 1F57A 3K9TA 3KZWA 2JA6I 1YIT1 4OC0A 3PO3I 3GTMS 1LAPA 2K5RA 4NGRA 3T8WA 1M4LA 3VTNA 3CC41 3CCU1 5LYLA 3I4MI 3WC7A 5J1QA 1RO0A 4JZ0A 3I07A 1TKHA 4PXDA 2V8VA 4RVDA 4OP4A 5LYDA 4NBEA 2DEAA 1N8R1 2AFWA 2XEJA 2ZOFA 1YLOA 3SI1A 4NH1C 1YJN1 4PPZA 3D7HA 4RV9A 4H2KA 2QA41 2ZAEB 2JA8I 1VQO1 2G9DA 3M3YI 1CX8A 5D1OA 3CCQZ 4BY1I 1VQ6Z 4X8IA 5LYIA 1YIJ1 3PFOA 1QF8A 1W2BZ 2QEX1 3J80f 4Y7NI 1W2BY 3WT4A 3KQZA 3TX8A 3VH9A 4E33A 3IWWA 1JWHC 2EK9A 3G4SZ 1VQ51 3FECA 2OTJ1 1TKFA 3PB7X 4OKOA 2J6AA 1LCPA 4NJQA 4NBBA 4A3JI 2V77A 3G71Z 2ZEEA 4NGSA 3GCFA 4ZY0A 3CCSZ 2PM9A 3FEDA 4NGMA 2QEXZ 4NBGA 3CC2Z 4E2WA 4A3FI 1VHOA 2ZEDA 1Y0RA 2PIYA 2RIQA 4NB9A 2Q4ZA 4QTTA 4DYOA 3GTGI 1VHEA 5LYFA 1YJW1 5CM2M 2OOXB 4KSIA 4OIWA 5A2Qb 2PCUA 1KQSZ 4ZYQA 2IZ3A 3H8FA 2OZKA 2DE5A 2VF1A 4PXBA 5D8NA 5A2Qf 4NGTA 1Y1VI 3FF3A 4NBCA 4A38A 3IIBA 2WYRA 2V8HA 4A37A 2ANPA 4A39A 2Y0SA 2GTHA 4E31A 4A3DI 2R93I 5HVHA 1Q861 4HGYA 2AFMA 4E30A 2XEFA 2POKA 1Y1WI 2QYVA 3CXCY 1IGBA 4GM5A 2IJZA 3V38A 4ZY1A 6CPAA 4FUUA 2F4OA 4RVHA 4P4EA 4Z65A 1ZLHA 2BJOA 4MXUA 2CIJA 3B3TA 2O53A 3M4OI 2QVPA 3S14I 3K2KA 7CPAA 3LUSA 3S1RI 2RT9A 2PJ0A 2PJ7A 2PVVA 3I1UA 3D4UA 2XEIA 1ZG7A 1K9M1 1UWYA 2CTBA 3FQQA 1JQGA 4ZX8A 3B35A 4X2TA 3SI2A 2Q43A 3VB9A 2JBJA 4R7MA 3I55Z 3B3SA 1TWAI 3B3CA 5F09A 5T64A 1VQ4Z 5T6BA 4XX2A 4R8FA 4X6AI 1L1OC 3KASA 1TXRA 2RHBA 2WAQA 1VQN1 2ZENA 1TFIA 5LRGA 4F8ZA 3I551 2RFHA 3BG0B 3I4NI 1ELLP 4P4DA 1F2OA 2R92I 4MCSA 1Q812 4OC2A 3BI0A 3QWUA 1YW6A 2ZEFA 5CPAA 4YU9A 2PJ4A 2ZOGA 3FJUA 2AFZA 3JAMb 1JJ2Z 4P44A 3IFUA 3ISXA 3L2NA 4R6TA 3IX0A 1TWHI 3GTJI 3GTMI 3KL9A 1YSJA 2PJ2A 1CP7A 4MCQA 3SJFA 2NSMA 3CCQ1 4EFDA 4ZX9A 1K83I 4RVGA 5C3EI 3D6WA 3H8EA 2IQ6A 1M902 2FVGA 3CCL1 2RBLA 2QLVB 1KC82 3KIFA 4A3GI 2AFUA 5D1OB 4IHMA 3T4NB 3RZDI 3KHXA 3CCS1 3PBEA 2KPIA 1R9TI 3GTKI 3F3FC 4IK2A 4TWEA 2C6PA 4MRIA 1ZB8A 4MONA 3HOUI 3D67A 5T67A 1USPA 2GU2A 2I3CA 3EERA 5C44I 3CCRZ 3GTQI 4A3BI 2DE6A 4A93I 2VUGA 4X3RA 2C1CA 1I6HI 1LOKA 2R6MA 3GB0A 1I50I 2CF4A 1VQKZ 1YMEA 2PJ6A 1VQ81 4P4FA 3CCLZ 1VLAA 1DE4C 1VQ91 3CDXA 2WZNA 2JNYA 2JS4A 2PJ1A 3U50C 1VQ71 2JA5I 1Q7LA 1BLLE 4UIAA 2IZ4A 1ELMP 1FNOA 3CCVZ 3CC71 1RTQA 2J9AA 1BPNA 4TNUA 3MONA 2B63I 3IF8A 4OC5A 1QVGY 3S16I 2E9HA 3PO3S 3S2HI 1TWGI 4AYBA 2AFSA 2W04A 4UEZA 3CC4Z 3V7ZA 1VQM1 2EWBA 1ARLA 1KC81 1YHQZ 3HKZA 1S72Z 4A3MI 4BBRI 1WW9A 2OR4A 3CCV1 1X3WA 3CXCZ 2HC9A 3DLJA 2DE7A 3FKII 3G6E1 3GUXA 3CD6Z 3S9MA 4MD9A 3NDJA 1VQ61 2QRDB 1QQ9A 1R3NA 3FEEA 4F9VA 1N8R2 3FX6A 1Z5RA 4CPAA 1IY7A 3S9NA 5I4MA 1RO2A 5C4JI 3S17I 4MHNA 1YI21 3I561 2ZEHA 3S1QI 4BXXI 1ML8A 1Q811 1XBUA 2F8HA 2PVWA 1Q821 3NFZA 2EK8A 1S721 2C6GA 2HB6A 2NVTI 2NVXI 2ZEOA 3D66A 1VQPZ 3JRUA 1QYPA 4OC4A 3B3WA 4YWYA 5AN9F 1YUKA 3B3VA 3IFEA 1AMPA 4P4JA 1LQLA 3HOXI 2BCOA 1P9NA 2OTL1 4E2XA 4HH4A 4IAVA 2ZEPA 3QNVA 1TWFI 3B2YA 3GTPI 3SI0A 5IT9b 3CC7Z 5K8PA 1RNIA 3J80b 3CCM1 4BD9A 4BBSI 3BI1A 1RO4A 1JJ2Y 2PJAA 1YJ91 1HDUA 5ELYA 2E2HI 3DGVA 3GTOI 3D7GA 3MZLB 3NH8A 3IEHA 1QVFZ 5JH9A 3D7DA 1QVFY 2ZELA 1Y0YA 1USPB 3GKQA 2JA7I 2IMOA 3BXMA 4RVFA 2AFOA 3LMSA 1XFOA 1YI2Z 5LRKA 3KR4A 2QR1B 3VMIA 5HVGA 4FBEA 4O23A 3FH4A 3CME1 1CG2A 2AFXA 3CCMZ 2C6CA 2LIYA 2PJBA 3N5FA 1EE3P 4A3CI 3PO2I 3CCJ1 3B7IA 1K731 4EMEA 4DUKA 4Q7AA 4A3KI 1VQNZ 2JEWA 4UIBA 1VQLZ 3LWUA 1PYTB 3VATA 2OOTA 3F3PC 3D68A 2XEGA 5JGFA 2RB7A 4LQGA 2OTJZ 1ZG8A 2V8DA 5IT9f 2M6NA 3GLJA 5HVFA 2JMOA 3S15I 3MZKB 4UF4A 2GLJA 3KHZA 1VQP1 3CMA1 1XRYA 1ZLIA 4NBAA 1F2PA 3NDIA 2YADA 2PJ9A 1RQFA 1S7MA 3TE5B 4MH4A 2BO9A 3IJ3A 1Q7Y2 3KQXA 3CMAZ 4FWUA 1TF8A 4NBFA 2HF1A 3CCE1 3D9XA 3H8GA 1KRLA 4UEFA 4PXCA 2PJ8A 2GREA 2WB1A 1VQK1 3PFEA 4NGNA 5IB9A 2LFUA 4P6YA 3J81f 1M1K1 4NBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB4 X;  3CPA A;  3NH4 A;  1YW4 A;  3WAB A;  1KWM A;  1AYE A;  4NGQ A;  3VAR A;  4MHY A;  3BHX A;  4EWT A;  1LAN A;  4PXE A;  5HXD A;  1NSA A;  3ISZ A;  4PQA A;  1VIX A;  1Z2L A;  2ZEM A;  4MMO A;  4K3N A;  5LRJ A;  2PRQ A;  4DJL A;  2Q51 A;  2ZEG A;  4AXV A;  3CPX A;  1TKJ A;  4WWV A;  4P4B A;  4OME A;  5DS0 A;  3KR5 A;  1LAM A;  3PB6 X;  5K8N A;  3RBU A;  2PE3 A;  4ZI6 A;  4JYW A;  2BOA A;  3KI9 A;  4OC1 A;  4UEE A;  3FMC A;  3MN8 A;  8CPA A;  3PRT A;  5JM6 A;  4MHZ A;  4MCP A;  1H8L A;  1TF9 A;  1HDQ A;  3NA6 A;  3CT9 A;  3HLP A;  4A94 A;  3RZA A;  1FT7 A;  3RAM A;  4OID A;  1QMU A;  4P10 A;  4R76 A;  1OBR A;  4MHP A;  3FVL A;  1CBX A;  1ZG9 A;  3SJE A;  1Z8L A;  4MCR A;  4NFR A;  1CPS A;  1XJO A;  3PEI A;  5CBM A;  1CPX A;  3HUV A;  1LFW A;  3WC6 A;  1R43 A;  3MRU A;  4P4I A;  4FAI A;  2PJ3 A;  3SJG A;  1BAV A;  2PIZ A;  3D7F A;  3KGQ A;  3IC1 A;  4WJB A;  3S9L A;  5D29 A;  2PJC A;  2O4H A;  4OC3 A;  4G1P A;  1DTD A;  1XMB A;  3NH5 A;  1PCA A;  4W9Y A;  2QJ8 A;  2CTC A;  5K8O A;  4P45 A;  3PB9 X;  2GLF A;  1HEE A;  2VL1 A;  4NJR A;  4NGP A;  1Y7E A;  1VGY A;  4B6Z A;  2PJ5 A;  2JBK A;  2F7V A;  3IO1 A;  2ABZ A;  3SJX A;  1GYT A;  1ARM A;  5THW A;  4ONW A;  2V8G A;  4ZY2 A;  4F9U A;  5K8M A;  1CP6 A;  4RUH A;  3WC5 A;  3PBB A;  1BPM A;  2NYQ A;  3PB8 X;  1F57 A;  3K9T A;  3KZW A;  4OC0 A;  1LAP A;  3T8W A;  4NGR A;  1M4L A;  5LYL A;  5J1Q A;  3WC7 A;  4JZ0 A;  1TKH A;  4PXD A;  2V8V A;  4OP4 A;  5LYD A;  2DEA A;  2AFW A;  2XEJ A;  2ZOF A;  1YLO A;  3SI1 A;  4PPZ A;  3D7H A;  4H2K A;  2G9D A;  1CX8 A;  4X8I A;  5LYI A;  3PFO A;  3WT4 A;  3KQZ A;  3TX8 A;  3VH9 A;  3IWW A;  2EK9 A;  3FEC A;  1TKF A;  3PB7 X;  4OKO A;  1LCP A;  4NJQ A;  2V77 A;  2ZEE A;  4NGS A;  4ZY0 A;  3FED A;  4NGM A;  1VHO A;  2ZED A;  1Y0R A;  2PIY A;  2Q4Z A;  4DYO A;  1VHE A;  5LYF A;  4KSI A;  4OIW A;  2PCU A;  4ZYQ A;  3H8F A;  4PXB A;  5D8N A;  4NGT A;  3FF3 A;  4A38 A;  3IIB A;  2WYR A;  2V8H A;  4A37 A;  2ANP A;  4A39 A;  5HVH A;  2AFM A;  2POK A;  2QYV A;  1IGB A;  4GM5 A;  2IJZ A;  3V38 A;  4ZY1 A;  6CPA A;  4FUU A;  4P4E A;  4Z65 A;  1ZLH A;  4MXU A;  2CIJ A;  3B3T A;  2O53 A;  2QVP A;  3K2K A;  7CPA A;  2PJ0 A;  2PJ7 A;  2PVV A;  3I1U A;  3D4U A;  2XEI A;  1ZG7 A;  1UWY A;  2CTB A;  1JQG A;  4ZX8 A;  3B35 A;  4X2T A;  3SI2 A;  2Q43 A;  2JBJ A;  4R7M A;  3B3S A;  3B3C A;  5F09 A;  4R8F A;  3KAS A;  1TXR A;  4F8Z A;  5LRG A;  2ZEN A;  2RFH A;  1ELL P;  4P4D A;  1F2O A;  4MCS A;  4OC2 A;  3BI0 A;  1YW6 A;  2ZEF A;  5CPA A;  4YU9 A;  2PJ4 A;  2ZOG A;  3FJU A;  2AFZ A;  4P44 A;  4R6T A;  3ISX A;  3L2N A;  3KL9 A;  1YSJ A;  2PJ2 A;  1CP7 A;  4MCQ A;  3SJF A;  2NSM A;  4EFD A;  4ZX9 A;  3H8E A;  2IQ6 A;  2FVG A;  2AFU A;  4IHM A;  3KHX A;  3PBE A;  4IK2 A;  4TWE A;  2C6P A;  4MRI A;  3D67 A;  2I3C A;  2GU2 A;  4X3R A;  2C1C A;  3GB0 A;  1LOK A;  2CF4 A;  1YME A;  2PJ6 A;  4P4F A;  1DE4 C;  3CDX A;  2WZN A;  2PJ1 A;  1Q7L A;  1BLL E;  4UIA A;  1ELM P;  1FNO A;  1RTQ A;  2J9A A;  1BPN A;  4TNU A;  4OC5 A;  2AFS A;  4UEZ A;  3V7Z A;  2EWB A;  1ARL A;  2OR4 A;  4FWU A;  3TC8 A;  2HC9 A;  3DLJ A;  3S9M A;  3GUX A;  1QQ9 A;  4F9V A;  1R3N A;  3FEE A;  3FX6 A;  1Z5R A;  4CPA A;  1IY7 A;  3S9N A;  5I4M A;  4MHN A;  2ZEH A;  1XBU A;  2F8H A;  2PVW A;  3NFZ A;  2EK8 A;  2C6G A;  2HB6 A;  2ZEO A;  3D66 A;  3JRU A;  4OC4 A;  3B3W A;  4YWY A;  3B3V A;  3IFE A;  1AMP A;  4P4J A;  2BCO A;  4IAV A;  2ZEP A;  3QNV A;  3B2Y A;  3SI0 A;  5K8P A;  4BD9 A;  3BI1 A;  5ELY A;  2PJA A;  1HDU A;  3DGV A;  3D7G A;  3NH8 A;  3IEH A;  5JH9 A;  3D7D A;  2ZEL A;  1Y0Y A;  3BXM A;  3LMS A;  2IMO A;  2AFO A;  1XFO A;  5LRK A;  3KR4 A;  5HVG A;  4FBE A;  4O23 A;  3FH4 A;  2PJB A;  1CG2 A;  2AFX A;  2C6C A;  3N5F A;  1EE3 P;  3B7I A;  4EME A;  4DUK A;  4Q7A A;  2JEW A;  4UIB A;  3LWU A;  1PYT B;  3VAT A;  2OOT A;  3D68 A;  2XEG A;  5JGF A;  2RB7 A;  4LQG A;  1ZG8 A;  2V8D A;  3GLJ A;  5HVF A;  4UF4 A;  2GLJ A;  3KHZ A;  1XRY A;  1ZLI A;  1F2P A;  2PJ9 A;  2BO9 A;  3IJ3 A;  3KQX A;  1TF8 A;  3H8G A;  4UEF A;  4PXC A;  2PJ8 A;  2GRE A;  3PFE A;  4NGN A;  5IB9 A;  4P6Y A;  2XEF A; 
#chains in the Genus database with same CATH topology
 3PB4 X;  4NEX A;  4QB9 A;  2LEX A;  2YU9 I;  1YW4 A;  2BSW A;  3VAR A;  5A27 A;  3BHX A;  1XOV A;  2F5I A;  4Y49 B;  4NBH A;  1VQ7 Z;  4OAD A;  4XNH C;  3F5B A;  1YJ9 Z;  4GS4 A;  4RI1 A;  1YJN Z;  3QAH A;  4JXR A;  4DQY B;  1UFH A;  3CD6 1;  1KQS Y;  1X3Z A;  4E2Z A;  3JAM f;  3CCR 1;  2B3V A;  4MMO A;  5F47 A;  1M44 A;  1VQ4 1;  3CPX A;  3DDD A;  2W03 A;  3KIH A;  4PSW A;  2F4M A;  1LAM A;  2VXK A;  1YIJ Z;  2PE3 A;  4A3I I;  1MJB A;  2QA4 Z;  4MFZ A;  1Z8X A;  8CPA A;  5FLX b;  5JM6 A;  3HOZ I;  2P0W A;  1H8L A;  4A94 A;  3RZA A;  2VI7 A;  1YVK A;  3A9L A;  5AG7 A;  2QKD A;  4B13 A;  4B10 A;  2C27 A;  2Q4Y A;  2YND A;  2YGW A;  1Z8L A;  1YJW Z;  1N2F A;  3G8W A;  1M90 1;  4MCR A;  4NFR A;  3PEI A;  5CBM A;  3WC6 A;  1R43 A;  2V8J A;  1IB1 E;  1AA6 A;  3BG1 B;  4M6I A;  1K8A 1;  3SJG A;  2PIZ A;  3TO6 A;  4KOR A;  1KD1 1;  4MFP A;  5A28 A;  4WJB A;  5LL6 f;  5D29 A;  2PDO A;  1WII A;  4G1P A;  1XMB A;  3H3V J;  1PCA A;  4P45 A;  3PB9 X;  4A3L I;  4UFV A;  2KI7 B;  2VL1 A;  3I9S A;  1K4J A;  3JTK A;  2JR6 A;  1YHQ 1;  4B6Z A;  4KSF A;  3D2M A;  4CAE A;  4A31 A;  2E7Z A;  1NJI 1;  4ONW A;  5FLX f;  4ZY2 A;  2DF5 A;  2VZZ A;  3ZJ0 A;  1CP6 A;  3J7A 4;  3RO0 A;  2EGT A;  4MJ8 A;  3S1N I;  3PB8 X;  3PO3 I;  3R96 A;  3GTM S;  2Z11 A;  4NGR A;  1N71 A;  3VTN A;  5LYL A;  5J1Q A;  1RO0 A;  4JZ0 A;  1TKH A;  2V8V A;  1BOB A;  2DEA A;  3I3G A;  2XEJ A;  2ZOF A;  2R1I A;  1TIQ A;  3D7H A;  4H2K A;  3W6X A;  3M3Y I;  2PR1 A;  1CX8 A;  2FCK A;  4BY1 I;  1NE9 A;  4F0Y A;  3WT4 A;  3TX8 A;  4E33 A;  1XEB A;  4C2Y A;  4ZBG A;  4A33 A;  1LCP A;  4NJQ A;  4NBB A;  3G71 Z;  2ZEE A;  4CAF A;  1KZF A;  2QEX Z;  3CC2 Z;  4OAE A;  3IR7 A;  2V3V A;  2ARH A;  2JIR A;  3GTG I;  3EFA A;  4AVB A;  3W6S A;  4ZYQ A;  1I1D A;  2J8M A;  4NBC A;  3PP9 A;  3SXN A;  1VKC A;  4A37 A;  2ANP A;  1Q86 1;  4HGY A;  4E30 A;  2F4O A;  2BJO A;  3B3T A;  2O53 A;  2REF A;  3K2K A;  3LUS A;  3RNZ A;  3R9E A;  3SHP A;  2XEI A;  1ZG7 A;  1Y7R A;  4ZX8 A;  3SI2 A;  1IIC A;  2Q43 A;  3VB9 A;  4KS9 A;  3CXS A;  4XX2 A;  2ZW7 A;  1L1O C;  1VQN 1;  4CGN A;  3I55 1;  4MCS A;  1YW6 A;  4YU9 A;  2PJ4 A;  2ZOG A;  4P44 A;  1Y8C A;  3GTJ I;  3GTM I;  4M6H A;  1CP7 A;  1PUA A;  4MCQ A;  1MK4 A;  1J4J A;  3CCL 1;  2AFU A;  2Z0Z A;  2GU2 A;  4X3R A;  2R6M A;  2CF4 A;  2WSA A;  1VQ9 1;  2O28 A;  3U50 C;  1Q7L A;  2IZ4 A;  1ELM P;  2VPX A;  4XNH B;  1QVG Y;  2JLM A;  3PO3 S;  2OZH A;  3S2H I;  1TWG I;  4AYB A;  3NE8 A;  1FY7 A;  4MY0 A;  3V7Z A;  3CC4 Z;  3P2F A;  3HKZ A;  1S72 Z;  4A3M I;  4FWU A;  2HV2 A;  3CCV 1;  4F9V A;  1VQ6 1;  4CYN A;  2YNE A;  1IY7 A;  5C4J I;  3S17 I;  2Z3N A;  2ZEH A;  2CY2 A;  3EY5 A;  1ML8 A;  1Q81 1;  3NFZ A;  1S72 1;  2HB6 A;  4KOY A;  4YWY A;  2YNC C;  1LQL A;  3HOX I;  4E8O A;  5GCN A;  4IAV A;  2ZXV A;  4BBS I;  1RO4 A;  1JJ2 Y;  5ISV A;  3G3S A;  3IEH A;  3D7D A;  4I49 A;  5F48 A;  2JA7 I;  2IMO A;  1QXF A;  1Q2D A;  3VMI A;  4IUS A;  4UCP A;  2PJB A;  1CG2 A;  3CXP A;  3PO2 I;  4R9M A;  1VQN Z;  4NF1 A;  2B5G A;  3PGP A;  3LWU A;  1XMT A;  1PYT B;  2B3U A;  1ZG8 A;  2VPZ A;  4UF4 A;  4CRY B;  1VQP 1;  3TCV A;  2PJ9 A;  4MH4 A;  3SXO A;  1TF8 A;  2HUZ A;  1Z9U A;  2D4O A;  2GRE A;  1VQK 1;  5G22 A;  4NGN A;  2JDD A;  4P6Y A;  1M1K 1;  3NH4 A;  1WCM I;  2B4B A;  3WAB A;  4EVY A;  4EWT A;  1LAN A;  2HQY A;  2JIP A;  4PXE A;  1QVG Z;  1NP6 A;  2E2J I;  3DNS A;  3S6G A;  4DNC A;  1X0T A;  1VIX A;  5FLM I;  4MD7 A;  2BUE A;  4BMH A;  3HOW I;  1Z2L A;  2ZEM A;  2K3R A;  3GIU A;  2ZEG A;  4P4B A;  3FYN A;  2ATR A;  3PB6 X;  5K8N A;  3RBU A;  4OC1 A;  1QSM A;  4DK1 A;  4LQ6 A;  3PRT A;  1SQH A;  4HPS A;  2OB0 A;  3CT9 A;  3HLP A;  4Y49 C;  4JLY A;  1FT7 A;  4CGP A;  2HU9 A;  4U9Y A;  4HNY B;  1YUA A;  3CME Z;  3FVL A;  1CBX A;  4A2Z A;  3W91 A;  3SJE A;  1K73 2;  3S1M I;  1CPS A;  3FRM A;  5C4X I;  1CPX A;  3HUV A;  1CM0 A;  2E2I I;  3LAC A;  3KGQ A;  3R9G A;  3IC1 A;  2JDC A;  3K9U A;  2P3Y A;  2EBJ A;  2H5M A;  4CAX A;  2PJC A;  3D3S A;  4C2X A;  4AVC A;  1Q16 A;  1Z02 A;  1VQ5 Z;  1I3Q I;  1DTD A;  4E32 A;  3NH5 A;  3CPW Y;  3CCE Z;  4ONU A;  2QRE B;  4NGP A;  4BIN A;  1VGY A;  2WPW A;  2JBK A;  4MFJ A;  1XIX A;  2F7V A;  3TT2 A;  1Q86 2;  4QUS A;  5IP9 I;  2VBQ A;  2FS5 A;  2VEZ A;  5J8F A;  5THW A;  4CL1 A;  2V8G A;  2ZW4 A;  4MFK A;  4MBU A;  1PFT A;  1YX0 A;  5K8M A;  3WC5 A;  4E2A A;  2NYQ A;  4KOS A;  1M4I A;  2G2K A;  1F57 A;  1S7N A;  1YIT 1;  1LAP A;  2K5R A;  3MGD A;  3I07 A;  4RVD A;  4XPK A;  5LYD A;  4NBE A;  4YFJ A;  1N8R 1;  4XPL A;  4LUA A;  1YJN 1;  2NMT A;  1B6B A;  1VQO 1;  4X8I A;  2WUU A;  1YIJ 1;  3PFO A;  3J80 f;  3KQZ A;  1S7L A;  3BJ8 A;  3G4S Z;  2Z3K A;  4NBG A;  4E2W A;  1Y0R A;  4DYO A;  4QTT A;  2JEV A;  2JIM A;  3FNC A;  1YJW 1;  5CM2 M;  2DPT A;  2OOX B;  4OIW A;  5A2Q b;  2IZ3 A;  3H8F A;  2DE5 A;  4JXQ A;  4KUB A;  4NGT A;  1Y1V I;  4A38 A;  3IIB A;  2WYR A;  1ZO0 A;  4A39 A;  2Y0S A;  2GTH A;  4E31 A;  4A3D I;  4KVO E;  2AFM A;  2POK A;  3CXC Y;  2X7B A;  4R57 A;  2VZY A;  2IJZ A;  4ZY1 A;  4YGO A;  4P4E A;  5KTA A;  4MXU A;  4XPD C;  2CIJ A;  3M4O I;  2QVP A;  3EC4 A;  2PJ7 A;  4QC6 A;  2Q4V A;  3FQQ A;  1JQG A;  3B35 A;  2JBJ A;  5H84 A;  2FT0 A;  3I55 Z;  3B3C A;  2B4D A;  5T64 A;  1VQ4 Z;  5T6B A;  1WK4 A;  4F8Z A;  2RHB A;  5LRG A;  1TFI A;  2RFH A;  1F2O A;  4OC2 A;  5CPA A;  2AFZ A;  2Q44 A;  3D2P A;  3L2N A;  1YRE A;  2ZW5 A;  4OLL A;  1MJA A;  3SJF A;  2NSM A;  3P2H A;  4M3S A;  3D6W A;  4FD7 A;  2AYD A;  1M90 2;  3D8P A;  1IOF A;  2RBL A;  1KC8 2;  3KIF A;  3RZD I;  1WJ2 A;  3GTK I;  4KOT A;  1ZB8 A;  2GAN A;  4MON A;  1USP A;  2I3C A;  1VHS A;  2CNM A;  4CGL A;  2DE6 A;  4A93 I;  2I00 A;  1I6H I;  1I50 I;  1Z4E A;  3DR6 A;  1VLA A;  3CDX A;  2WZN A;  3TTH A;  2PJ1 A;  1V0C A;  2BL1 A;  3R1K A;  4QBJ A;  2Z3P A;  1Y9W A;  5AG6 A;  5JQ4 A;  3IF8 A;  3S16 I;  2W04 A;  3UY5 A;  1VQM 1;  1ARL A;  4ORF A;  1YHQ Z;  2CNT A;  3QAY A;  3CD6 Z;  3H4Q A;  3FX6 A;  1Z4R A;  1FDI A;  4CPA A;  2FE7 A;  2BEI A;  3S9N A;  1M1D A;  5C82 A;  5I4M A;  3I56 1;  4H6Z A;  1X10 A;  2F8H A;  5H86 A;  3R95 A;  2EK8 A;  4Q38 A;  2NVT I;  2NVX I;  3D66 A;  1VQP Z;  5G20 A;  2BCO A;  2OTL 1;  2ZEP A;  1TWF I;  3B2Y A;  2PQ8 A;  3SI0 A;  3CC7 Z;  5K8P A;  1RNI A;  3CCM 1;  4BD9 A;  5ELY A;  3DGV A;  1S3Z A;  3TOA A;  1KUV A;  2ZEL A;  1Y0Y A;  1USP B;  2OZU A;  1YI2 Z;  2OU2 A;  5LRK A;  3IWG A;  3R9F A;  1IYK A;  4KVM E;  5HVG A;  4FBE A;  2PSW A;  5BWA B;  5E96 A;  3FH4 A;  2C6C A;  2LIY A;  2J8R A;  2OOT A;  5DWN A;  2DXQ A;  3F3P C;  4KVX A;  2XEG A;  2R7H A;  5JGF A;  2OTJ Z;  2V8D A;  1OZP A;  5HVF A;  3MZK B;  2GLJ A;  3KHZ A;  2Q04 A;  1ZLI A;  5EMI A;  2PR8 A;  2BO9 A;  3IJ3 A;  1Q7Y 2;  4C7I A;  5KTD A;  2B4D B;  3FB3 A;  4R87 A;  4UEF A;  2PJ8 A;  3BLN A;  2WB1 A;  2LFU A;  1CJW A;  2XEF A;  3CPA A;  1L0C A;  3PZJ A;  3OW2 Y;  2QML A;  2IV2 X;  1KWM A;  2G3A A;  5EBV A;  2V8K A;  3TE4 A;  1P0H A;  3GKR A;  2P6G A;  5HXD A;  2B5G B;  3FIX A;  1VQO Z;  4PQA A;  1LRZ A;  2K5T A;  1VQ8 Z;  4J3G A;  1Z01 A;  1VQ9 Z;  2RPR A;  1SIW A;  4II9 A;  1KD1 2;  4K3N A;  5LRJ A;  2FSR A;  4CYQ A;  2PRQ A;  4DJL A;  2Q51 A;  4MY3 A;  1TKJ A;  4C2Z A;  1YQE A;  4OME A;  2FIW A;  5D1P A;  4B5P B;  4ZI6 A;  4JYW A;  2BOA A;  4UEE A;  3FMC A;  3MN8 A;  2R98 A;  4MHZ A;  1TF9 A;  3GTL I;  1VQM Z;  3E0K A;  1Z03 A;  4CAW A;  3RAM A;  4UWJ A;  2QRC B;  4MD8 A;  1QMU A;  4P10 A;  4R76 A;  1OBR A;  2V8I A;  1Q82 2;  4Y52 I;  4U9Z A;  4FD5 A;  4H89 A;  1XJO A;  3S2D I;  1LFW A;  3MRU A;  1WZN A;  1GHE A;  2PJ3 A;  1I12 A;  3H5Z A;  5EC4 A;  2H85 A;  4BBH A;  4M6G A;  1M4G A;  1YIT Z;  2AKL A;  3CCJ Z;  2M48 A;  2O4H A;  2B58 A;  3HOV I;  4R3L A;  3I56 Z;  3CPW Z;  3VMG A;  3J81 b;  5IX3 A;  4W9Y A;  2QJ8 A;  2CTC A;  5K8O A;  3TDH B;  1K9M 2;  1ON0 A;  2Z3L A;  1S5K A;  2CXA A;  4NJR A;  1FDO A;  2PJ5 A;  2OZG A;  2ABZ A;  1M1K 2;  1GYT A;  2NVY I;  1ARM A;  4GXH A;  4UCN A;  4QTU A;  5J8C A;  4F9U A;  4DGL A;  4BY7 I;  4CRZ B;  1Y9K A;  2NVQ I;  2EUI A;  2PMZ A;  3K9T A;  3KZW A;  1YGH A;  2JA6 I;  4OC0 A;  2AJ6 A;  1M4L A;  3CC4 1;  3CCU 1;  3WC7 A;  4R3K A;  5AG4 A;  2Z10 A;  4PXD A;  5AGE A;  3T9Y A;  2AFW A;  2R8V A;  3VWE A;  4CYP A;  1YLO A;  1YVO A;  4NH1 C;  2V45 A;  1JWQ A;  2G0B A;  2EVN A;  3WR7 A;  2ZAE B;  2G9D A;  3GY9 A;  4KOU A;  4M85 A;  1W2B Z;  1W2B Y;  1R57 A;  1IYL A;  3VH9 A;  3IWW A;  1JWH C;  2EK9 A;  2DPS A;  1QSN A;  1VQ5 1;  4JD6 A;  1TKF A;  3PB7 X;  2J6A A;  2V77 A;  4ZY0 A;  3CCS Z;  2PM9 A;  3FED A;  4NGM A;  2IL4 A;  2Q4Z A;  3CZX A;  1RO5 A;  2EO8 A;  4KSI A;  3OWC A;  4AG9 A;  2OZK A;  5HMN A;  4CGO A;  1MJ9 A;  2V8H A;  4A32 A;  5HVH A;  2QYV A;  4KOW A;  1IGB A;  4GM5 A;  3V38 A;  6CPA A;  4FUU A;  4RVH A;  2JIO A;  2KCW A;  3S14 I;  7CPA A;  3I1U A;  3D4U A;  1K9M 1;  1UWY A;  2CTB A;  4A30 A;  4R7M A;  3B3S A;  5F09 A;  4R8F A;  2PRB A;  2ODF A;  1TXR A;  2WAQ A;  5I0C A;  3BG0 B;  3I4N I;  4PSX A;  4B12 A;  1ELL P;  2OH1 A;  2R92 I;  1YK3 A;  1Q81 2;  3QWU A;  2ZEF A;  4NCZ A;  3JAM b;  1JJ2 Z;  3IX0 A;  3TO9 A;  1TWH I;  2ZW6 A;  3KL9 A;  1YSJ A;  2PJ2 A;  1K83 I;  4RVG A;  5C3E I;  3H8E A;  2IQ6 A;  4QVT A;  2FVG A;  5D1O B;  3KHX A;  3IGR A;  3PBE A;  2KPI A;  4IK2 A;  4TWE A;  2C6P A;  3JVN A;  4MRI A;  2CNS A;  4MFL A;  2ZPA A;  4A3B I;  3GTQ I;  2VUG A;  3GB0 A;  1LOK A;  1VQK Z;  1YME A;  3CCL Z;  1DE4 C;  1S7K A;  2JS4 A;  2JA5 I;  1BLL E;  4UIA A;  3T90 A;  1RTQ A;  2J9A A;  1BPN A;  2B63 I;  1B87 A;  2E9H A;  4HNX B;  4PK2 A;  1KC8 1;  2OR4 A;  4BBR I;  3CXC Z;  2HC9 A;  2VPY A;  3DLJ A;  3S9M A;  5CNP A;  1Q2Y A;  2Q7B A;  1R3N A;  3FEE A;  1Z8T A;  2Z3O A;  1RO2 A;  4MHN A;  2C6G A;  2ZEO A;  4MI4 A;  3JRU A;  4OC4 A;  4C7H A;  5AN9 F;  1YUK A;  3B3V A;  3IFE A;  3V8I A;  1AMP A;  1P9N A;  4E2X A;  3QNV A;  2P6E A;  4B5O A;  5IT9 b;  3J80 b;  4HKF A;  3F0A A;  1HDU A;  3D7G A;  3GTO I;  4CYO A;  3MZL B;  1YR0 A;  5JH9 A;  3GKQ A;  4RVF A;  2AFO A;  3N7Z A;  3KR4 A;  4KOX A;  3CME 1;  3N5F A;  1XE4 A;  2REE A;  5JPH A;  4A3C I;  2GFQ A;  3B7I A;  4Q7A A;  2JEW A;  4UIB A;  4KUA A;  4MFQ A;  3VAT A;  4KOV A;  3D68 A;  2RB7 A;  2M6N A;  3GLJ A;  3CMA 1;  1F2P A;  2YAD A;  1RQF A;  1S7M A;  3KQX A;  3CMA Z;  3H8G A;  5G21 A;  3D9X A;  1KRL A;  2FXF A;  4JWP A;  4PK3 A;  4KLW A;  5IB9 A;  3G6E Z;  4RS4 A;  4NB8 A;  2VUM I;  3D2L A;  1AYE A;  4NGQ A;  4MHY A;  1NMT A;  1PU9 A;  4X5K A;  4B11 A;  5DWM A;  2FIA A;  1NSA A;  3ISZ A;  1IOI A;  1SFO I;  4NOZ A;  4KLV A;  3ESW A;  2Q0Y A;  4AXV A;  4WWV A;  5DS0 A;  3KR5 A;  4UFW A;  4Q36 A;  3S6H A;  3KI9 A;  4KZT A;  1I21 A;  5F49 A;  4EWC A;  1S60 A;  1RLY A;  4U5Y A;  4MCP A;  1NJI 2;  1HDQ A;  3NA6 A;  3G71 1;  1Q7Y 1;  2JUB A;  4E2Y A;  1ZB9 A;  2PK7 A;  3CCU Z;  3TOB A;  4RN7 A;  4B5P A;  4OID A;  4LX9 A;  4NXY A;  2VQY A;  4MHP A;  3CQZ I;  5HH1 A;  3CXQ A;  5C88 A;  1ZG9 A;  3OW2 Z;  2Y0M A;  3Q87 A;  3RZO I;  4P4I A;  4FAI A;  1QST A;  4B14 A;  1BAV A;  4HGZ A;  3D7F A;  2QIR A;  4XPD B;  1Y1V S;  3K7A I;  2WPX A;  5FVJ A;  3S9L A;  3QB8 A;  3C26 A;  1K8A 2;  3P5J B;  4CGM A;  4OC3 A;  3DR8 A;  5F46 A;  5G1Z A;  2R7Z I;  1NUI A;  4L8A A;  5IV0 A;  2FL4 A;  3FBU A;  1A2Z A;  2P6F A;  1Z8W A;  1ZH1 A;  1P4N A;  3HOY I;  2GLF A;  4S1T A;  1HEE A;  1Y7E A;  3IO1 A;  2OTL Z;  3SJX A;  1VQL 1;  4CS0 B;  5IP7 I;  3EED A;  2P28 A;  2OOY B;  1RXT A;  1DL6 A;  4AG7 A;  4CAV A;  3G4S 1;  1IU8 A;  4F0X A;  3VMH A;  2AE6 A;  3FQM A;  4RUH A;  3H0G I;  2GTI A;  3PBB A;  1BPM A;  1TWC I;  4A3E I;  3CC2 1;  4UWI A;  3LD2 A;  1NSL A;  4UBR A;  3T8W A;  3EO4 A;  3I4M I;  4YRH A;  4OP4 A;  1QSO A;  4A95 A;  1S7F A;  4PV6 A;  1YLE A;  2NAP A;  3SI1 A;  3LOD A;  4PPZ A;  4RV9 A;  2QA4 1;  2JA8 I;  5D1O A;  3CCQ Z;  1VQ6 Z;  5LYI A;  1QF8 A;  3ZZI A;  2QEX 1;  1WWZ A;  4Y7N I;  2GIV A;  3TO7 A;  3FEC A;  2OTJ 1;  4OKO A;  3FXT A;  4A3J I;  1KUX A;  2QEC A;  1Q2C A;  4NGS A;  3GCF A;  4K30 A;  4JJX A;  1VHO A;  4A3F I;  2ZED A;  4L89 A;  2PIY A;  2RIQ A;  4NB9 A;  4FD6 A;  1VHE A;  5LYF A;  1U6M A;  1XF8 A;  2PCU A;  1KQS Z;  2A4N A;  4PXB A;  2VF1 A;  5D8N A;  5A2Q f;  3FF3 A;  1X12 A;  5IB0 A;  2R93 I;  1Y1W I;  2I79 A;  3B8G A;  5KTC A;  2J8N A;  4Z65 A;  1ZLH A;  3S6F A;  3S1R I;  2RT9 A;  2PJ0 A;  2PVV A;  4HNW B;  4X2T A;  1TWA I;  3F8K A;  4X6A I;  4F6A A;  3KAS A;  4UCM A;  2ZEN A;  4IF5 A;  2JIQ A;  4P4D A;  2YNC A;  3BI0 A;  4MHD A;  3VWD A;  3FJU A;  4R6T A;  3IFU A;  3ISX A;  2GE3 A;  3KKW A;  4EFD A;  3CCQ 1;  2Z3M A;  4ZX9 A;  3TFY A;  2QLV B;  4A3G I;  4UA3 A;  2VPW A;  4IHM A;  3T4N B;  3CCS 1;  1R9T I;  3F3F C;  3HOU I;  3D67 A;  5T67 A;  1BO4 A;  3EER A;  5C44 I;  3CCR Z;  2C1C A;  3IU2 A;  2PJ6 A;  1VQ8 1;  4P4F A;  2RC4 A;  2JNY A;  3BJ7 A;  1VQ7 1;  3GYA A;  2Q7S A;  3NE7 A;  1QSR A;  1FNO A;  3CCV Z;  3CC7 1;  4TNU A;  1IID A;  4ZGY B;  3MON A;  4OC5 A;  4NSQ A;  2AFS A;  4UEZ A;  2EWB A;  3S6K A;  4C68 A;  3IWE A;  1WW9 A;  3TC8 A;  1X3W A;  2DE7 A;  3FKI I;  3G6E 1;  2D4P A;  3GUX A;  4MD9 A;  3NDJ A;  1QQ9 A;  2QRD B;  3IU1 A;  4FD4 A;  1N8R 2;  1Z5R A;  1YI2 1;  5AG5 A;  3S1Q I;  4BXX I;  1XBU A;  2PVW A;  1Q82 1;  4UFX A;  3EXN A;  1QYP A;  3B3W A;  3JUW A;  4P4J A;  4HH4 A;  3GTP I;  3RYO A;  3BI1 A;  2PJA A;  1YJ9 1;  2E2H I;  3NH8 A;  1QVF Z;  1QVF Y;  3BXM A;  3LMS A;  2PC1 A;  1AUG A;  1XFO A;  2QR1 B;  3DSB A;  4E0A A;  4O23 A;  2AFX A;  3CCM Z;  1EE3 P;  3CCJ 1;  1K73 1;  4EME A;  4DUK A;  4A3K I;  1VQL Z;  2G3T A;  4LQG A;  4AB7 A;  1KUY A;  5IT9 f;  4AVA A;  2JMO A;  3S15 I;  1XRY A;  4NBA A;  4H6U A;  3NDI A;  4KSA A;  4RS2 A;  3TE5 B;  4NBF A;  2HF1 A;  3CCE 1;  4PXC A;  3PFE A;  3J81 f;  1M4D A;  4NBD A; 
#chains in the Genus database with same CATH homology
 3G6E Z;  3PB4 X;  3CPA A;  4RS4 A;  3NH4 A;  3OW2 Y;  4NB8 A;  1WCM I;  2YU9 I;  1YW4 A;  2VUM I;  3WAB A;  1KWM A;  1AYE A;  4NGQ A;  3VAR A;  2V8K A;  4MHY A;  3BHX A;  4EWT A;  1LAN A;  4PXE A;  1QVG Z;  1NP6 A;  5HXD A;  4NBH A;  2E2J I;  1NSA A;  1VQ7 Z;  3ISZ A;  1VQO Z;  4PQA A;  1YJ9 Z;  1VQ8 Z;  1YJN Z;  1Z01 A;  1VQ9 Z;  1SFO I;  4DQY B;  1X0T A;  2RPR A;  4NOZ A;  3CD6 1;  1KQS Y;  1X3Z A;  4E2Z A;  3JAM f;  3CCR 1;  1VIX A;  5FLM I;  4MD7 A;  3HOW I;  1Z2L A;  1KD1 2;  2ZEM A;  4MMO A;  4K3N A;  5LRJ A;  2K3R A;  3ESW A;  2PRQ A;  4DJL A;  2Q51 A;  2ZEG A;  4AXV A;  1VQ4 1;  3CPX A;  1TKJ A;  2W03 A;  4WWV A;  4P4B A;  4OME A;  5DS0 A;  3KR5 A;  3KIH A;  2F4M A;  5D1P A;  1LAM A;  3PB6 X;  1YIJ Z;  5K8N A;  3RBU A;  2PE3 A;  4ZI6 A;  4JYW A;  4A3I I;  2BOA A;  3KI9 A;  4OC1 A;  4UEE A;  2QA4 Z;  3FMC A;  3MN8 A;  4DK1 A;  8CPA A;  3PRT A;  5FLX b;  4EWC A;  5JM6 A;  1RLY A;  4MHZ A;  3HOZ I;  4MCP A;  1H8L A;  1TF9 A;  1NJI 2;  1HDQ A;  3NA6 A;  3CT9 A;  3HLP A;  3GTL I;  4A94 A;  1VQM Z;  3G71 1;  3RZA A;  1Q7Y 1;  1Z03 A;  1FT7 A;  2JUB A;  4E2Y A;  1ZB9 A;  2PK7 A;  2HU9 A;  3CCU Z;  3RAM A;  1YUA A;  2QRC B;  4OID A;  4MD8 A;  1QMU A;  2QKD A;  4P10 A;  4R76 A;  1OBR A;  4MHP A;  3CME Z;  3FVL A;  1CBX A;  3CQZ I;  1ZG9 A;  3SJE A;  3OW2 Z;  1Z8L A;  1YJW Z;  1N2F A;  1Q82 2;  2V8I A;  4Y52 I;  1K73 2;  3S1M I;  1M90 1;  4MCR A;  4NFR A;  1CPS A;  1XJO A;  3PEI A;  3Q87 A;  5CBM A;  3RZO I;  5C4X I;  1CPX A;  3S2D I;  1LFW A;  3HUV A;  1R43 A;  3MRU A;  3WC6 A;  2V8J A;  4P4I A;  4FAI A;  2E2I I;  2PJ3 A;  3BG1 B;  1K8A 1;  3SJG A;  1BAV A;  2PIZ A;  4HGZ A;  3D7F A;  3KGQ A;  1KD1 1;  3IC1 A;  1Y1V S;  3K7A I;  2H85 A;  4WJB A;  3S9L A;  1YIT Z;  5LL6 f;  1K8A 2;  2AKL A;  2P3Y A;  1WII A;  5D29 A;  3P5J B;  3CCJ Z;  2PJC A;  2M48 A;  2O4H A;  1Z02 A;  4OC3 A;  1VQ5 Z;  4G1P A;  1I3Q I;  1DTD A;  2R7Z I;  3HOV I;  1NUI A;  4E32 A;  1XMB A;  3NH5 A;  3CPW Y;  3I56 Z;  3H3V J;  3CCE Z;  3CPW Z;  3VMG A;  1PCA A;  3J81 b;  1ZH1 A;  4W9Y A;  2QJ8 A;  2CTC A;  5K8O A;  3TDH B;  1K9M 2;  4P45 A;  3PB9 X;  4A3L I;  2QRE B;  3HOY I;  2GLF A;  4S1T A;  1HEE A;  2KI7 B;  2VL1 A;  4NJR A;  4NGP A;  1Y7E A;  1VGY A;  2JR6 A;  1YHQ 1;  4B6Z A;  2PJ5 A;  2JBK A;  2F7V A;  3IO1 A;  2ABZ A;  2OTL Z;  1M1K 2;  3SJX A;  1VQL 1;  1Q86 2;  5IP7 I;  1GYT A;  5IP9 I;  2NVY I;  3EED A;  1NJI 1;  2P28 A;  2OOY B;  1ARM A;  3TC8 A;  5THW A;  4CL1 A;  4ONW A;  2V8G A;  4QTU A;  5FLX f;  1DL6 A;  4ZY2 A;  3G4S 1;  1PFT A;  4F9U A;  4DGL A;  3VMH A;  5K8M A;  4BY7 I;  1CP6 A;  3FQM A;  4RUH A;  3J7A 4;  2EGT A;  3WC5 A;  3H0G I;  3S1N I;  2GTI A;  3PBB A;  2NVQ I;  2PMZ A;  1BPM A;  2NYQ A;  1TWC I;  4A3E I;  2G2K A;  3CC2 1;  3PB8 X;  1F57 A;  3K9T A;  3KZW A;  2JA6 I;  1YIT 1;  4OC0 A;  3PO3 I;  3GTM S;  1LAP A;  2K5R A;  4NGR A;  3T8W A;  1M4L A;  3VTN A;  3CC4 1;  3CCU 1;  5LYL A;  3I4M I;  3WC7 A;  5J1Q A;  1RO0 A;  4JZ0 A;  3I07 A;  1TKH A;  4PXD A;  2V8V A;  4RVD A;  4OP4 A;  5LYD A;  4NBE A;  2DEA A;  1N8R 1;  2AFW A;  2XEJ A;  2ZOF A;  1YLO A;  3SI1 A;  4NH1 C;  1YJN 1;  4PPZ A;  3D7H A;  4RV9 A;  4H2K A;  2QA4 1;  2ZAE B;  2JA8 I;  1VQO 1;  2G9D A;  3M3Y I;  1CX8 A;  5D1O A;  3CCQ Z;  4BY1 I;  1VQ6 Z;  4X8I A;  5LYI A;  1YIJ 1;  3PFO A;  1QF8 A;  1W2B Z;  2QEX 1;  3J80 f;  4Y7N I;  1W2B Y;  3WT4 A;  3KQZ A;  3TX8 A;  3VH9 A;  4E33 A;  3IWW A;  1JWH C;  2EK9 A;  3G4S Z;  1VQ5 1;  3FEC A;  2OTJ 1;  1TKF A;  3PB7 X;  4OKO A;  2J6A A;  1LCP A;  4NJQ A;  4NBB A;  4A3J I;  2V77 A;  3G71 Z;  2ZEE A;  4NGS A;  3GCF A;  4ZY0 A;  3CCS Z;  2PM9 A;  3FED A;  4NGM A;  2QEX Z;  4NBG A;  3CC2 Z;  4E2W A;  4A3F I;  1VHO A;  2ZED A;  1Y0R A;  2PIY A;  2RIQ A;  4NB9 A;  2Q4Z A;  4QTT A;  4DYO A;  3GTG I;  1VHE A;  5LYF A;  1YJW 1;  5CM2 M;  2OOX B;  4KSI A;  4OIW A;  5A2Q b;  2PCU A;  1KQS Z;  4ZYQ A;  2IZ3 A;  3H8F A;  2OZK A;  2DE5 A;  2VF1 A;  4PXB A;  5D8N A;  5A2Q f;  4NGT A;  1Y1V I;  3FF3 A;  4NBC A;  4A38 A;  3IIB A;  2WYR A;  2V8H A;  4A37 A;  2ANP A;  4A39 A;  2Y0S A;  2GTH A;  4E31 A;  4A3D I;  2R93 I;  5HVH A;  1Q86 1;  4HGY A;  2AFM A;  4E30 A;  2XEF A;  2POK A;  1Y1W I;  2QYV A;  3CXC Y;  1IGB A;  4GM5 A;  2IJZ A;  3V38 A;  4ZY1 A;  6CPA A;  4FUU A;  2F4O A;  4RVH A;  4P4E A;  4Z65 A;  1ZLH A;  2BJO A;  4MXU A;  2CIJ A;  3B3T A;  2O53 A;  3M4O I;  2QVP A;  3S14 I;  3K2K A;  7CPA A;  3LUS A;  3S1R I;  2RT9 A;  2PJ0 A;  2PJ7 A;  2PVV A;  3I1U A;  3D4U A;  2XEI A;  1ZG7 A;  1K9M 1;  1UWY A;  2CTB A;  3FQQ A;  1JQG A;  4ZX8 A;  3B35 A;  4X2T A;  3SI2 A;  2Q43 A;  3VB9 A;  2JBJ A;  4R7M A;  3I55 Z;  3B3S A;  1TWA I;  3B3C A;  5F09 A;  5T64 A;  1VQ4 Z;  5T6B A;  4XX2 A;  4R8F A;  4X6A I;  1L1O C;  3KAS A;  1TXR A;  2RHB A;  2WAQ A;  1VQN 1;  2ZEN A;  1TFI A;  5LRG A;  4F8Z A;  3I55 1;  2RFH A;  3BG0 B;  3I4N I;  1ELL P;  4P4D A;  1F2O A;  2R92 I;  4MCS A;  1Q81 2;  4OC2 A;  3BI0 A;  3QWU A;  1YW6 A;  2ZEF A;  5CPA A;  4YU9 A;  2PJ4 A;  2ZOG A;  3FJU A;  2AFZ A;  3JAM b;  1JJ2 Z;  4P44 A;  3IFU A;  3ISX A;  3L2N A;  4R6T A;  3IX0 A;  1TWH I;  3GTJ I;  3GTM I;  3KL9 A;  1YSJ A;  2PJ2 A;  1CP7 A;  4MCQ A;  3SJF A;  2NSM A;  3CCQ 1;  4EFD A;  4ZX9 A;  1K83 I;  4RVG A;  5C3E I;  3D6W A;  3H8E A;  2IQ6 A;  1M90 2;  2FVG A;  3CCL 1;  2RBL A;  2QLV B;  1KC8 2;  3KIF A;  4A3G I;  2AFU A;  5D1O B;  4IHM A;  3T4N B;  3RZD I;  3KHX A;  3CCS 1;  3PBE A;  2KPI A;  1R9T I;  3GTK I;  3F3F C;  4IK2 A;  4TWE A;  2C6P A;  4MRI A;  1ZB8 A;  4MON A;  3HOU I;  3D67 A;  5T67 A;  1USP A;  2GU2 A;  2I3C A;  3EER A;  5C44 I;  3CCR Z;  3GTQ I;  4A3B I;  2DE6 A;  4A93 I;  2VUG A;  4X3R A;  2C1C A;  1I6H I;  1LOK A;  2R6M A;  3GB0 A;  1I50 I;  2CF4 A;  1VQK Z;  1YME A;  2PJ6 A;  1VQ8 1;  4P4F A;  3CCL Z;  1VLA A;  1DE4 C;  1VQ9 1;  3CDX A;  2WZN A;  2JNY A;  2JS4 A;  2PJ1 A;  3U50 C;  1VQ7 1;  2JA5 I;  1Q7L A;  1BLL E;  4UIA A;  2IZ4 A;  1ELM P;  1FNO A;  3CCV Z;  3CC7 1;  1RTQ A;  2J9A A;  1BPN A;  4TNU A;  3MON A;  2B63 I;  3IF8 A;  4OC5 A;  1QVG Y;  3S16 I;  2E9H A;  3PO3 S;  3S2H I;  1TWG I;  4AYB A;  2AFS A;  2W04 A;  4UEZ A;  3CC4 Z;  3V7Z A;  1VQM 1;  2EWB A;  1ARL A;  1KC8 1;  1YHQ Z;  3HKZ A;  1S72 Z;  4A3M I;  4BBR I;  1WW9 A;  2OR4 A;  3CCV 1;  1X3W A;  3CXC Z;  2HC9 A;  3DLJ A;  2DE7 A;  3FKI I;  3G6E 1;  3GUX A;  3CD6 Z;  3S9M A;  4MD9 A;  3NDJ A;  1VQ6 1;  2QRD B;  1QQ9 A;  1R3N A;  3FEE A;  4F9V A;  1N8R 2;  3FX6 A;  1Z5R A;  4CPA A;  1IY7 A;  3S9N A;  5I4M A;  1RO2 A;  5C4J I;  3S17 I;  4MHN A;  1YI2 1;  3I56 1;  2ZEH A;  3S1Q I;  4BXX I;  1ML8 A;  1Q81 1;  1XBU A;  2F8H A;  2PVW A;  1Q82 1;  3NFZ A;  2EK8 A;  1S72 1;  2C6G A;  2HB6 A;  2NVT I;  2NVX I;  2ZEO A;  3D66 A;  1VQP Z;  3JRU A;  1QYP A;  4OC4 A;  3B3W A;  4YWY A;  5AN9 F;  1YUK A;  3B3V A;  3IFE A;  1AMP A;  4P4J A;  1LQL A;  3HOX I;  2BCO A;  1P9N A;  2OTL 1;  4E2X A;  4HH4 A;  4IAV A;  2ZEP A;  3QNV A;  1TWF I;  3B2Y A;  3GTP I;  3SI0 A;  5IT9 b;  3CC7 Z;  5K8P A;  1RNI A;  3J80 b;  3CCM 1;  4BD9 A;  4BBS I;  3BI1 A;  1RO4 A;  1JJ2 Y;  2PJA A;  1YJ9 1;  1HDU A;  5ELY A;  2E2H I;  3DGV A;  3GTO I;  3D7G A;  3MZL B;  3NH8 A;  3IEH A;  1QVF Z;  5JH9 A;  3D7D A;  1QVF Y;  2ZEL A;  1Y0Y A;  1USP B;  3GKQ A;  2JA7 I;  2IMO A;  3BXM A;  4RVF A;  2AFO A;  3LMS A;  1XFO A;  1YI2 Z;  5LRK A;  3KR4 A;  2QR1 B;  3VMI A;  5HVG A;  4FBE A;  4O23 A;  3FH4 A;  3CME 1;  1CG2 A;  2AFX A;  3CCM Z;  2C6C A;  2LIY A;  2PJB A;  3N5F A;  1EE3 P;  4A3C I;  3PO2 I;  3CCJ 1;  3B7I A;  1K73 1;  4EME A;  4DUK A;  4Q7A A;  4A3K I;  1VQN Z;  2JEW A;  4UIB A;  1VQL Z;  3LWU A;  1PYT B;  3VAT A;  2OOT A;  3F3P C;  3D68 A;  2XEG A;  5JGF A;  2RB7 A;  4LQG A;  2OTJ Z;  1ZG8 A;  2V8D A;  5IT9 f;  2M6N A;  3GLJ A;  5HVF A;  2JMO A;  3S15 I;  3MZK B;  4UF4 A;  2GLJ A;  3KHZ A;  1VQP 1;  3CMA 1;  1XRY A;  1ZLI A;  4NBA A;  1F2P A;  3NDI A;  2YAD A;  2PJ9 A;  1RQF A;  1S7M A;  3TE5 B;  4MH4 A;  2BO9 A;  3IJ3 A;  1Q7Y 2;  3KQX A;  3CMA Z;  4FWU A;  1TF8 A;  4NBF A;  2HF1 A;  3CCE 1;  3D9X A;  3H8G A;  1KRL A;  4UEF A;  4PXC A;  2PJ8 A;  2GRE A;  2WB1 A;  1VQK 1;  3PFE A;  4NGN A;  5IB9 A;  2LFU A;  4P6Y A;  3J81 f;  1M1K 1;  4NBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...