3VTNA

The crystal structure of the c-terminal domain of mu phage central spike - pt derivative for mad
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
71
structure length
71
Chain Sequence
RIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITAPDAIINGKSTDKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Protein gp45
publication title Crystal structure of the C-terminal domain of Mu phage central spike and functions of bound calcium ion
pubmed doi rcsb
source organism Enterobacteria phage mu
total genus 3
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18715 Phage_spike Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.540 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3vtnA01
3VTNA
chains in the Genus database with same CATH superfamily
3FKII 2OTL1 3JAMf 3EEDA 1NJI2 4MONA 1Y1VI 3CXCY 2E2II 4NBCA 1S7MA 3CCSZ 4RVHA 5T6BA 2DE6A 3GTQI 1Q812 3CD61 1WIIA 5FLXb 1VQ7Z 3PO2I 3FQQA 1YUAA 3GCFA 2NVXI 1VQMZ 1L1OC 3TDHB 1LQLA 4MD7A 1K8A1 3NDIA 3IFUA 4NBHA 1P9NA 2J6AA 5LL6f 3MZKB 4E31A 2IV2X 4AYBA 3MONA 1I50I 1VQP1 3I07A 4RVFA 1JJ2Z 1Y1VS 1K83I 2R6MA 3CCQ1 1N8R2 2QRCB 5C4JI 1WCMI 3J81f 3G71Z 4HH4A 1YJNZ 3I551 4NFRA 3S1QI 2QA41 2Q51A 2G2KA 3J7A4 5C44I 3VMHA 2JUBA 4BBSI 4E33A 1JJ2Y 2OOXB 4EWCA 2JIRA 5IT9b 2H85A 1VQO1 1VQ91 2GTIA 1N2FA 1QVFZ 3S15I 3GTMI 1QVGZ 2JS4A 1VQ61 5D1OA 2RHBA 1USPA 3OW2Y 2JMOA 1YIJ1 3D2LA 3CMAZ 4NH1C 3J80f 1S721 1Q862 4MD8A 1VQN1 2JIQA 4RS4A 2W04A 4NBEA 2OOYB 2VPWA 4CL1A 3G6EZ 2OZKA 3GTMS 2YADA 2NVQI 1PFTA 4BBRI 3HOUI 1QYPA 3CCEZ 5AN9F 1M902 3CC41 1YI21 4RV9A 2WAQA 3HOWI 1VQ51 2I3CA 1Q861 1KQSZ 1KD12 3CCU1 3CPWZ 1VQ81 1Q822 3CCRZ 1KRLA 2K3RA 3HOVI 3GKQA 1RO4A 3S2HI 2LIYA 1Q7Y2 2OTLZ 2PM9A 2R93I 5A2Qf 2VPYA 1M901 3CQZI 2V45A 2QKDA 3KIFA 4A3JI 1KQSY 4A93I 3CPWY 2R7ZI 4E2ZA 4QTUA 3CC21 2JA5I 4NBGA 1VQ4Z 3H3VJ 1KD11 2RBLA 1VQL1 1Q821 2E2JI 2RPRA 3KIHA 3BG1B 4MRIA 1X3WA 4Y52I 4DK1A 3U50C 2AKLA 3CCQZ 3F3PC 3I561 4NB8A 3I4MI 4BXXI 2E2HI 3NH5A 1M1K2 3JAMb 1YHQZ 1RO0A 1ZB8A 4A3DI 1TWCI 3NDJA 1NJI1 3CCS1 4DGLA 3I55Z 1QF8A 2QA4Z 4E32A 1RQFA 1Q811 2P28A 2QR1B 1VQM1 2QEX1 2K5RA 4S1TA 1RNIA 3S17I 3H0GI 2IZ3A 3S16I 1VQOZ 3D9XA 1TWGI 2F4MA 2O4HA 4DQYB 2F4OA 1X0TA 4HGYA 3VMGA 2ZAEB 1VQ6Z 1VLAA 1N8R1 1YJ9Z 2VPXA 3J81b 1YIJZ 3G711 1DL6A 1JWHC 1YJWZ 1YJN1 1KC82 1VQKZ 1QXFA 4A3LI 1SFOI 4MH4A 1Y8CA 1WW9A 5IP7I 3CCJ1 3S2DI 3GTKI 5IP9I 2V8IA 3G4S1 1W2BZ 3GTGI 3VB9A 4MXUA 1K9M2 3RZOI 1QVFY 2JIOA 2PMZA 3NH8A 3CCL1 1QVGY 3S1NI 1YI2Z 5D1OB 3HKZA 1USPB 4A3EI 2OTJZ 2KI7B 1YUKA 2GTHA 3K7AI 4NBAA 4NBBA 1VQ5Z 2B63I 2EGTA 3P5JB 3D6WA 3J80b 1VQ8Z 2Y0SA 1W2BY 4RVDA 2QRDB 2VF1A 2V3VA 1SIWA 3MZLB 4TNUA 3ESWA 2RIQA 3CMEZ 3CC71 2VUGA 4NBFA 3CCMZ 1NUIA 3F3FC 3CCV1 4A3II 3Q87A 4NOZA 3IF8A 1WZNA 2AYDA 1YIT1 3EERA 3CD6Z 4X6AI 5FLXf 4A3MI 1K8A2 1VQLZ 4E30A 2DE7A 3M3YI 1I3QI 1FDOA 2E7ZA 1TFIA 1X3ZA 3CCR1 2M48A 3I56Z 3S14I 1TWAI 1VQPZ 5C3EI 1Q7Y1 5A2Qb 3M4OI 4XX2A 2JA8I 4E2XA 1ZH1A 4A3KI 2JIMA 5T64A 2JIPA 2QEXZ 1VQ71 2IZ4A 3GTLI 1VQ41 1Q16A 3TE5B 3T4NB 1Z01A 1WJ2A 3HOZI 1I6HI 3GTPI 5IT9f 1VQ9Z 1K732 3VMIA 1YHQ1 2HF1A 1Z02A 3QWUA 1M1K1 2DE5A 2VUMI 2JA6I 3IX0A 3OW2Z 2LEXA 3CCJZ 1S72Z 2LFUA 4A3GI 3LUSA 4NBDA 1VQNZ 2Q4ZA 3G4SZ 4BY1I 2W03A 1RO2A 4MD9A 2V8KA 4Y7NI 2PK7A 3CCLZ 1K731 3HOYI 1Z03A 2JNYA 4RVGA 4HGZA 5CM2M 3CC4Z 3IR7A 3I4NI 1YJ91 2VPZA 1ML8A 3GTOI 2E9HA 1NP6A 1YJW1 3FQMA 1VQK1 4QTTA 1R9TI 1TWHI 1AA6A 4E2YA 1KC81 2HU9A 3CMA1 3CCUZ 5C4XI 3CC7Z 4NB9A 2JA7I 2JR6A 4E2WA 3S1MI 3RZDI 5D1PA 3CCVZ 3PO3I 2R92I 2NVTI 2O53A 3NH4A 4A3CI 1K9M1 1FDIA 3BG0B 3G6E1 1YITZ 4A3BI 1ZB9A 3S1RI 2NVYI 2BJOA 2YU9I 5FLMI 2OTJ1 2P3YA 3CCE1 3GTJI 3NFZA 3CXCZ 3CC2Z 1Y1WI 2NAPA 2M6NA 2QLVB 2QREB 2RT9A 3VTNA 4A3FI 3PO3S 2GU2A 3CME1 1TWFI 2KPIA 3CCM1 5T67A 2WB1A 4BY7I 2V8JA 1RLYA 3HOXI
chains in the Genus database with same CATH topology
3FKII 2OTL1 3JAMf 3EEDA 1NJI2 4MONA 1Y1VI 3CXCY 2E2II 4NBCA 1S7MA 3CCSZ 4RVHA 5T6BA 2DE6A 3GTQI 1Q812 3CD61 1WIIA 5FLXb 1VQ7Z 3PO2I 3FQQA 1YUAA 3GCFA 2NVXI 1VQMZ 1L1OC 3TDHB 1LQLA 4MD7A 1K8A1 3NDIA 3IFUA 4NBHA 1P9NA 2J6AA 5LL6f 3MZKB 4E31A 4AYBA 3MONA 1I50I 1VQP1 3I07A 4RVFA 1JJ2Z 1Y1VS 1K83I 2R6MA 3CCQ1 1N8R2 2QRCB 5C4JI 1WCMI 3J81f 3G71Z 4HH4A 1YJNZ 3I551 4NFRA 3S1QI 2QA41 2Q51A 2G2KA 3J7A4 5C44I 3VMHA 2JUBA 4BBSI 4E33A 1JJ2Y 2OOXB 4EWCA 5IT9b 2H85A 1VQO1 1VQ91 2GTIA 1N2FA 1QVFZ 3S15I 3GTMI 1QVGZ 2JS4A 1VQ61 5D1OA 2RHBA 1USPA 3OW2Y 2JMOA 1YIJ1 3CMAZ 4NH1C 3J80f 1S721 1Q862 4MD8A 1VQN1 4RS4A 2W04A 4NBEA 2OOYB 4CL1A 3G6EZ 2OZKA 3GTMS 2YADA 2NVQI 1PFTA 4BBRI 3HOUI 1QYPA 3CCEZ 5AN9F 1M902 3CC41 1YI21 4RV9A 2WAQA 3HOWI 1VQ51 2I3CA 1Q861 1KQSZ 1KD12 3CCU1 3CPWZ 1VQ81 1Q822 3CCRZ 1KRLA 2K3RA 3HOVI 3GKQA 1RO4A 3S2HI 2LIYA 1Q7Y2 2OTLZ 2PM9A 2R93I 5A2Qf 1M901 3CQZI 2QKDA 3KIFA 4A3JI 1KQSY 4A93I 3CPWY 2R7ZI 4E2ZA 4QTUA 3CC21 2JA5I 4NBGA 1VQ4Z 3H3VJ 1KD11 2RBLA 1VQL1 1Q821 2E2JI 2RPRA 3KIHA 3BG1B 4MRIA 1X3WA 4Y52I 4DK1A 3U50C 2AKLA 3CCQZ 3F3PC 3I561 4NB8A 3I4MI 4BXXI 2E2HI 3NH5A 1M1K2 3JAMb 1YHQZ 1RO0A 1ZB8A 4A3DI 1TWCI 3NDJA 1NJI1 3CCS1 4DGLA 3I55Z 1QF8A 2QA4Z 4E32A 1RQFA 1Q811 2P28A 2QR1B 1VQM1 2QEX1 2K5RA 4S1TA 1RNIA 3S17I 3H0GI 2IZ3A 3S16I 1VQOZ 3D9XA 1TWGI 2F4MA 2O4HA 4DQYB 2F4OA 1X0TA 4HGYA 3VMGA 2ZAEB 1VQ6Z 1VLAA 1N8R1 1YJ9Z 3J81b 1YIJZ 3G711 1DL6A 1JWHC 1YJWZ 1YJN1 1KC82 1VQKZ 4A3LI 1SFOI 4MH4A 1WW9A 5IP7I 3CCJ1 3S2DI 3GTKI 5IP9I 2V8IA 3G4S1 1W2BZ 3GTGI 3VB9A 4MXUA 1K9M2 3RZOI 1QVFY 2PMZA 3NH8A 3CCL1 1QVGY 3S1NI 1YI2Z 5D1OB 3HKZA 1USPB 4A3EI 2OTJZ 2KI7B 1YUKA 2GTHA 3K7AI 4NBAA 4NBBA 1VQ5Z 2B63I 2EGTA 3P5JB 3D6WA 3J80b 1VQ8Z 2Y0SA 1W2BY 4RVDA 2QRDB 2VF1A 3MZLB 4TNUA 3ESWA 2RIQA 3CMEZ 3CC71 2VUGA 4NBFA 3CCMZ 1NUIA 3F3FC 3CCV1 4A3II 3Q87A 4NOZA 3IF8A 1YIT1 3EERA 3CD6Z 4X6AI 5FLXf 4A3MI 1K8A2 1VQLZ 4E30A 2DE7A 3M3YI 1I3QI 1TFIA 1X3ZA 3CCR1 2M48A 3I56Z 3S14I 1TWAI 1VQPZ 5C3EI 1Q7Y1 5A2Qb 3M4OI 4XX2A 2JA8I 4E2XA 1ZH1A 4A3KI 5T64A 2QEXZ 1VQ71 2IZ4A 3GTLI 1VQ41 3TE5B 3T4NB 1Z01A 3HOZI 1I6HI 3GTPI 5IT9f 1VQ9Z 1K732 3VMIA 1YHQ1 2HF1A 1Z02A 3QWUA 1M1K1 2DE5A 2VUMI 2JA6I 3IX0A 3OW2Z 3CCJZ 1S72Z 2LFUA 4A3GI 3LUSA 4NBDA 1VQNZ 2Q4ZA 3G4SZ 4BY1I 2W03A 1RO2A 4MD9A 2V8KA 4Y7NI 2PK7A 3CCLZ 1K731 3HOYI 1Z03A 2JNYA 4RVGA 4HGZA 5CM2M 3CC4Z 3I4NI 1YJ91 1ML8A 3GTOI 2E9HA 1NP6A 1YJW1 3FQMA 1VQK1 4QTTA 1R9TI 1TWHI 4E2YA 1KC81 2HU9A 3CMA1 3CCUZ 5C4XI 3CC7Z 4NB9A 2JA7I 2JR6A 4E2WA 3S1MI 3RZDI 5D1PA 3CCVZ 3PO3I 2R92I 2NVTI 2O53A 3NH4A 4A3CI 1K9M1 3BG0B 3G6E1 1YITZ 4A3BI 1ZB9A 3S1RI 2NVYI 2BJOA 2YU9I 5FLMI 2OTJ1 2P3YA 3CCE1 3GTJI 3NFZA 3CXCZ 3CC2Z 1Y1WI 2M6NA 2QLVB 2QREB 2RT9A 3VTNA 4A3FI 3PO3S 2GU2A 3CME1 1TWFI 2KPIA 3CCM1 5T67A 2WB1A 4BY7I 2V8JA 1RLYA 3HOXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTN A; 
#chains in the Genus database with same CATH topology
 3FKI I;  2OTL 1;  3JAM f;  3EED A;  1NJI 2;  4MON A;  1Y1V I;  3CXC Y;  2E2I I;  4NBC A;  1S7M A;  3CCS Z;  4RVH A;  5T6B A;  2DE6 A;  3GTQ I;  1Q81 2;  3CD6 1;  1WII A;  5FLX b;  1VQ7 Z;  3PO2 I;  3FQQ A;  1YUA A;  3GCF A;  2NVX I;  1VQM Z;  1L1O C;  3TDH B;  1LQL A;  4MD7 A;  1K8A 1;  3NDI A;  3IFU A;  4NBH A;  1P9N A;  2J6A A;  5LL6 f;  3MZK B;  4E31 A;  2IV2 X;  4AYB A;  3MON A;  1I50 I;  1VQP 1;  3I07 A;  4RVF A;  1JJ2 Z;  1Y1V S;  1K83 I;  2R6M A;  3CCQ 1;  1N8R 2;  2QRC B;  5C4J I;  1WCM I;  3J81 f;  3G71 Z;  4HH4 A;  1YJN Z;  3I55 1;  4NFR A;  3S1Q I;  2QA4 1;  2Q51 A;  2G2K A;  3J7A 4;  5C44 I;  3VMH A;  2JUB A;  4BBS I;  4E33 A;  1JJ2 Y;  2OOX B;  4EWC A;  2JIR A;  5IT9 b;  2H85 A;  1VQO 1;  1VQ9 1;  2GTI A;  1N2F A;  1QVF Z;  3S15 I;  3GTM I;  1QVG Z;  2JS4 A;  1VQ6 1;  5D1O A;  2RHB A;  1USP A;  3OW2 Y;  2JMO A;  1YIJ 1;  3D2L A;  3CMA Z;  4NH1 C;  3J80 f;  1S72 1;  1Q86 2;  4MD8 A;  1VQN 1;  2JIQ A;  4RS4 A;  2W04 A;  4NBE A;  2OOY B;  2VPW A;  4CL1 A;  3G6E Z;  2OZK A;  3GTM S;  2YAD A;  2NVQ I;  1PFT A;  4BBR I;  3HOU I;  1QYP A;  3CCE Z;  5AN9 F;  1M90 2;  3CC4 1;  1YI2 1;  4RV9 A;  2WAQ A;  3HOW I;  1VQ5 1;  2I3C A;  1Q86 1;  1KQS Z;  1KD1 2;  3CCU 1;  3CPW Z;  1VQ8 1;  1Q82 2;  3CCR Z;  1KRL A;  2K3R A;  3HOV I;  3GKQ A;  1RO4 A;  3S2H I;  2LIY A;  1Q7Y 2;  2OTL Z;  2PM9 A;  2R93 I;  5A2Q f;  2VPY A;  1M90 1;  3CQZ I;  2V45 A;  2QKD A;  3KIF A;  4A3J I;  1KQS Y;  4A93 I;  3CPW Y;  2R7Z I;  4E2Z A;  4QTU A;  3CC2 1;  2JA5 I;  4NBG A;  1VQ4 Z;  3H3V J;  1KD1 1;  2RBL A;  1VQL 1;  1Q82 1;  2E2J I;  2RPR A;  3KIH A;  3BG1 B;  4MRI A;  1X3W A;  4Y52 I;  4DK1 A;  3U50 C;  2AKL A;  3CCQ Z;  3F3P C;  3I56 1;  4NB8 A;  3I4M I;  4BXX I;  2E2H I;  3NH5 A;  1M1K 2;  3JAM b;  1YHQ Z;  1RO0 A;  1ZB8 A;  4A3D I;  1TWC I;  3NDJ A;  1NJI 1;  3CCS 1;  4DGL A;  3I55 Z;  1QF8 A;  2QA4 Z;  4E32 A;  1RQF A;  1Q81 1;  2P28 A;  2QR1 B;  1VQM 1;  2QEX 1;  2K5R A;  4S1T A;  1RNI A;  3S17 I;  3H0G I;  2IZ3 A;  3S16 I;  1VQO Z;  3D9X A;  1TWG I;  2F4M A;  2O4H A;  4DQY B;  2F4O A;  1X0T A;  4HGY A;  3VMG A;  2ZAE B;  1VQ6 Z;  1VLA A;  1N8R 1;  1YJ9 Z;  2VPX A;  3J81 b;  1YIJ Z;  3G71 1;  1DL6 A;  1JWH C;  1YJW Z;  1YJN 1;  1KC8 2;  1VQK Z;  1QXF A;  4A3L I;  1SFO I;  4MH4 A;  1Y8C A;  1WW9 A;  5IP7 I;  3CCJ 1;  3S2D I;  3GTK I;  5IP9 I;  2V8I A;  3G4S 1;  1W2B Z;  3GTG I;  3VB9 A;  4MXU A;  1K9M 2;  3RZO I;  1QVF Y;  2JIO A;  2PMZ A;  3NH8 A;  3CCL 1;  1QVG Y;  3S1N I;  1YI2 Z;  5D1O B;  3HKZ A;  1USP B;  4A3E I;  2OTJ Z;  2KI7 B;  1YUK A;  2GTH A;  3K7A I;  4NBA A;  4NBB A;  1VQ5 Z;  2B63 I;  2EGT A;  3P5J B;  3D6W A;  3J80 b;  1VQ8 Z;  2Y0S A;  1W2B Y;  4RVD A;  2QRD B;  2VF1 A;  2V3V A;  1SIW A;  3MZL B;  4TNU A;  3ESW A;  2RIQ A;  3CME Z;  3CC7 1;  2VUG A;  4NBF A;  3CCM Z;  1NUI A;  3F3F C;  3CCV 1;  4A3I I;  3Q87 A;  4NOZ A;  3IF8 A;  1WZN A;  2AYD A;  1YIT 1;  3EER A;  3CD6 Z;  4X6A I;  5FLX f;  4A3M I;  1K8A 2;  1VQL Z;  4E30 A;  2DE7 A;  3M3Y I;  1I3Q I;  1FDO A;  2E7Z A;  1TFI A;  1X3Z A;  3CCR 1;  2M48 A;  3I56 Z;  3S14 I;  1TWA I;  1VQP Z;  5C3E I;  1Q7Y 1;  5A2Q b;  3M4O I;  4XX2 A;  2JA8 I;  4E2X A;  1ZH1 A;  4A3K I;  2JIM A;  5T64 A;  2JIP A;  2QEX Z;  1VQ7 1;  2IZ4 A;  3GTL I;  1VQ4 1;  1Q16 A;  3TE5 B;  3T4N B;  1Z01 A;  1WJ2 A;  3HOZ I;  1I6H I;  3GTP I;  5IT9 f;  1VQ9 Z;  1K73 2;  3VMI A;  1YHQ 1;  2HF1 A;  1Z02 A;  3QWU A;  1M1K 1;  2DE5 A;  2VUM I;  2JA6 I;  3IX0 A;  3OW2 Z;  2LEX A;  3CCJ Z;  1S72 Z;  2LFU A;  4A3G I;  3LUS A;  4NBD A;  1VQN Z;  2Q4Z A;  3G4S Z;  4BY1 I;  2W03 A;  1RO2 A;  4MD9 A;  2V8K A;  4Y7N I;  2PK7 A;  3CCL Z;  1K73 1;  3HOY I;  1Z03 A;  2JNY A;  4RVG A;  4HGZ A;  5CM2 M;  3CC4 Z;  3IR7 A;  3I4N I;  1YJ9 1;  2VPZ A;  1ML8 A;  3GTO I;  2E9H A;  1NP6 A;  1YJW 1;  3FQM A;  1VQK 1;  4QTT A;  1R9T I;  1TWH I;  1AA6 A;  4E2Y A;  1KC8 1;  2HU9 A;  3CMA 1;  3CCU Z;  5C4X I;  3CC7 Z;  4NB9 A;  2JA7 I;  2JR6 A;  4E2W A;  3S1M I;  3RZD I;  5D1P A;  3CCV Z;  3PO3 I;  2R92 I;  2NVT I;  2O53 A;  3NH4 A;  4A3C I;  1K9M 1;  1FDI A;  3BG0 B;  3G6E 1;  1YIT Z;  4A3B I;  1ZB9 A;  3S1R I;  2NVY I;  2BJO A;  2YU9 I;  5FLM I;  2OTJ 1;  2P3Y A;  3CCE 1;  3GTJ I;  3NFZ A;  3CXC Z;  3CC2 Z;  1Y1W I;  2NAP A;  2M6N A;  2QLV B;  2QRE B;  2RT9 A;  3VTN A;  4A3F I;  3PO3 S;  2GU2 A;  3CME 1;  1TWF I;  2KPI A;  3CCM 1;  5T67 A;  2WB1 A;  4BY7 I;  2V8J A;  1RLY A;  3HOX I; 
#chains in the Genus database with same CATH homology
 3FKI I;  2OTL 1;  3JAM f;  3EED A;  1NJI 2;  4MON A;  1Y1V I;  3CXC Y;  2E2I I;  4NBC A;  1S7M A;  3CCS Z;  4RVH A;  5T6B A;  2DE6 A;  3GTQ I;  1Q81 2;  3CD6 1;  1WII A;  5FLX b;  1VQ7 Z;  3PO2 I;  3FQQ A;  1YUA A;  3GCF A;  2NVX I;  1VQM Z;  1L1O C;  3TDH B;  1LQL A;  4MD7 A;  1K8A 1;  3NDI A;  3IFU A;  4NBH A;  1P9N A;  2J6A A;  5LL6 f;  3MZK B;  4E31 A;  4AYB A;  3MON A;  1I50 I;  1VQP 1;  3I07 A;  4RVF A;  1JJ2 Z;  1Y1V S;  1K83 I;  2R6M A;  3CCQ 1;  1N8R 2;  2QRC B;  5C4J I;  1WCM I;  3J81 f;  3G71 Z;  4HH4 A;  1YJN Z;  3I55 1;  4NFR A;  3S1Q I;  2QA4 1;  2Q51 A;  2G2K A;  3J7A 4;  5C44 I;  3VMH A;  2JUB A;  4BBS I;  4E33 A;  1JJ2 Y;  2OOX B;  4EWC A;  5IT9 b;  2H85 A;  1VQO 1;  1VQ9 1;  2GTI A;  1N2F A;  1QVF Z;  3S15 I;  3GTM I;  1QVG Z;  2JS4 A;  1VQ6 1;  5D1O A;  2RHB A;  1USP A;  3OW2 Y;  2JMO A;  1YIJ 1;  3CMA Z;  4NH1 C;  3J80 f;  1S72 1;  1Q86 2;  4MD8 A;  1VQN 1;  4RS4 A;  2W04 A;  4NBE A;  2OOY B;  4CL1 A;  3G6E Z;  2OZK A;  3GTM S;  2YAD A;  2NVQ I;  1PFT A;  4BBR I;  3HOU I;  1QYP A;  3CCE Z;  5AN9 F;  1M90 2;  3CC4 1;  1YI2 1;  4RV9 A;  2WAQ A;  3HOW I;  1VQ5 1;  2I3C A;  1Q86 1;  1KQS Z;  1KD1 2;  3CCU 1;  3CPW Z;  1VQ8 1;  1Q82 2;  3CCR Z;  1KRL A;  2K3R A;  3HOV I;  3GKQ A;  1RO4 A;  3S2H I;  2LIY A;  1Q7Y 2;  2OTL Z;  2PM9 A;  2R93 I;  5A2Q f;  1M90 1;  3CQZ I;  2QKD A;  3KIF A;  4A3J I;  1KQS Y;  4A93 I;  3CPW Y;  2R7Z I;  4E2Z A;  4QTU A;  3CC2 1;  2JA5 I;  4NBG A;  1VQ4 Z;  3H3V J;  1KD1 1;  2RBL A;  1VQL 1;  1Q82 1;  2E2J I;  2RPR A;  3KIH A;  3BG1 B;  4MRI A;  1X3W A;  4Y52 I;  4DK1 A;  3U50 C;  2AKL A;  3CCQ Z;  3F3P C;  3I56 1;  4NB8 A;  3I4M I;  4BXX I;  2E2H I;  3NH5 A;  1M1K 2;  3JAM b;  1YHQ Z;  1RO0 A;  1ZB8 A;  4A3D I;  1TWC I;  3NDJ A;  1NJI 1;  3CCS 1;  4DGL A;  3I55 Z;  1QF8 A;  2QA4 Z;  4E32 A;  1RQF A;  1Q81 1;  2P28 A;  2QR1 B;  1VQM 1;  2QEX 1;  2K5R A;  4S1T A;  1RNI A;  3S17 I;  3H0G I;  2IZ3 A;  3S16 I;  1VQO Z;  3D9X A;  1TWG I;  2F4M A;  2O4H A;  4DQY B;  2F4O A;  1X0T A;  4HGY A;  3VMG A;  2ZAE B;  1VQ6 Z;  1VLA A;  1N8R 1;  1YJ9 Z;  3J81 b;  1YIJ Z;  3G71 1;  1DL6 A;  1JWH C;  1YJW Z;  1YJN 1;  1KC8 2;  1VQK Z;  4A3L I;  1SFO I;  4MH4 A;  1WW9 A;  5IP7 I;  3CCJ 1;  3S2D I;  3GTK I;  5IP9 I;  2V8I A;  3G4S 1;  1W2B Z;  3GTG I;  3VB9 A;  4MXU A;  1K9M 2;  3RZO I;  1QVF Y;  2PMZ A;  3NH8 A;  3CCL 1;  1QVG Y;  3S1N I;  1YI2 Z;  5D1O B;  3HKZ A;  1USP B;  4A3E I;  2OTJ Z;  2KI7 B;  1YUK A;  2GTH A;  3K7A I;  4NBA A;  4NBB A;  1VQ5 Z;  2B63 I;  2EGT A;  3P5J B;  3D6W A;  3J80 b;  1VQ8 Z;  2Y0S A;  1W2B Y;  4RVD A;  2QRD B;  2VF1 A;  3MZL B;  4TNU A;  3ESW A;  2RIQ A;  3CME Z;  3CC7 1;  2VUG A;  4NBF A;  3CCM Z;  1NUI A;  3F3F C;  3CCV 1;  4A3I I;  3Q87 A;  4NOZ A;  3IF8 A;  1YIT 1;  3EER A;  3CD6 Z;  4X6A I;  5FLX f;  4A3M I;  1K8A 2;  1VQL Z;  4E30 A;  2DE7 A;  3M3Y I;  1I3Q I;  1TFI A;  1X3Z A;  3CCR 1;  2M48 A;  3I56 Z;  3S14 I;  1TWA I;  1VQP Z;  5C3E I;  1Q7Y 1;  5A2Q b;  3M4O I;  4XX2 A;  2JA8 I;  4E2X A;  1ZH1 A;  4A3K I;  5T64 A;  2QEX Z;  1VQ7 1;  2IZ4 A;  3GTL I;  1VQ4 1;  3TE5 B;  3T4N B;  1Z01 A;  3HOZ I;  1I6H I;  3GTP I;  5IT9 f;  1VQ9 Z;  1K73 2;  3VMI A;  1YHQ 1;  2HF1 A;  1Z02 A;  3QWU A;  1M1K 1;  2DE5 A;  2VUM I;  2JA6 I;  3IX0 A;  3OW2 Z;  3CCJ Z;  1S72 Z;  2LFU A;  4A3G I;  3LUS A;  4NBD A;  1VQN Z;  2Q4Z A;  3G4S Z;  4BY1 I;  2W03 A;  1RO2 A;  4MD9 A;  2V8K A;  4Y7N I;  2PK7 A;  3CCL Z;  1K73 1;  3HOY I;  1Z03 A;  2JNY A;  4RVG A;  4HGZ A;  5CM2 M;  3CC4 Z;  3I4N I;  1YJ9 1;  1ML8 A;  3GTO I;  2E9H A;  1NP6 A;  1YJW 1;  3FQM A;  1VQK 1;  4QTT A;  1R9T I;  1TWH I;  4E2Y A;  1KC8 1;  2HU9 A;  3CMA 1;  3CCU Z;  5C4X I;  3CC7 Z;  4NB9 A;  2JA7 I;  2JR6 A;  4E2W A;  3S1M I;  3RZD I;  5D1P A;  3CCV Z;  3PO3 I;  2R92 I;  2NVT I;  2O53 A;  3NH4 A;  4A3C I;  1K9M 1;  3BG0 B;  3G6E 1;  1YIT Z;  4A3B I;  1ZB9 A;  3S1R I;  2NVY I;  2BJO A;  2YU9 I;  5FLM I;  2OTJ 1;  2P3Y A;  3CCE 1;  3GTJ I;  3NFZ A;  3CXC Z;  3CC2 Z;  1Y1W I;  2M6N A;  2QLV B;  2QRE B;  2RT9 A;  3VTN A;  4A3F I;  3PO3 S;  2GU2 A;  3CME 1;  1TWF I;  2KPI A;  3CCM 1;  5T67 A;  2WB1 A;  4BY7 I;  2V8J A;  1RLY A;  3HOX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...