3IF8A

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
314
structure length
265
Chain Sequence
GPLGSMWERLNCAAEDFYSRLLQKFNEEKKGIRKDPFLYEADVQVQLISKGQPNPLKNILNENDIVFIVEKVPGPLALPVGKARQLIGLYTMAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSQTAIALDISWSPVDEILQIPPLSSTATLNIKHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Protein zwilch homolog
total genus 54
structure length 265
sequence length 314
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.230 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3if8A02
3IF8A
chains in the Genus database with same CATH superfamily
2PMZA 4A3BI 1VQ7Z 2JS4A 3H3VJ 2V3VA 2E9HA 3D2LA 3NFZA 3J81f 3CCQZ 1RO0A 4X6AI 1ZH1A 4A3LI 4A3MI 5C4XI 1M901 3MZLB 5AN9F 3VB9A 2R93I 3CCMZ 1S72Z 1VQ61 2IZ3A 1Z01A 3IX0A 1YIT1 5T67A 3CXCZ 2JMOA 2EGTA 1YJW1 3Q87A 5T64A 3PO2I 2QEX1 1VQK1 3S15I 4NBGA 1M1K1 4MXUA 3CCS1 5T6BA 3RZOI 1JWHC 3CCJZ 4E2YA 2VUMI 3D9XA 1WCMI 3CCV1 3G71Z 1KQSZ 4NBAA 1RO4A 1VQOZ 2OOYB 4E30A 4MH4A 1K732 1VQ71 4E31A 1VQO1 3CMA1 3S2DI 1YJ91 5FLMI 4BXXI 1N8R1 1KC81 3GTPI 1KD11 1VQKZ 4E2XA 2JA8I 1VQ91 4MD9A 3GTKI 2E2JI 3F3PC 2GTHA 3CQZI 3S1QI 1ZB9A 3MONA 3CC4Z 1Z02A 1K83I 2E7ZA 2J6AA 3GCFA 1RLYA 3NH8A 1YJN1 1N2FA 4A3KI 1X3ZA 4HH4A 4TNUA 1K9M2 3JAMf 3CMEZ 3CC21 3I4MI 1YJNZ 1YUKA 1NP6A 1VQ5Z 3P5JB 1YHQZ 4DGLA 2QEXZ 1Q862 1VQ81 3EEDA 3HOUI 1ZB8A 4HGZA 2OOXB 2RBLA 3MZKB 4QTUA 1YIJZ 1VQLZ 3GTMS 4NB8A 1I50I 4E33A 3CME1 3CC2Z 3CCE1 1NJI1 2JA7I 3G4SZ 3GTOI 3T4NB 2E2II 3I07A 2V45A 2W04A 2RIQA 4DK1A 4RVFA 2HF1A 3I4NI 1QYPA 4MD8A 1ML8A 3CC71 4E32A 3HOXI 1Q822 5FLXf 1SFOI 2ZAEB 3QWUA 2JUBA 3NDIA 4NBFA 1Z03A 2R7ZI 1WW9A 2JIQA 2W03A 3JAMb 1LQLA 2VPYA 2DE7A 3PO3I 3H0GI 3CCLZ 3CCEZ 3OW2Y 4A3II 2K5RA 2M6NA 3CD6Z 2BJOA 4A3FI 3CMAZ 1Y1VI 2JIOA 2KPIA 1VQ6Z 3CCM1 1YI21 3BG1B 2OTJ1 1KQSY 2R92I 3CCQ1 5A2Qb 4BY7I 2YADA 4A3DI 1X3WA 2RPRA 3VMHA 1M902 1SIWA 1YIJ1 1VQL1 4NBCA 1RNIA 3CCJ1 3VTNA 1YJWZ 2QR1B 1JJ2Z 1TFIA 4RS4A 1VQ41 4BY1I 2B63I 5D1OA 4BBRI 2E2HI 1QXFA 3HOWI 1K731 2Q51A 4NH1C 3S14I 4AYBA 1Q811 2R6MA 3CCUZ 5IP9I 1TWFI 2JA6I 3S1NI 3FQMA 2V8KA 3S17I 3I561 5FLXb 2V8IA 3J80f 4QTTA 3M4OI 3GTGI 3HOZI 2HU9A 1DL6A 3VMGA 4E2WA 2QRDB 1WJ2A 3CD61 4A3CI 1TWCI 1Q812 1NJI2 3CCL1 3D6WA 4MONA 1X0TA 1Q16A 2O53A 2YU9I 1K8A2 1VQN1 3I551 3U50C 3M3YI 2F4OA 5IP7I 5IT9b 3LUSA 4NBBA 2DE6A 1VLAA 1QVGZ 1YI2Z 3CCRZ 2OTJZ 2LFUA 3BG0B 3FKII 2OTL1 3CCVZ 3TDHB 1M1K2 1NUIA 3NDJA 1QVFZ 3PO3S 3G4S1 1TWHI 2JIRA 1AA6A 1USPB 2V8JA 2QA4Z 2JNYA 1RO2A 3CCU1 3IF8A 1YUAA 1QVFY 2QA41 1VQ8Z 1USPA 1QF8A 2AKLA 2JR6A 1S7MA 1WZNA 2AYDA 3K7AI 3IR7A 1R9TI 1VQ51 1KD12 3HOVI 4S1TA 4Y7NI 3G711 2KI7B 2NAPA 3VMIA 3F3FC 5C3EI 4CL1A 1L1OC 2DE5A 3GTJI 1Q861 3FQQA 2Y0SA 2Q4ZA 4NBDA 1KRLA 4EWCA 2I3CA 3NH5A 4HGYA 2P28A 3GKQA 1FDIA 3S1RI 1JJ2Y 2GU2A 4RVHA 2LEXA 1Y8CA 4NB9A 1VQNZ 4E2ZA 3J81b 5A2Qf 3CCR1 1FDOA 3I56Z 1Q7Y2 1KC82 3S2HI 2G2KA 1W2BY 1TWAI 1K8A1 1W2BZ 3CPWY 1TWGI 4DQYB 2VPZA 1VQMZ 3GTQI 1VQ9Z 2VPWA 2VF1A 1PFTA 1Q7Y1 3HOYI 3KIHA 3GTLI 4XX2A 2H85A 3CXCY 2IV2X 2PK7A 5IT9f 1YITZ 4NOZA 1Y1VS 1P9NA 2NVXI 2JIMA 3NH4A 1YHQ1 2VUGA 1RQFA 5D1PA 2JIPA 5C44I 3HKZA 2QLVB 2OTLZ 1I6HI 3IFUA 3G6E1 2K3RA 2M48A 2QKDA 2O4HA 2WB1A 4A3JI 1N8R2 5D1OB 3S16I 3TE5B 3CC41 2VPXA 3OW2Z 4Y52I 2NVTI 1VQPZ 1S721 1VQ4Z 2GTIA 3S1MI 4A3GI 2F4MA 2RT9A 3KIFA 4MRIA 3G6EZ 4RV9A 5LL6f 4MD7A 4A3EI 4RVGA 2RHBA 2QRCB 2JA5I 4NBEA 2LIYA 1VQM1 2NVQI 1VQP1 5CM2M 4NFRA 1QVGY 2P3YA 4RVDA 4NBHA 1WIIA 2QREB 2IZ4A 3I55Z 1K9M1 2OZKA 1Y1WI 2NVYI 4A93I 1YJ9Z 4BBSI 1Q821 3CCSZ 2PM9A 3EERA 3ESWA 3J7A4 3CC7Z 3RZDI 5C4JI 3CPWZ 1I3QI 2WAQA 3GTMI 3J80b
chains in the Genus database with same CATH topology
2PMZA 4A3BI 1VQ7Z 2JS4A 3H3VJ 2E9HA 3NFZA 3J81f 3CCQZ 1RO0A 4X6AI 1ZH1A 4A3LI 4A3MI 5C4XI 1M901 3MZLB 5AN9F 3VB9A 2R93I 3CCMZ 1S72Z 1VQ61 2IZ3A 1Z01A 3IX0A 1YIT1 5T67A 3CXCZ 2JMOA 2EGTA 1YJW1 3Q87A 5T64A 3PO2I 2QEX1 1VQK1 3S15I 4NBGA 1M1K1 4MXUA 3CCS1 5T6BA 3RZOI 1JWHC 3CCJZ 4E2YA 2VUMI 3D9XA 1WCMI 3CCV1 3G71Z 1KQSZ 4NBAA 1RO4A 1VQOZ 2OOYB 4E30A 4MH4A 1K732 1VQ71 4E31A 1VQO1 3CMA1 3S2DI 1YJ91 5FLMI 4BXXI 1N8R1 1KC81 3GTPI 1KD11 1VQKZ 4E2XA 2JA8I 1VQ91 4MD9A 3GTKI 2E2JI 3F3PC 2GTHA 3CQZI 3S1QI 1ZB9A 3MONA 3CC4Z 1Z02A 1K83I 2J6AA 3GCFA 1RLYA 3NH8A 1YJN1 1N2FA 4A3KI 1X3ZA 4HH4A 4TNUA 1K9M2 3JAMf 3CMEZ 3CC21 3I4MI 1YJNZ 1YUKA 1NP6A 1VQ5Z 3P5JB 1YHQZ 4DGLA 2QEXZ 1Q862 1VQ81 3EEDA 3HOUI 1ZB8A 4HGZA 2OOXB 2RBLA 3MZKB 4QTUA 1YIJZ 1VQLZ 3GTMS 4NB8A 1I50I 4E33A 3CME1 3CC2Z 3CCE1 1NJI1 2JA7I 3G4SZ 3GTOI 3T4NB 2E2II 3I07A 2W04A 2RIQA 4DK1A 4RVFA 2HF1A 3I4NI 1QYPA 4MD8A 1ML8A 3CC71 4E32A 3HOXI 1Q822 5FLXf 1SFOI 2ZAEB 3QWUA 2JUBA 3NDIA 4NBFA 1Z03A 2R7ZI 1WW9A 2W03A 3JAMb 1LQLA 2DE7A 3PO3I 3H0GI 3CCLZ 3CCEZ 3OW2Y 4A3II 2K5RA 2M6NA 3CD6Z 2BJOA 4A3FI 3CMAZ 1Y1VI 2KPIA 1VQ6Z 3CCM1 1YI21 3BG1B 2OTJ1 1KQSY 2R92I 3CCQ1 5A2Qb 4BY7I 2YADA 4A3DI 1X3WA 2RPRA 3VMHA 1M902 1YIJ1 1VQL1 4NBCA 1RNIA 3CCJ1 3VTNA 1YJWZ 2QR1B 1JJ2Z 1TFIA 4RS4A 1VQ41 4BY1I 2B63I 5D1OA 4BBRI 2E2HI 3HOWI 1K731 2Q51A 4NH1C 3S14I 4AYBA 1Q811 2R6MA 3CCUZ 5IP9I 1TWFI 2JA6I 3S1NI 3FQMA 2V8KA 3S17I 3I561 5FLXb 2V8IA 3J80f 4QTTA 3M4OI 3GTGI 3HOZI 2HU9A 1DL6A 3VMGA 4E2WA 2QRDB 3CD61 4A3CI 1TWCI 1Q812 1NJI2 3CCL1 3D6WA 4MONA 1X0TA 2O53A 2YU9I 1K8A2 1VQN1 3I551 3U50C 3M3YI 2F4OA 5IP7I 5IT9b 3LUSA 4NBBA 2DE6A 1VLAA 1QVGZ 1YI2Z 3CCRZ 2OTJZ 2LFUA 3BG0B 3FKII 2OTL1 3CCVZ 3TDHB 1M1K2 1NUIA 3NDJA 1QVFZ 3PO3S 3G4S1 1TWHI 1USPB 2V8JA 2QA4Z 2JNYA 1RO2A 3CCU1 3IF8A 1YUAA 1QVFY 2QA41 1VQ8Z 1USPA 1QF8A 2AKLA 2JR6A 1S7MA 3K7AI 1KD12 1R9TI 1VQ51 3HOVI 4S1TA 4Y7NI 3G711 2KI7B 3VMIA 3F3FC 5C3EI 4CL1A 1L1OC 2DE5A 3GTJI 1Q861 3FQQA 2Y0SA 2Q4ZA 4NBDA 1KRLA 4EWCA 2I3CA 3NH5A 4HGYA 2P28A 3GKQA 3S1RI 1JJ2Y 2GU2A 4RVHA 4NB9A 1VQNZ 4E2ZA 3J81b 5A2Qf 3CCR1 3I56Z 1Q7Y2 1KC82 3S2HI 1W2BY 2G2KA 1TWAI 1K8A1 1W2BZ 3CPWY 1TWGI 4DQYB 1VQMZ 3GTQI 1VQ9Z 2VF1A 1PFTA 1Q7Y1 3HOYI 3KIHA 3GTLI 4XX2A 2H85A 3CXCY 2PK7A 5IT9f 1YITZ 4NOZA 1Y1VS 1P9NA 2NVXI 3NH4A 1YHQ1 2VUGA 1RQFA 5D1PA 5C44I 3HKZA 2QLVB 2OTLZ 1I6HI 3IFUA 3G6E1 2K3RA 2M48A 2QKDA 2O4HA 2WB1A 4A3JI 1N8R2 5D1OB 3S16I 3TE5B 3CC41 3OW2Z 4Y52I 2NVTI 1VQPZ 1S721 1VQ4Z 2GTIA 3S1MI 4A3GI 2F4MA 2RT9A 3KIFA 4MRIA 3G6EZ 4RV9A 5LL6f 4MD7A 4A3EI 4RVGA 2RHBA 2QRCB 2JA5I 4NBEA 2LIYA 1VQM1 2NVQI 1VQP1 5CM2M 4NFRA 1QVGY 2P3YA 4RVDA 4NBHA 1WIIA 2QREB 2IZ4A 3I55Z 1K9M1 2OZKA 1Y1WI 2NVYI 4A93I 1YJ9Z 4BBSI 1Q821 3CCSZ 2PM9A 3EERA 3ESWA 3J7A4 3CC7Z 3RZDI 5C4JI 3CPWZ 1I3QI 2WAQA 3GTMI 3J80b
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 A; 
#chains in the Genus database with same CATH topology
 2PMZ A;  4A3B I;  1VQ7 Z;  2JS4 A;  3H3V J;  2V3V A;  2E9H A;  3D2L A;  3NFZ A;  3J81 f;  3CCQ Z;  1RO0 A;  4X6A I;  1ZH1 A;  4A3L I;  4A3M I;  5C4X I;  1M90 1;  3MZL B;  5AN9 F;  3VB9 A;  2R93 I;  3CCM Z;  1S72 Z;  1VQ6 1;  2IZ3 A;  1Z01 A;  3IX0 A;  1YIT 1;  5T67 A;  3CXC Z;  2JMO A;  2EGT A;  1YJW 1;  3Q87 A;  5T64 A;  3PO2 I;  2QEX 1;  1VQK 1;  3S15 I;  4NBG A;  1M1K 1;  4MXU A;  3CCS 1;  5T6B A;  3RZO I;  1JWH C;  3CCJ Z;  4E2Y A;  2VUM I;  3D9X A;  1WCM I;  3CCV 1;  3G71 Z;  1KQS Z;  4NBA A;  1RO4 A;  1VQO Z;  2OOY B;  4E30 A;  4MH4 A;  1K73 2;  1VQ7 1;  4E31 A;  1VQO 1;  3CMA 1;  3S2D I;  1YJ9 1;  5FLM I;  4BXX I;  1N8R 1;  1KC8 1;  3GTP I;  1KD1 1;  1VQK Z;  4E2X A;  2JA8 I;  1VQ9 1;  4MD9 A;  3GTK I;  2E2J I;  3F3P C;  2GTH A;  3CQZ I;  3S1Q I;  1ZB9 A;  3MON A;  3CC4 Z;  1Z02 A;  1K83 I;  2E7Z A;  2J6A A;  3GCF A;  1RLY A;  3NH8 A;  1YJN 1;  1N2F A;  4A3K I;  1X3Z A;  4HH4 A;  4TNU A;  1K9M 2;  3JAM f;  3CME Z;  3CC2 1;  3I4M I;  1YJN Z;  1YUK A;  1NP6 A;  1VQ5 Z;  3P5J B;  1YHQ Z;  4DGL A;  2QEX Z;  1Q86 2;  1VQ8 1;  3EED A;  3HOU I;  1ZB8 A;  4HGZ A;  2OOX B;  2RBL A;  3MZK B;  4QTU A;  1YIJ Z;  1VQL Z;  3GTM S;  4NB8 A;  1I50 I;  4E33 A;  3CME 1;  3CC2 Z;  3CCE 1;  1NJI 1;  2JA7 I;  3G4S Z;  3GTO I;  3T4N B;  2E2I I;  3I07 A;  2V45 A;  2W04 A;  2RIQ A;  4DK1 A;  4RVF A;  2HF1 A;  3I4N I;  1QYP A;  4MD8 A;  1ML8 A;  3CC7 1;  4E32 A;  3HOX I;  1Q82 2;  5FLX f;  1SFO I;  2ZAE B;  3QWU A;  2JUB A;  3NDI A;  4NBF A;  1Z03 A;  2R7Z I;  1WW9 A;  2JIQ A;  2W03 A;  3JAM b;  1LQL A;  2VPY A;  2DE7 A;  3PO3 I;  3H0G I;  3CCL Z;  3CCE Z;  3OW2 Y;  4A3I I;  2K5R A;  2M6N A;  3CD6 Z;  2BJO A;  4A3F I;  3CMA Z;  1Y1V I;  2JIO A;  2KPI A;  1VQ6 Z;  3CCM 1;  1YI2 1;  3BG1 B;  2OTJ 1;  1KQS Y;  2R92 I;  3CCQ 1;  5A2Q b;  4BY7 I;  2YAD A;  4A3D I;  1X3W A;  2RPR A;  3VMH A;  1M90 2;  1SIW A;  1YIJ 1;  1VQL 1;  4NBC A;  1RNI A;  3CCJ 1;  3VTN A;  1YJW Z;  2QR1 B;  1JJ2 Z;  1TFI A;  4RS4 A;  1VQ4 1;  4BY1 I;  2B63 I;  5D1O A;  4BBR I;  2E2H I;  1QXF A;  3HOW I;  1K73 1;  2Q51 A;  4NH1 C;  3S14 I;  4AYB A;  1Q81 1;  2R6M A;  3CCU Z;  5IP9 I;  1TWF I;  2JA6 I;  3S1N I;  3FQM A;  2V8K A;  3S17 I;  3I56 1;  5FLX b;  2V8I A;  3J80 f;  4QTT A;  3M4O I;  3GTG I;  3HOZ I;  2HU9 A;  1DL6 A;  3VMG A;  4E2W A;  2QRD B;  1WJ2 A;  3CD6 1;  4A3C I;  1TWC I;  1Q81 2;  1NJI 2;  3CCL 1;  3D6W A;  4MON A;  1X0T A;  1Q16 A;  2O53 A;  2YU9 I;  1K8A 2;  1VQN 1;  3I55 1;  3U50 C;  3M3Y I;  2F4O A;  5IP7 I;  5IT9 b;  3LUS A;  4NBB A;  2DE6 A;  1VLA A;  1QVG Z;  1YI2 Z;  3CCR Z;  2OTJ Z;  2LFU A;  3BG0 B;  3FKI I;  2OTL 1;  3CCV Z;  3TDH B;  1M1K 2;  1NUI A;  3NDJ A;  1QVF Z;  3PO3 S;  3G4S 1;  1TWH I;  2JIR A;  1AA6 A;  1USP B;  2V8J A;  2QA4 Z;  2JNY A;  1RO2 A;  3CCU 1;  3IF8 A;  1YUA A;  1QVF Y;  2QA4 1;  1VQ8 Z;  1USP A;  1QF8 A;  2AKL A;  2JR6 A;  1S7M A;  1WZN A;  2AYD A;  3K7A I;  3IR7 A;  1R9T I;  1VQ5 1;  1KD1 2;  3HOV I;  4S1T A;  4Y7N I;  3G71 1;  2KI7 B;  2NAP A;  3VMI A;  3F3F C;  5C3E I;  4CL1 A;  1L1O C;  2DE5 A;  3GTJ I;  1Q86 1;  3FQQ A;  2Y0S A;  2Q4Z A;  4NBD A;  1KRL A;  4EWC A;  2I3C A;  3NH5 A;  4HGY A;  2P28 A;  3GKQ A;  1FDI A;  3S1R I;  1JJ2 Y;  2GU2 A;  4RVH A;  2LEX A;  1Y8C A;  4NB9 A;  1VQN Z;  4E2Z A;  3J81 b;  5A2Q f;  3CCR 1;  1FDO A;  3I56 Z;  1Q7Y 2;  1KC8 2;  3S2H I;  2G2K A;  1W2B Y;  1TWA I;  1K8A 1;  1W2B Z;  3CPW Y;  1TWG I;  4DQY B;  2VPZ A;  1VQM Z;  3GTQ I;  1VQ9 Z;  2VPW A;  2VF1 A;  1PFT A;  1Q7Y 1;  3HOY I;  3KIH A;  3GTL I;  4XX2 A;  2H85 A;  3CXC Y;  2IV2 X;  2PK7 A;  5IT9 f;  1YIT Z;  4NOZ A;  1Y1V S;  1P9N A;  2NVX I;  2JIM A;  3NH4 A;  1YHQ 1;  2VUG A;  1RQF A;  5D1P A;  2JIP A;  5C44 I;  3HKZ A;  2QLV B;  2OTL Z;  1I6H I;  3IFU A;  3G6E 1;  2K3R A;  2M48 A;  2QKD A;  2O4H A;  2WB1 A;  4A3J I;  1N8R 2;  5D1O B;  3S16 I;  3TE5 B;  3CC4 1;  2VPX A;  3OW2 Z;  4Y52 I;  2NVT I;  1VQP Z;  1S72 1;  1VQ4 Z;  2GTI A;  3S1M I;  4A3G I;  2F4M A;  2RT9 A;  3KIF A;  4MRI A;  3G6E Z;  4RV9 A;  5LL6 f;  4MD7 A;  4A3E I;  4RVG A;  2RHB A;  2QRC B;  2JA5 I;  4NBE A;  2LIY A;  1VQM 1;  2NVQ I;  1VQP 1;  5CM2 M;  4NFR A;  1QVG Y;  2P3Y A;  4RVD A;  4NBH A;  1WII A;  2QRE B;  2IZ4 A;  3I55 Z;  1K9M 1;  2OZK A;  1Y1W I;  2NVY I;  4A93 I;  1YJ9 Z;  4BBS I;  1Q82 1;  3CCS Z;  2PM9 A;  3EER A;  3ESW A;  3J7A 4;  3CC7 Z;  3RZD I;  5C4J I;  3CPW Z;  1I3Q I;  2WAQ A;  3GTM I;  3J80 b; 
#chains in the Genus database with same CATH homology
 2PMZ A;  4A3B I;  1VQ7 Z;  2JS4 A;  3H3V J;  2E9H A;  3NFZ A;  3J81 f;  3CCQ Z;  1RO0 A;  4X6A I;  1ZH1 A;  4A3L I;  4A3M I;  5C4X I;  1M90 1;  3MZL B;  5AN9 F;  3VB9 A;  2R93 I;  3CCM Z;  1S72 Z;  1VQ6 1;  2IZ3 A;  1Z01 A;  3IX0 A;  1YIT 1;  5T67 A;  3CXC Z;  2JMO A;  2EGT A;  1YJW 1;  3Q87 A;  5T64 A;  3PO2 I;  2QEX 1;  1VQK 1;  3S15 I;  4NBG A;  1M1K 1;  4MXU A;  3CCS 1;  5T6B A;  3RZO I;  1JWH C;  3CCJ Z;  4E2Y A;  2VUM I;  3D9X A;  1WCM I;  3CCV 1;  3G71 Z;  1KQS Z;  4NBA A;  1RO4 A;  1VQO Z;  2OOY B;  4E30 A;  4MH4 A;  1K73 2;  1VQ7 1;  4E31 A;  1VQO 1;  3CMA 1;  3S2D I;  1YJ9 1;  5FLM I;  4BXX I;  1N8R 1;  1KC8 1;  3GTP I;  1KD1 1;  1VQK Z;  4E2X A;  2JA8 I;  1VQ9 1;  4MD9 A;  3GTK I;  2E2J I;  3F3P C;  2GTH A;  3CQZ I;  3S1Q I;  1ZB9 A;  3MON A;  3CC4 Z;  1Z02 A;  1K83 I;  2J6A A;  3GCF A;  1RLY A;  3NH8 A;  1YJN 1;  1N2F A;  4A3K I;  1X3Z A;  4HH4 A;  4TNU A;  1K9M 2;  3JAM f;  3CME Z;  3CC2 1;  3I4M I;  1YJN Z;  1YUK A;  1NP6 A;  1VQ5 Z;  3P5J B;  1YHQ Z;  4DGL A;  2QEX Z;  1Q86 2;  1VQ8 1;  3EED A;  3HOU I;  1ZB8 A;  4HGZ A;  2OOX B;  2RBL A;  3MZK B;  4QTU A;  1YIJ Z;  1VQL Z;  3GTM S;  4NB8 A;  1I50 I;  4E33 A;  3CME 1;  3CC2 Z;  3CCE 1;  1NJI 1;  2JA7 I;  3G4S Z;  3GTO I;  3T4N B;  2E2I I;  3I07 A;  2W04 A;  2RIQ A;  4DK1 A;  4RVF A;  2HF1 A;  3I4N I;  1QYP A;  4MD8 A;  1ML8 A;  3CC7 1;  4E32 A;  3HOX I;  1Q82 2;  5FLX f;  1SFO I;  2ZAE B;  3QWU A;  2JUB A;  3NDI A;  4NBF A;  1Z03 A;  2R7Z I;  1WW9 A;  2W03 A;  3JAM b;  1LQL A;  2DE7 A;  3PO3 I;  3H0G I;  3CCL Z;  3CCE Z;  3OW2 Y;  4A3I I;  2K5R A;  2M6N A;  3CD6 Z;  2BJO A;  4A3F I;  3CMA Z;  1Y1V I;  2KPI A;  1VQ6 Z;  3CCM 1;  1YI2 1;  3BG1 B;  2OTJ 1;  1KQS Y;  2R92 I;  3CCQ 1;  5A2Q b;  4BY7 I;  2YAD A;  4A3D I;  1X3W A;  2RPR A;  3VMH A;  1M90 2;  1YIJ 1;  1VQL 1;  4NBC A;  1RNI A;  3CCJ 1;  3VTN A;  1YJW Z;  2QR1 B;  1JJ2 Z;  1TFI A;  4RS4 A;  1VQ4 1;  4BY1 I;  2B63 I;  5D1O A;  4BBR I;  2E2H I;  3HOW I;  1K73 1;  2Q51 A;  4NH1 C;  3S14 I;  4AYB A;  1Q81 1;  2R6M A;  3CCU Z;  5IP9 I;  1TWF I;  2JA6 I;  3S1N I;  3FQM A;  2V8K A;  3S17 I;  3I56 1;  5FLX b;  2V8I A;  3J80 f;  4QTT A;  3M4O I;  3GTG I;  3HOZ I;  2HU9 A;  1DL6 A;  3VMG A;  4E2W A;  2QRD B;  3CD6 1;  4A3C I;  1TWC I;  1Q81 2;  1NJI 2;  3CCL 1;  3D6W A;  4MON A;  1X0T A;  2O53 A;  2YU9 I;  1K8A 2;  1VQN 1;  3I55 1;  3U50 C;  3M3Y I;  2F4O A;  5IP7 I;  5IT9 b;  3LUS A;  4NBB A;  2DE6 A;  1VLA A;  1QVG Z;  1YI2 Z;  3CCR Z;  2OTJ Z;  2LFU A;  3BG0 B;  3FKI I;  2OTL 1;  3CCV Z;  3TDH B;  1M1K 2;  1NUI A;  3NDJ A;  1QVF Z;  3PO3 S;  3G4S 1;  1TWH I;  1USP B;  2V8J A;  2QA4 Z;  2JNY A;  1RO2 A;  3CCU 1;  3IF8 A;  1YUA A;  1QVF Y;  2QA4 1;  1VQ8 Z;  1USP A;  1QF8 A;  2AKL A;  2JR6 A;  1S7M A;  3K7A I;  1KD1 2;  1R9T I;  1VQ5 1;  3HOV I;  4S1T A;  4Y7N I;  3G71 1;  2KI7 B;  3VMI A;  3F3F C;  5C3E I;  4CL1 A;  1L1O C;  2DE5 A;  3GTJ I;  1Q86 1;  3FQQ A;  2Y0S A;  2Q4Z A;  4NBD A;  1KRL A;  4EWC A;  2I3C A;  3NH5 A;  4HGY A;  2P28 A;  3GKQ A;  3S1R I;  1JJ2 Y;  2GU2 A;  4RVH A;  4NB9 A;  1VQN Z;  4E2Z A;  3J81 b;  5A2Q f;  3CCR 1;  3I56 Z;  1Q7Y 2;  1KC8 2;  3S2H I;  1W2B Y;  2G2K A;  1TWA I;  1K8A 1;  1W2B Z;  3CPW Y;  1TWG I;  4DQY B;  1VQM Z;  3GTQ I;  1VQ9 Z;  2VF1 A;  1PFT A;  1Q7Y 1;  3HOY I;  3KIH A;  3GTL I;  4XX2 A;  2H85 A;  3CXC Y;  2PK7 A;  5IT9 f;  1YIT Z;  4NOZ A;  1Y1V S;  1P9N A;  2NVX I;  3NH4 A;  1YHQ 1;  2VUG A;  1RQF A;  5D1P A;  5C44 I;  3HKZ A;  2QLV B;  2OTL Z;  1I6H I;  3IFU A;  3G6E 1;  2K3R A;  2M48 A;  2QKD A;  2O4H A;  2WB1 A;  4A3J I;  1N8R 2;  5D1O B;  3S16 I;  3TE5 B;  3CC4 1;  3OW2 Z;  4Y52 I;  2NVT I;  1VQP Z;  1S72 1;  1VQ4 Z;  2GTI A;  3S1M I;  4A3G I;  2F4M A;  2RT9 A;  3KIF A;  4MRI A;  3G6E Z;  4RV9 A;  5LL6 f;  4MD7 A;  4A3E I;  4RVG A;  2RHB A;  2QRC B;  2JA5 I;  4NBE A;  2LIY A;  1VQM 1;  2NVQ I;  1VQP 1;  5CM2 M;  4NFR A;  1QVG Y;  2P3Y A;  4RVD A;  4NBH A;  1WII A;  2QRE B;  2IZ4 A;  3I55 Z;  1K9M 1;  2OZK A;  1Y1W I;  2NVY I;  4A93 I;  1YJ9 Z;  4BBS I;  1Q82 1;  3CCS Z;  2PM9 A;  3EER A;  3ESW A;  3J7A 4;  3CC7 Z;  3RZD I;  5C4J I;  3CPW Z;  1I3Q I;  2WAQ A;  3GTM I;  3J80 b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...