3IF8A

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
314
structure length
265
Chain Sequence
GPLGSMWERLNCAAEDFYSRLLQKFNEEKKGIRKDPFLYEADVQVQLISKGQPNPLKNILNENDIVFIVEKVPGPLALPVGKARQLIGLYTMAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSQTAIALDISWSPVDEILQIPPLSSTATLNIKHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein zwilch homolog
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 54
structure length 265
sequence length 314
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.230 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3if8A02
3IF8A
chains in the Genus database with same CATH superfamily
3HOUI 3S14I 4MD7A 2RHBA 2GTIA 1S72Z 1K8A1 3CCU1 1W2BY 1JWHC 2QEXZ 1I50I 2QRCB 2R7ZI 2VPXA 2ZAEB 4RS4A 4NBDA 2EGTA 2RIQA 2K5RA 2RT9A 2YADA 1QYPA 1YJWZ 1KC81 1YJN1 4RVGA 4A3CI 1VQM1 3EERA 2RBLA 4NB8A 3PO2I 5C3EI 1K9M2 2QR1B 3GTGI 1WW9A 1YHQZ 1VQO1 2H85A 4HGYA 3CMAZ 3CC71 1QXFA 2JUBA 1W2BZ 1VQLZ 3CXCZ 1I6HI 1K731 2JIPA 2R93I 2OTJZ 4CL1A 4Y52I 2PM9A 2OOYB 3GCFA 3CCSZ 3GTLI 3I561 1VQNZ 4NH1C 1FDOA 4HGZA 5C4XI 3FKII 3CD6Z 3CCV1 2JIOA 3GTQI 3MZKB 4DQYB 3HOXI 2E2HI 3CCLZ 4A3BI 3CCQZ 3MZLB 2JA8I 3I07A 1VQKZ 3F3PC 1Q812 1QVGZ 3GTKI 2AKLA 3S1NI 1FDIA 1QVFZ 4MONA 1QF8A 2LFUA 3IF8A 4NB9A 1Q822 1YIJZ 2OZKA 3CCR1 4RV9A 3JAMb 1X3WA 4E30A 3J81f 1VQ71 3JAMf 2R92I 3H3VJ 1Q862 3HOYI 3G4SZ 2JS4A 5IP9I 4NFRA 2OTL1 3I4NI 3D2LA 5FLXb 3IX0A 2NVYI 3CME1 3G711 4MD8A 5FLXf 2AYDA 3I551 3S1QI 2E7ZA 3VMHA 1VQ5Z 1VQ81 4E2XA 5FLMI 2Q51A 2QKDA 3VMGA 1AA6A 2LIYA 1KD12 2JR6A 3FQQA 3CCM1 2QA41 3OW2Z 2O53A 2V3VA 2JIQA 2I3CA 3HOVI 4RVFA 3CCJ1 2JA5I 2WAQA 1TWAI 4E32A 2K3RA 3CCUZ 3PO3I 4BBRI 3PO3S 4QTTA 1Y1WI 5CM2M 1YI21 1Z01A 3S2HI 3GTMI 3CC21 2NAPA 3GTMS 2PMZA 3TE5B 1YJNZ 1YIT1 1Z03A 1VQMZ 1ML8A 3FQMA 1JJ2Y 3VMIA 1KC82 1VQOZ 3NFZA 1NJI2 1WIIA 2QRDB 1VQ61 2QEX1 4QTUA 3CC7Z 2O4HA 2P28A 1I3QI 1Q7Y1 1TFIA 3HOWI 4BY1I 3I56Z 2JIRA 3IFUA 3CCE1 3CCVZ 5C4JI 3F3FC 1YHQ1 4AYBA 1PFTA 1JJ2Z 4A3GI 3CQZI 3NH5A 2E9HA 1VQL1 3VTNA 1VQP1 2OTJ1 1YUKA 2NVXI 3Q87A 1VQ91 3D6WA 2BJOA 1VQN1 1LQLA 1N8R2 5D1OA 1Z02A 3CCRZ 2PK7A 1Q811 1VQ7Z 2E2JI 3VB9A 2VUGA 3RZDI 3S15I 1USPA 1YUAA 2P3YA 1M902 5A2Qb 5D1PA 2OTLZ 3U50C 5A2Qf 3BG1B 2F4OA 3CMEZ 3H0GI 3KIHA 1TWFI 2HF1A 2NVQI 1K83I 4RVHA 3I55Z 1TWGI 3MONA 2W03A 4TNUA 1YIJ1 1KQSY 3G6E1 3CPWY 1SIWA 5T67A 1M1K1 3CC41 3S2DI 1YJ91 4NBCA 5IT9b 2DE6A 3QWUA 4MD9A 3BG0B 4DGLA 4S1TA 3CCMZ 2QA4Z 2NVTI 1RO0A 4MH4A 3GTPI 2G2KA 2R6MA 3CCJZ 2QLVB 2F4MA 1KD11 1RLYA 2V8IA 4MXUA 1VQ41 1X0TA 1YI2Z 2M6NA 4NOZA 4XX2A 2GTHA 4HH4A 1K8A2 3S17I 4NBFA 1TWCI 2DE5A 3NH4A 4BBSI 2DE7A 3T4NB 4E2YA 1ZB9A 3K7AI 2B63I 2V45A 1RNIA 4RVDA 3CXCY 2M48A 1VQ6Z 2V8JA 1S721 2KPIA 1ZB8A 1NP6A 3NH8A 2RPRA 1K9M1 4MRIA 2JNYA 3J7A4 1Q7Y2 1NJI1 3TDHB 1YJW1 3CCEZ 2VPWA 1K732 2VF1A 2WB1A 1DL6A 1L1OC 3NDJA 4EWCA 2IV2X 1QVGY 5T64A 2JIMA 4BY7I 1ZH1A 4BXXI 1S7MA 3ESWA 3GKQA 4E2ZA 3CMA1 2VPYA 4NBEA 1QVFY 1WCMI 1VQPZ 1SFOI 3M3YI 3NDIA 1R9TI 1VQ9Z 3RZOI 3CCS1 3S1RI 4A3II 4A3LI 1Y8CA 3CD61 3S1MI 4A3JI 1P9NA 3CCL1 3CCQ1 5AN9F 2JA6I 1VQK1 3EEDA 1N8R1 2YU9I 4NBBA 5D1OB 1N2FA 2KI7B 3P5JB 4DK1A 1Q821 2OOXB 1TWHI 3G71Z 5LL6f 4A3FI 3G6EZ 3J81b 1RQFA 1M901 4NBHA 4A3KI 1USPB 1VQ8Z 1Q861 1VLAA 3CC4Z 1YJ9Z 2VPZA 2J6AA 2VUMI 2IZ3A 3OW2Y 3IR7A 1M1K2 2HU9A 2JMOA 3D9XA 3HOZI 3G4S1 5IT9f 4E2WA 4NBGA 3HKZA 1Y1VI 4X6AI 3KIFA 2Q4ZA 1Y1VS 5C44I 4A3MI 2W04A 2IZ4A 3LUSA 3I4MI 1KRLA 1X3ZA 4E33A 2LEXA 3GTJI 3M4OI 4Y7NI 1VQ51 1RO4A 1WZNA 2V8KA 3S16I 2Y0SA 1KQSZ 3CPWZ 4A93I 1VQ4Z 5T6BA 1NUIA 3GTOI 2GU2A 4A3EI 4A3DI 2E2II 3CC2Z 4NBAA 1RO2A 3J80b 5IP7I 2QREB 4E31A 1WJ2A 1YITZ 1Q16A 2JA7I 3J80f
chains in the Genus database with same CATH topology
3HOUI 3S14I 4MD7A 2RHBA 2GTIA 1S72Z 1K8A1 3CCU1 1W2BY 1JWHC 2QEXZ 1I50I 2QRCB 2R7ZI 2ZAEB 4RS4A 4NBDA 2EGTA 2RIQA 2K5RA 2RT9A 2YADA 1QYPA 1YJWZ 1KC81 1YJN1 4RVGA 4A3CI 1VQM1 3EERA 2RBLA 4NB8A 3PO2I 5C3EI 1K9M2 2QR1B 3GTGI 1WW9A 1YHQZ 1VQO1 2H85A 4HGYA 3CMAZ 3CC71 2JUBA 1W2BZ 1VQLZ 3CXCZ 1I6HI 1K731 2R93I 2OTJZ 4CL1A 4Y52I 2PM9A 2OOYB 3GCFA 3CCSZ 3GTLI 3I561 1VQNZ 4NH1C 4HGZA 5C4XI 3FKII 3CD6Z 3CCV1 3GTQI 3MZKB 4DQYB 3HOXI 2E2HI 3CCLZ 4A3BI 3CCQZ 3MZLB 2JA8I 3I07A 1VQKZ 3F3PC 1Q812 1QVGZ 3GTKI 2AKLA 3S1NI 1QVFZ 4MONA 1QF8A 2LFUA 3IF8A 4NB9A 1Q822 1YIJZ 2OZKA 3CCR1 4RV9A 3JAMb 1X3WA 4E30A 3J81f 1VQ71 3JAMf 2R92I 3H3VJ 1Q862 3HOYI 3G4SZ 2JS4A 5IP9I 4NFRA 2OTL1 3I4NI 5FLXb 3IX0A 2NVYI 3CME1 3G711 4MD8A 5FLXf 3I551 3S1QI 3VMHA 1VQ5Z 1VQ81 4E2XA 5FLMI 2Q51A 2QKDA 3VMGA 1KD12 2LIYA 2JR6A 3FQQA 3CCM1 2QA41 3OW2Z 2O53A 2I3CA 3HOVI 4RVFA 3CCJ1 2JA5I 2WAQA 1TWAI 4E32A 2K3RA 3CCUZ 3PO3I 4BBRI 3PO3S 4QTTA 1Y1WI 5CM2M 1YI21 1Z01A 3S2HI 3GTMI 3CC21 3GTMS 2PMZA 3TE5B 1YJNZ 1YIT1 1Z03A 1VQMZ 1ML8A 3FQMA 1JJ2Y 3VMIA 1KC82 1VQOZ 3NFZA 1NJI2 1WIIA 2QRDB 1VQ61 2QEX1 4QTUA 3CC7Z 2O4HA 2P28A 1I3QI 1Q7Y1 1TFIA 3HOWI 4BY1I 3I56Z 3IFUA 3CCE1 3CCVZ 5C4JI 3F3FC 1YHQ1 4AYBA 1PFTA 1JJ2Z 4A3GI 3CQZI 3NH5A 2E9HA 1VQL1 3VTNA 1VQP1 2OTJ1 1YUKA 2NVXI 3Q87A 1VQ91 3D6WA 2BJOA 1VQN1 1LQLA 1N8R2 5D1OA 1Z02A 3CCRZ 2PK7A 1Q811 1VQ7Z 2E2JI 3VB9A 2VUGA 3RZDI 3S15I 1USPA 1YUAA 2P3YA 1M902 5A2Qb 5D1PA 2OTLZ 3U50C 5A2Qf 3BG1B 2F4OA 3CMEZ 3H0GI 3KIHA 1TWFI 2HF1A 2NVQI 1K83I 4RVHA 3I55Z 1TWGI 3MONA 2W03A 4TNUA 1YIJ1 1KQSY 3G6E1 3CPWY 5T67A 1M1K1 3CC41 3S2DI 1YJ91 4NBCA 5IT9b 2DE6A 3QWUA 4MD9A 3BG0B 4DGLA 4S1TA 3CCMZ 2QA4Z 2NVTI 1RO0A 4MH4A 3GTPI 2G2KA 2R6MA 3CCJZ 2QLVB 2F4MA 1KD11 1RLYA 2V8IA 4MXUA 1VQ41 1X0TA 1YI2Z 2M6NA 4NOZA 4XX2A 2GTHA 4HH4A 1K8A2 3S17I 4NBFA 1TWCI 2DE5A 3NH4A 4BBSI 2DE7A 3T4NB 4E2YA 1ZB9A 3K7AI 2B63I 1RNIA 4RVDA 3CXCY 2M48A 1VQ6Z 2V8JA 1S721 2KPIA 1ZB8A 1NP6A 3NH8A 2RPRA 1K9M1 4MRIA 2JNYA 3J7A4 1Q7Y2 1NJI1 3TDHB 1YJW1 3CCEZ 1K732 2VF1A 2WB1A 1DL6A 1L1OC 3NDJA 4EWCA 1QVGY 5T64A 4BY7I 1ZH1A 4BXXI 1S7MA 3ESWA 3GKQA 4E2ZA 3CMA1 4NBEA 1QVFY 1WCMI 1VQPZ 1SFOI 3M3YI 3NDIA 1R9TI 1VQ9Z 3RZOI 3CCS1 3S1RI 4A3II 4A3LI 3CD61 3S1MI 4A3JI 1P9NA 3CCL1 3CCQ1 5AN9F 2JA6I 1VQK1 3EEDA 1N8R1 2YU9I 4NBBA 5D1OB 1N2FA 2KI7B 3P5JB 4DK1A 1Q821 2OOXB 1TWHI 3G71Z 5LL6f 4A3FI 3G6EZ 3J81b 1RQFA 1M901 4NBHA 4A3KI 1USPB 1VQ8Z 1Q861 1VLAA 3CC4Z 1YJ9Z 2J6AA 2VUMI 2IZ3A 3OW2Y 1M1K2 2HU9A 2JMOA 3D9XA 3HOZI 3G4S1 5IT9f 4E2WA 4NBGA 3HKZA 1Y1VI 4X6AI 4A3MI 2Q4ZA 1Y1VS 3KIFA 5C44I 2W04A 2IZ4A 3LUSA 3I4MI 1KRLA 1X3ZA 4E33A 3GTJI 3M4OI 4Y7NI 1VQ51 1RO4A 2V8KA 3S16I 2Y0SA 1KQSZ 3CPWZ 4A93I 1VQ4Z 5T6BA 1NUIA 3GTOI 2GU2A 4A3EI 4A3DI 2E2II 3CC2Z 4NBAA 1RO2A 3J80b 5IP7I 2QREB 4E31A 1YITZ 2JA7I 3J80f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 A; 
#chains in the Genus database with same CATH topology
 3HOU I;  3S14 I;  4MD7 A;  2RHB A;  2GTI A;  1S72 Z;  1K8A 1;  3CCU 1;  1W2B Y;  1JWH C;  2QEX Z;  1I50 I;  2QRC B;  2R7Z I;  2VPX A;  2ZAE B;  4RS4 A;  4NBD A;  2EGT A;  2RIQ A;  2K5R A;  2RT9 A;  2YAD A;  1QYP A;  1YJW Z;  1KC8 1;  1YJN 1;  4RVG A;  4A3C I;  1VQM 1;  3EER A;  2RBL A;  4NB8 A;  3PO2 I;  5C3E I;  1K9M 2;  2QR1 B;  3GTG I;  1WW9 A;  1YHQ Z;  1VQO 1;  2H85 A;  4HGY A;  3CMA Z;  3CC7 1;  1QXF A;  2JUB A;  1W2B Z;  1VQL Z;  3CXC Z;  1I6H I;  1K73 1;  2JIP A;  2R93 I;  2OTJ Z;  4CL1 A;  4Y52 I;  2PM9 A;  2OOY B;  3GCF A;  3CCS Z;  3GTL I;  3I56 1;  1VQN Z;  4NH1 C;  1FDO A;  4HGZ A;  5C4X I;  3FKI I;  3CD6 Z;  3CCV 1;  2JIO A;  3GTQ I;  3MZK B;  4DQY B;  3HOX I;  2E2H I;  3CCL Z;  4A3B I;  3CCQ Z;  3MZL B;  2JA8 I;  3I07 A;  1VQK Z;  3F3P C;  1Q81 2;  1QVG Z;  3GTK I;  2AKL A;  3S1N I;  1FDI A;  1QVF Z;  4MON A;  1QF8 A;  2LFU A;  3IF8 A;  4NB9 A;  1Q82 2;  1YIJ Z;  2OZK A;  3CCR 1;  4RV9 A;  3JAM b;  1X3W A;  4E30 A;  3J81 f;  1VQ7 1;  3JAM f;  2R92 I;  3H3V J;  1Q86 2;  3HOY I;  3G4S Z;  2JS4 A;  5IP9 I;  4NFR A;  2OTL 1;  3I4N I;  3D2L A;  5FLX b;  3IX0 A;  2NVY I;  3CME 1;  3G71 1;  4MD8 A;  5FLX f;  2AYD A;  3I55 1;  3S1Q I;  2E7Z A;  3VMH A;  1VQ5 Z;  1VQ8 1;  4E2X A;  5FLM I;  2Q51 A;  2QKD A;  3VMG A;  1AA6 A;  2LIY A;  1KD1 2;  2JR6 A;  3FQQ A;  3CCM 1;  2QA4 1;  3OW2 Z;  2O53 A;  2V3V A;  2JIQ A;  2I3C A;  3HOV I;  4RVF A;  3CCJ 1;  2JA5 I;  2WAQ A;  1TWA I;  4E32 A;  2K3R A;  3CCU Z;  3PO3 I;  4BBR I;  3PO3 S;  4QTT A;  1Y1W I;  5CM2 M;  1YI2 1;  1Z01 A;  3S2H I;  3GTM I;  3CC2 1;  2NAP A;  3GTM S;  2PMZ A;  3TE5 B;  1YJN Z;  1YIT 1;  1Z03 A;  1VQM Z;  1ML8 A;  3FQM A;  1JJ2 Y;  3VMI A;  1KC8 2;  1VQO Z;  3NFZ A;  1NJI 2;  1WII A;  2QRD B;  1VQ6 1;  2QEX 1;  4QTU A;  3CC7 Z;  2O4H A;  2P28 A;  1I3Q I;  1Q7Y 1;  1TFI A;  3HOW I;  4BY1 I;  3I56 Z;  2JIR A;  3IFU A;  3CCE 1;  3CCV Z;  5C4J I;  3F3F C;  1YHQ 1;  4AYB A;  1PFT A;  1JJ2 Z;  4A3G I;  3CQZ I;  3NH5 A;  2E9H A;  1VQL 1;  3VTN A;  1VQP 1;  2OTJ 1;  1YUK A;  2NVX I;  3Q87 A;  1VQ9 1;  3D6W A;  2BJO A;  1VQN 1;  1LQL A;  1N8R 2;  5D1O A;  1Z02 A;  3CCR Z;  2PK7 A;  1Q81 1;  1VQ7 Z;  2E2J I;  3VB9 A;  2VUG A;  3RZD I;  3S15 I;  1USP A;  1YUA A;  2P3Y A;  1M90 2;  5A2Q b;  5D1P A;  2OTL Z;  3U50 C;  5A2Q f;  3BG1 B;  2F4O A;  3CME Z;  3H0G I;  3KIH A;  1TWF I;  2HF1 A;  2NVQ I;  1K83 I;  4RVH A;  3I55 Z;  1TWG I;  3MON A;  2W03 A;  4TNU A;  1YIJ 1;  1KQS Y;  3G6E 1;  3CPW Y;  1SIW A;  5T67 A;  1M1K 1;  3CC4 1;  3S2D I;  1YJ9 1;  4NBC A;  5IT9 b;  2DE6 A;  3QWU A;  4MD9 A;  3BG0 B;  4DGL A;  4S1T A;  3CCM Z;  2QA4 Z;  2NVT I;  1RO0 A;  4MH4 A;  3GTP I;  2G2K A;  2R6M A;  3CCJ Z;  2QLV B;  2F4M A;  1KD1 1;  1RLY A;  2V8I A;  4MXU A;  1VQ4 1;  1X0T A;  1YI2 Z;  2M6N A;  4NOZ A;  4XX2 A;  2GTH A;  4HH4 A;  1K8A 2;  3S17 I;  4NBF A;  1TWC I;  2DE5 A;  3NH4 A;  4BBS I;  2DE7 A;  3T4N B;  4E2Y A;  1ZB9 A;  3K7A I;  2B63 I;  2V45 A;  1RNI A;  4RVD A;  3CXC Y;  2M48 A;  1VQ6 Z;  2V8J A;  1S72 1;  2KPI A;  1ZB8 A;  1NP6 A;  3NH8 A;  2RPR A;  1K9M 1;  4MRI A;  2JNY A;  3J7A 4;  1Q7Y 2;  1NJI 1;  3TDH B;  1YJW 1;  3CCE Z;  2VPW A;  1K73 2;  2VF1 A;  2WB1 A;  1DL6 A;  1L1O C;  3NDJ A;  4EWC A;  2IV2 X;  1QVG Y;  5T64 A;  2JIM A;  4BY7 I;  1ZH1 A;  4BXX I;  1S7M A;  3ESW A;  3GKQ A;  4E2Z A;  3CMA 1;  2VPY A;  4NBE A;  1QVF Y;  1WCM I;  1VQP Z;  1SFO I;  3M3Y I;  3NDI A;  1R9T I;  1VQ9 Z;  3RZO I;  3CCS 1;  3S1R I;  4A3I I;  4A3L I;  1Y8C A;  3CD6 1;  3S1M I;  4A3J I;  1P9N A;  3CCL 1;  3CCQ 1;  5AN9 F;  2JA6 I;  1VQK 1;  3EED A;  1N8R 1;  2YU9 I;  4NBB A;  5D1O B;  1N2F A;  2KI7 B;  3P5J B;  4DK1 A;  1Q82 1;  2OOX B;  1TWH I;  3G71 Z;  5LL6 f;  4A3F I;  3G6E Z;  3J81 b;  1RQF A;  1M90 1;  4NBH A;  4A3K I;  1USP B;  1VQ8 Z;  1Q86 1;  1VLA A;  3CC4 Z;  1YJ9 Z;  2VPZ A;  2J6A A;  2VUM I;  2IZ3 A;  3OW2 Y;  3IR7 A;  1M1K 2;  2HU9 A;  2JMO A;  3D9X A;  3HOZ I;  3G4S 1;  5IT9 f;  4E2W A;  4NBG A;  3HKZ A;  1Y1V I;  4X6A I;  3KIF A;  2Q4Z A;  1Y1V S;  5C44 I;  4A3M I;  2W04 A;  2IZ4 A;  3LUS A;  3I4M I;  1KRL A;  1X3Z A;  4E33 A;  2LEX A;  3GTJ I;  3M4O I;  4Y7N I;  1VQ5 1;  1RO4 A;  1WZN A;  2V8K A;  3S16 I;  2Y0S A;  1KQS Z;  3CPW Z;  4A93 I;  1VQ4 Z;  5T6B A;  1NUI A;  3GTO I;  2GU2 A;  4A3E I;  4A3D I;  2E2I I;  3CC2 Z;  4NBA A;  1RO2 A;  3J80 b;  5IP7 I;  2QRE B;  4E31 A;  1WJ2 A;  1YIT Z;  1Q16 A;  2JA7 I;  3J80 f; 
#chains in the Genus database with same CATH homology
 3HOU I;  3S14 I;  4MD7 A;  2RHB A;  2GTI A;  1S72 Z;  1K8A 1;  3CCU 1;  1W2B Y;  1JWH C;  2QEX Z;  1I50 I;  2QRC B;  2R7Z I;  2ZAE B;  4RS4 A;  4NBD A;  2EGT A;  2RIQ A;  2K5R A;  2RT9 A;  2YAD A;  1QYP A;  1YJW Z;  1KC8 1;  1YJN 1;  4RVG A;  4A3C I;  1VQM 1;  3EER A;  2RBL A;  4NB8 A;  3PO2 I;  5C3E I;  1K9M 2;  2QR1 B;  3GTG I;  1WW9 A;  1YHQ Z;  1VQO 1;  2H85 A;  4HGY A;  3CMA Z;  3CC7 1;  2JUB A;  1W2B Z;  1VQL Z;  3CXC Z;  1I6H I;  1K73 1;  2R93 I;  2OTJ Z;  4CL1 A;  4Y52 I;  2PM9 A;  2OOY B;  3GCF A;  3CCS Z;  3GTL I;  3I56 1;  1VQN Z;  4NH1 C;  4HGZ A;  5C4X I;  3FKI I;  3CD6 Z;  3CCV 1;  3GTQ I;  3MZK B;  4DQY B;  3HOX I;  2E2H I;  3CCL Z;  4A3B I;  3CCQ Z;  3MZL B;  2JA8 I;  3I07 A;  1VQK Z;  3F3P C;  1Q81 2;  1QVG Z;  3GTK I;  2AKL A;  3S1N I;  1QVF Z;  4MON A;  1QF8 A;  2LFU A;  3IF8 A;  4NB9 A;  1Q82 2;  1YIJ Z;  2OZK A;  3CCR 1;  4RV9 A;  3JAM b;  1X3W A;  4E30 A;  3J81 f;  1VQ7 1;  3JAM f;  2R92 I;  3H3V J;  1Q86 2;  3HOY I;  3G4S Z;  2JS4 A;  5IP9 I;  4NFR A;  2OTL 1;  3I4N I;  5FLX b;  3IX0 A;  2NVY I;  3CME 1;  3G71 1;  4MD8 A;  5FLX f;  3I55 1;  3S1Q I;  3VMH A;  1VQ5 Z;  1VQ8 1;  4E2X A;  5FLM I;  2Q51 A;  2QKD A;  3VMG A;  1KD1 2;  2LIY A;  2JR6 A;  3FQQ A;  3CCM 1;  2QA4 1;  3OW2 Z;  2O53 A;  2I3C A;  3HOV I;  4RVF A;  3CCJ 1;  2JA5 I;  2WAQ A;  1TWA I;  4E32 A;  2K3R A;  3CCU Z;  3PO3 I;  4BBR I;  3PO3 S;  4QTT A;  1Y1W I;  5CM2 M;  1YI2 1;  1Z01 A;  3S2H I;  3GTM I;  3CC2 1;  3GTM S;  2PMZ A;  3TE5 B;  1YJN Z;  1YIT 1;  1Z03 A;  1VQM Z;  1ML8 A;  3FQM A;  1JJ2 Y;  3VMI A;  1KC8 2;  1VQO Z;  3NFZ A;  1NJI 2;  1WII A;  2QRD B;  1VQ6 1;  2QEX 1;  4QTU A;  3CC7 Z;  2O4H A;  2P28 A;  1I3Q I;  1Q7Y 1;  1TFI A;  3HOW I;  4BY1 I;  3I56 Z;  3IFU A;  3CCE 1;  3CCV Z;  5C4J I;  3F3F C;  1YHQ 1;  4AYB A;  1PFT A;  1JJ2 Z;  4A3G I;  3CQZ I;  3NH5 A;  2E9H A;  1VQL 1;  3VTN A;  1VQP 1;  2OTJ 1;  1YUK A;  2NVX I;  3Q87 A;  1VQ9 1;  3D6W A;  2BJO A;  1VQN 1;  1LQL A;  1N8R 2;  5D1O A;  1Z02 A;  3CCR Z;  2PK7 A;  1Q81 1;  1VQ7 Z;  2E2J I;  3VB9 A;  2VUG A;  3RZD I;  3S15 I;  1USP A;  1YUA A;  2P3Y A;  1M90 2;  5A2Q b;  5D1P A;  2OTL Z;  3U50 C;  5A2Q f;  3BG1 B;  2F4O A;  3CME Z;  3H0G I;  3KIH A;  1TWF I;  2HF1 A;  2NVQ I;  1K83 I;  4RVH A;  3I55 Z;  1TWG I;  3MON A;  2W03 A;  4TNU A;  1YIJ 1;  1KQS Y;  3G6E 1;  3CPW Y;  5T67 A;  1M1K 1;  3CC4 1;  3S2D I;  1YJ9 1;  4NBC A;  5IT9 b;  2DE6 A;  3QWU A;  4MD9 A;  3BG0 B;  4DGL A;  4S1T A;  3CCM Z;  2QA4 Z;  2NVT I;  1RO0 A;  4MH4 A;  3GTP I;  2G2K A;  2R6M A;  3CCJ Z;  2QLV B;  2F4M A;  1KD1 1;  1RLY A;  2V8I A;  4MXU A;  1VQ4 1;  1X0T A;  1YI2 Z;  2M6N A;  4NOZ A;  4XX2 A;  2GTH A;  4HH4 A;  1K8A 2;  3S17 I;  4NBF A;  1TWC I;  2DE5 A;  3NH4 A;  4BBS I;  2DE7 A;  3T4N B;  4E2Y A;  1ZB9 A;  3K7A I;  2B63 I;  1RNI A;  4RVD A;  3CXC Y;  2M48 A;  1VQ6 Z;  2V8J A;  1S72 1;  2KPI A;  1ZB8 A;  1NP6 A;  3NH8 A;  2RPR A;  1K9M 1;  4MRI A;  2JNY A;  3J7A 4;  1Q7Y 2;  1NJI 1;  3TDH B;  1YJW 1;  3CCE Z;  1K73 2;  2VF1 A;  2WB1 A;  1DL6 A;  1L1O C;  3NDJ A;  4EWC A;  1QVG Y;  5T64 A;  4BY7 I;  1ZH1 A;  4BXX I;  1S7M A;  3ESW A;  3GKQ A;  4E2Z A;  3CMA 1;  4NBE A;  1QVF Y;  1WCM I;  1VQP Z;  1SFO I;  3M3Y I;  3NDI A;  1R9T I;  1VQ9 Z;  3RZO I;  3CCS 1;  3S1R I;  4A3I I;  4A3L I;  3CD6 1;  3S1M I;  4A3J I;  1P9N A;  3CCL 1;  3CCQ 1;  5AN9 F;  2JA6 I;  1VQK 1;  3EED A;  1N8R 1;  2YU9 I;  4NBB A;  5D1O B;  1N2F A;  2KI7 B;  3P5J B;  4DK1 A;  1Q82 1;  2OOX B;  1TWH I;  3G71 Z;  5LL6 f;  4A3F I;  3G6E Z;  3J81 b;  1RQF A;  1M90 1;  4NBH A;  4A3K I;  1USP B;  1VQ8 Z;  1Q86 1;  1VLA A;  3CC4 Z;  1YJ9 Z;  2J6A A;  2VUM I;  2IZ3 A;  3OW2 Y;  1M1K 2;  2HU9 A;  2JMO A;  3D9X A;  3HOZ I;  3G4S 1;  5IT9 f;  4E2W A;  4NBG A;  3HKZ A;  1Y1V I;  4X6A I;  4A3M I;  2Q4Z A;  1Y1V S;  3KIF A;  5C44 I;  2W04 A;  2IZ4 A;  3LUS A;  3I4M I;  1KRL A;  1X3Z A;  4E33 A;  3GTJ I;  3M4O I;  4Y7N I;  1VQ5 1;  1RO4 A;  2V8K A;  3S16 I;  2Y0S A;  1KQS Z;  3CPW Z;  4A93 I;  1VQ4 Z;  5T6B A;  1NUI A;  3GTO I;  2GU2 A;  4A3E I;  4A3D I;  2E2I I;  3CC2 Z;  4NBA A;  1RO2 A;  3J80 b;  5IP7 I;  2QRE B;  4E31 A;  1YIT Z;  2JA7 I;  3J80 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...