3IF8A

Crystal structure of zwilch, a member of the rzz kinetochore complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
314
structure length
265
Chain Sequence
GPLGSMWERLNCAAEDFYSRLLQKFNEEKKGIRKDPFLYEADVQVQLISKGQPNPLKNILNENDIVFIVEKVPGPLALPVGKARQLIGLYTMAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSQTAIALDISWSPVDEILQIPPLSSTATLNIKHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein zwilch homolog
publication title Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 54
structure length 265
sequence length 314
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.230 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3if8A02
3IF8A
chains in the Genus database with same CATH superfamily
1M1K1 2NVTI 1VLAA 2NVQI 2RPRA 5D1PA 3U50C 1VQMZ 2W03A 4DGLA 2JS4A 3G71Z 4A3II 1RO0A 1YJN1 3MZKB 2QA41 5D1OB 4A3DI 1VQN1 1VQ8Z 1WW9A 4RVDA 1QXFA 2R93I 4X6AI 2QRCB 1YI21 1QVFZ 1VQLZ 3NH8A 2DE7A 4A3JI 3I55Z 4NB9A 1KQSZ 2QR1B 1VQOZ 3I07A 1Y1WI 3CD6Z 3CMAZ 2BJOA 4A3MI 2G2KA 3BG1B 2JIQA 1Q16A 1X0TA 4TNUA 1VQK1 3GTMI 1RNIA 3CCV1 2YU9I 3OW2Y 2VPZA 2OTLZ 5IT9b 4BBSI 1KRLA 1TWGI 2JIMA 1Y8CA 1YITZ 2E7ZA 1K9M2 3CCR1 1RO4A 4NBAA 2RIQA 3FKII 4NB8A 3S1RI 1VQ61 2V3VA 1JJ2Y 1NUIA 3CMEZ 2JIPA 1K732 1WJ2A 3M3YI 1VQ4Z 4NH1C 2O4HA 4CL1A 3CC4Z 4RVFA 4A3GI 1QVGY 2E2II 2R6MA 1X3WA 3S2HI 5IP9I 1ZB9A 3CCQZ 2DE5A 2LIYA 3S17I 3P5JB 1P9NA 1VQ91 3D2LA 3G6EZ 3G4SZ 3LUSA 4NBBA 1S72Z 3CPWZ 2E2JI 1R9TI 3GCFA 3CC21 4EWCA 1VQP1 2OOXB 4RVGA 2K3RA 4RS4A 3CCSZ 2LFUA 2QKDA 3HOVI 3ESWA 1DL6A 3MONA 3IR7A 4NFRA 2AYDA 2GTIA 1L1OC 5A2Qb 1K9M1 2Q51A 5FLXb 3I561 2E2HI 4BY1I 3CCMZ 2I3CA 5LL6f 1Q7Y2 1YJ9Z 3H0GI 2R92I 2IZ4A 3D6WA 4DQYB 5CM2M 2QEXZ 4NBEA 4NBGA 3KIHA 3HOUI 3K7AI 1FDOA 3I4NI 4MD7A 4A3KI 3GTMS 2JA6I 1RO2A 2JIOA 1USPB 3GTPI 2WB1A 2Y0SA 3CCVZ 4E2XA 3CCJ1 3J80f 2V8JA 4MXUA 2ZAEB 2JIRA 3RZDI 3GTOI 3CXCZ 4Y7NI 3CCLZ 1VQ71 2O53A 4E32A 3PO3I 1YHQ1 1Q7Y1 1AA6A 1TWFI 3TDHB 3TE5B 4E30A 5FLMI 3JAMf 1I3QI 3FQMA 1W2BZ 1PFTA 2JUBA 3Q87A 5AN9F 1KD12 1YIJ1 2IZ3A 2V45A 3J81f 1ZB8A 3IFUA 5T64A 4BBRI 1SFOI 3T4NB 2OTJ1 3NH5A 4HH4A 1ZH1A 3CCE1 1VQL1 3GTGI 2GU2A 3S16I 3RZOI 3I551 1WZNA 4HGZA 2NAPA 3S1NI 4A3LI 1Q811 2RT9A 1VQO1 1S7MA 1TWAI 3CC2Z 2F4OA 1WIIA 1WCMI 5D1OA 1RLYA 3GTLI 1FDIA 1USPA 1YIT1 1RQFA 2OOYB 1JWHC 3QWUA 4E33A 3S1QI 3NFZA 3EEDA 4MD8A 2QLVB 4AYBA 2M48A 4A3FI 2H85A 2VPXA 2WAQA 2DE6A 3VMIA 4DK1A 3CME1 1KD11 1YJW1 2QRDB 3OW2Z 1VQ41 3FQQA 3CCUZ 3IX0A 1K83I 4NBDA 1YUAA 2HU9A 4A3CI 2JNYA 3VMGA 2F4MA 4MH4A 1YJNZ 2QA4Z 1VQNZ 4RVHA 1JJ2Z 3S2DI 3G6E1 2VPWA 4QTUA 1YI2Z 3PO2I 3CCJZ 3J7A4 1S721 3BG0B 4NBHA 1QYPA 1QVGZ 3D9XA 2NVXI 3PO3S 1TWCI 4E2YA 2E9HA 2KI7B 1VQ7Z 1Q812 1NP6A 3HOWI 1QF8A 3VB9A 1KC81 3VTNA 2VF1A 1VQKZ 2KPIA 3NH4A 4Y52I 3KIFA 4A3BI 3GTQI 1VQ51 3HOYI 4HGYA 4NOZA 3CCRZ 1YIJZ 5C44I 3HOZI 4A93I 2VPYA 1K8A2 2QEX1 3CC71 3HOXI 2OTJZ 3CCEZ 3NDJA 1VQ6Z 3H3VJ 4QTTA 3J80b 5IT9f 2OZKA 3MZLB 3GKQA 3GTKI 1VQM1 3CPWY 1TWHI 3G711 2W04A 3S14I 2QREB 2IV2X 4MRIA 2AKLA 5C3EI 1VQ81 4E31A 4A3EI 3F3FC 4E2WA 3JAMb 3HKZA 4XX2A 2R7ZI 1N8R2 1M902 2K5RA 2VUMI 1Q821 1VQ9Z 4BXXI 3CCL1 3CD61 3J81b 3CMA1 1Y1VS 3I4MI 5IP7I 2GTHA 1VQPZ 5C4JI 1I6HI 2LEXA 3S1MI 3VMHA 2JR6A 3NDIA 2OTL1 5C4XI 4BY7I 4NBCA 3S15I 1YJWZ 1N2FA 3I56Z 1KC82 1K8A1 2V8KA 1Q862 5T67A 2P28A 1I50I 1Y1VI 1NJI2 2VUGA 1M1K2 4MONA 2Q4ZA 2JA7I 4S1TA 1QVFY 1X3ZA 4MD9A 5A2Qf 5FLXf 3CC41 1ML8A 2RHBA 1KQSY 3CXCY 1LQLA 2YADA 2JA8I 2M6NA 2PMZA 2PM9A 2JA5I 3CCQ1 1SIWA 1Z02A 1N8R1 1M901 5T6BA 4E2ZA 2HF1A 3IF8A 1YUKA 1W2BY 4NBFA 3G4S1 2J6AA 2RBLA 2PK7A 3F3PC 3GTJI 2B63I 1VQ5Z 3CCS1 1Z01A 4RV9A 3CQZI 1Q822 1TFIA 3EERA 2EGTA 2NVYI 1K731 2JMOA 2V8IA 3CC7Z 1YHQZ 3CCU1 3CCM1 1Q861 1Z03A 2P3YA 3M4OI 1NJI1 1YJ91
chains in the Genus database with same CATH topology
1M1K1 2NVTI 1VLAA 2NVQI 2RPRA 5D1PA 3U50C 1VQMZ 2W03A 4DGLA 2JS4A 3G71Z 4A3II 1RO0A 1YJN1 3MZKB 2QA41 5D1OB 4A3DI 1VQN1 1VQ8Z 1WW9A 4RVDA 2R93I 4X6AI 2QRCB 1YI21 1QVFZ 1VQLZ 3NH8A 2DE7A 4A3JI 3I55Z 4NB9A 1KQSZ 2QR1B 1VQOZ 3I07A 1Y1WI 3CD6Z 3CMAZ 2BJOA 4A3MI 2G2KA 3BG1B 1X0TA 4TNUA 1VQK1 3GTMI 1RNIA 3CCV1 2YU9I 3OW2Y 2OTLZ 5IT9b 4BBSI 1KRLA 1TWGI 1YITZ 1K9M2 3CCR1 1RO4A 4NBAA 2RIQA 3FKII 4NB8A 3S1RI 1VQ61 1JJ2Y 1NUIA 3CMEZ 1K732 3M3YI 1VQ4Z 4NH1C 2O4HA 4CL1A 3CC4Z 4RVFA 4A3GI 1QVGY 2E2II 2R6MA 1X3WA 3S2HI 5IP9I 1ZB9A 3CCQZ 2DE5A 2LIYA 3S17I 3P5JB 1P9NA 1VQ91 3G6EZ 3G4SZ 3LUSA 4NBBA 1S72Z 3CPWZ 2E2JI 1R9TI 3GCFA 3CC21 4EWCA 1VQP1 2OOXB 4RVGA 2K3RA 4RS4A 3CCSZ 2LFUA 2QKDA 3HOVI 3ESWA 1DL6A 3MONA 4NFRA 2GTIA 1L1OC 5A2Qb 1K9M1 2Q51A 5FLXb 3I561 2E2HI 4BY1I 3CCMZ 2I3CA 5LL6f 1Q7Y2 1YJ9Z 3H0GI 2R92I 2IZ4A 3D6WA 4DQYB 5CM2M 2QEXZ 4NBEA 4NBGA 3KIHA 3HOUI 3K7AI 3I4NI 4MD7A 4A3KI 3GTMS 2JA6I 1RO2A 1USPB 3GTPI 2WB1A 2Y0SA 3CCVZ 4E2XA 3CCJ1 3J80f 2V8JA 4MXUA 2ZAEB 3RZDI 3GTOI 3CXCZ 4Y7NI 3CCLZ 1VQ71 2O53A 4E32A 3PO3I 1YHQ1 1Q7Y1 1TWFI 3TDHB 3TE5B 4E30A 5FLMI 3JAMf 1I3QI 3FQMA 1W2BZ 1PFTA 2JUBA 3Q87A 5AN9F 1KD12 1YIJ1 2IZ3A 3J81f 1ZB8A 3IFUA 5T64A 4BBRI 1SFOI 3T4NB 2OTJ1 3NH5A 4HH4A 1ZH1A 3CCE1 1VQL1 3GTGI 2GU2A 3S16I 3RZOI 3I551 4HGZA 3S1NI 4A3LI 1Q811 1VQO1 2RT9A 1S7MA 1TWAI 3CC2Z 2F4OA 1WIIA 1WCMI 5D1OA 1RLYA 3GTLI 1USPA 1YIT1 1RQFA 2OOYB 1JWHC 3QWUA 4E33A 3S1QI 3NFZA 3EEDA 4MD8A 2QLVB 4AYBA 2M48A 4A3FI 2H85A 2WAQA 2DE6A 3VMIA 4DK1A 3CME1 1KD11 1YJW1 2QRDB 3OW2Z 1VQ41 3FQQA 3CCUZ 3IX0A 1K83I 4NBDA 1YUAA 2HU9A 4A3CI 2JNYA 3VMGA 2F4MA 4MH4A 1YJNZ 2QA4Z 1VQNZ 4RVHA 1JJ2Z 3S2DI 3G6E1 4QTUA 1YI2Z 3PO2I 3CCJZ 3J7A4 1S721 3BG0B 4NBHA 1QYPA 1QVGZ 3D9XA 2NVXI 3PO3S 1TWCI 4E2YA 2E9HA 2KI7B 1VQ7Z 1Q812 1NP6A 3HOWI 1QF8A 3VB9A 1KC81 3VTNA 2VF1A 1VQKZ 2KPIA 3NH4A 4Y52I 3KIFA 4A3BI 3GTQI 1VQ51 3HOYI 4HGYA 4NOZA 3CCRZ 1YIJZ 5C44I 3HOZI 4A93I 1K8A2 2QEX1 3CC71 3HOXI 2OTJZ 3CCEZ 3NDJA 1VQ6Z 3H3VJ 4QTTA 3J80b 5IT9f 2OZKA 3MZLB 3GKQA 3GTKI 1VQM1 3CPWY 1TWHI 3G711 2W04A 3S14I 2QREB 4MRIA 2AKLA 5C3EI 1VQ81 4E31A 4A3EI 3F3FC 4E2WA 3JAMb 3HKZA 4XX2A 2R7ZI 1N8R2 1M902 2K5RA 2VUMI 1Q821 1VQ9Z 4BXXI 3CCL1 3CD61 3J81b 3CMA1 1Y1VS 3I4MI 5IP7I 2GTHA 1VQPZ 5C4JI 1I6HI 3S1MI 3VMHA 2JR6A 3NDIA 2OTL1 5C4XI 4BY7I 4NBCA 3S15I 1YJWZ 1N2FA 3I56Z 1KC82 1K8A1 2V8KA 1Q862 5T67A 2P28A 1I50I 1Y1VI 1NJI2 2VUGA 1M1K2 4MONA 2Q4ZA 2JA7I 4S1TA 1QVFY 1X3ZA 4MD9A 5A2Qf 5FLXf 3CC41 1ML8A 2RHBA 1KQSY 3CXCY 1LQLA 2YADA 2JA8I 2M6NA 2PMZA 2PM9A 2JA5I 3CCQ1 1Z02A 1N8R1 1M901 5T6BA 4E2ZA 2HF1A 3IF8A 1YUKA 1W2BY 4NBFA 3G4S1 2J6AA 2RBLA 2PK7A 3F3PC 3GTJI 2B63I 1VQ5Z 3CCS1 1Z01A 4RV9A 3CQZI 1Q822 1TFIA 3EERA 2EGTA 2NVYI 1K731 2JMOA 2V8IA 3CC7Z 1YHQZ 3CCU1 3CCM1 1Q861 1Z03A 2P3YA 3M4OI 1NJI1 1YJ91
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IF8 A; 
#chains in the Genus database with same CATH topology
 1M1K 1;  2NVT I;  1VLA A;  2NVQ I;  2RPR A;  5D1P A;  3U50 C;  1VQM Z;  2W03 A;  4DGL A;  2JS4 A;  3G71 Z;  4A3I I;  1RO0 A;  1YJN 1;  3MZK B;  2QA4 1;  5D1O B;  4A3D I;  1VQN 1;  1VQ8 Z;  1WW9 A;  4RVD A;  1QXF A;  2R93 I;  4X6A I;  2QRC B;  1YI2 1;  1QVF Z;  1VQL Z;  3NH8 A;  2DE7 A;  4A3J I;  3I55 Z;  4NB9 A;  1KQS Z;  2QR1 B;  1VQO Z;  3I07 A;  1Y1W I;  3CD6 Z;  3CMA Z;  2BJO A;  4A3M I;  2G2K A;  3BG1 B;  2JIQ A;  1Q16 A;  1X0T A;  4TNU A;  1VQK 1;  3GTM I;  1RNI A;  3CCV 1;  2YU9 I;  3OW2 Y;  2VPZ A;  2OTL Z;  5IT9 b;  4BBS I;  1KRL A;  1TWG I;  2JIM A;  1Y8C A;  1YIT Z;  2E7Z A;  1K9M 2;  3CCR 1;  1RO4 A;  4NBA A;  2RIQ A;  3FKI I;  4NB8 A;  3S1R I;  1VQ6 1;  2V3V A;  1JJ2 Y;  1NUI A;  3CME Z;  2JIP A;  1K73 2;  1WJ2 A;  3M3Y I;  1VQ4 Z;  4NH1 C;  2O4H A;  4CL1 A;  3CC4 Z;  4RVF A;  4A3G I;  1QVG Y;  2E2I I;  2R6M A;  1X3W A;  3S2H I;  5IP9 I;  1ZB9 A;  3CCQ Z;  2DE5 A;  2LIY A;  3S17 I;  3P5J B;  1P9N A;  1VQ9 1;  3D2L A;  3G6E Z;  3G4S Z;  3LUS A;  4NBB A;  1S72 Z;  3CPW Z;  2E2J I;  1R9T I;  3GCF A;  3CC2 1;  4EWC A;  1VQP 1;  2OOX B;  4RVG A;  2K3R A;  4RS4 A;  3CCS Z;  2LFU A;  2QKD A;  3HOV I;  3ESW A;  1DL6 A;  3MON A;  3IR7 A;  4NFR A;  2AYD A;  2GTI A;  1L1O C;  5A2Q b;  1K9M 1;  2Q51 A;  5FLX b;  3I56 1;  2E2H I;  4BY1 I;  3CCM Z;  2I3C A;  5LL6 f;  1Q7Y 2;  1YJ9 Z;  3H0G I;  2R92 I;  2IZ4 A;  3D6W A;  4DQY B;  5CM2 M;  2QEX Z;  4NBE A;  4NBG A;  3KIH A;  3HOU I;  3K7A I;  1FDO A;  3I4N I;  4MD7 A;  4A3K I;  3GTM S;  2JA6 I;  1RO2 A;  2JIO A;  1USP B;  3GTP I;  2WB1 A;  2Y0S A;  3CCV Z;  4E2X A;  3CCJ 1;  3J80 f;  2V8J A;  4MXU A;  2ZAE B;  2JIR A;  3RZD I;  3GTO I;  3CXC Z;  4Y7N I;  3CCL Z;  1VQ7 1;  2O53 A;  4E32 A;  3PO3 I;  1YHQ 1;  1Q7Y 1;  1AA6 A;  1TWF I;  3TDH B;  3TE5 B;  4E30 A;  5FLM I;  3JAM f;  1I3Q I;  3FQM A;  1W2B Z;  1PFT A;  2JUB A;  3Q87 A;  5AN9 F;  1KD1 2;  1YIJ 1;  2IZ3 A;  2V45 A;  3J81 f;  1ZB8 A;  3IFU A;  5T64 A;  4BBR I;  1SFO I;  3T4N B;  2OTJ 1;  3NH5 A;  4HH4 A;  1ZH1 A;  3CCE 1;  1VQL 1;  3GTG I;  2GU2 A;  3S16 I;  3RZO I;  3I55 1;  1WZN A;  4HGZ A;  2NAP A;  3S1N I;  4A3L I;  1Q81 1;  2RT9 A;  1VQO 1;  1S7M A;  1TWA I;  3CC2 Z;  2F4O A;  1WII A;  1WCM I;  5D1O A;  1RLY A;  3GTL I;  1FDI A;  1USP A;  1YIT 1;  1RQF A;  2OOY B;  1JWH C;  3QWU A;  4E33 A;  3S1Q I;  3NFZ A;  3EED A;  4MD8 A;  2QLV B;  4AYB A;  2M48 A;  4A3F I;  2H85 A;  2VPX A;  2WAQ A;  2DE6 A;  3VMI A;  4DK1 A;  3CME 1;  1KD1 1;  1YJW 1;  2QRD B;  3OW2 Z;  1VQ4 1;  3FQQ A;  3CCU Z;  3IX0 A;  1K83 I;  4NBD A;  1YUA A;  2HU9 A;  4A3C I;  2JNY A;  3VMG A;  2F4M A;  4MH4 A;  1YJN Z;  2QA4 Z;  1VQN Z;  4RVH A;  1JJ2 Z;  3S2D I;  3G6E 1;  2VPW A;  4QTU A;  1YI2 Z;  3PO2 I;  3CCJ Z;  3J7A 4;  1S72 1;  3BG0 B;  4NBH A;  1QYP A;  1QVG Z;  3D9X A;  2NVX I;  3PO3 S;  1TWC I;  4E2Y A;  2E9H A;  2KI7 B;  1VQ7 Z;  1Q81 2;  1NP6 A;  3HOW I;  1QF8 A;  3VB9 A;  1KC8 1;  3VTN A;  2VF1 A;  1VQK Z;  2KPI A;  3NH4 A;  4Y52 I;  3KIF A;  4A3B I;  3GTQ I;  1VQ5 1;  3HOY I;  4HGY A;  4NOZ A;  3CCR Z;  1YIJ Z;  5C44 I;  3HOZ I;  4A93 I;  2VPY A;  1K8A 2;  2QEX 1;  3CC7 1;  3HOX I;  2OTJ Z;  3CCE Z;  3NDJ A;  1VQ6 Z;  3H3V J;  4QTT A;  3J80 b;  5IT9 f;  2OZK A;  3MZL B;  3GKQ A;  3GTK I;  1VQM 1;  3CPW Y;  1TWH I;  3G71 1;  2W04 A;  3S14 I;  2QRE B;  2IV2 X;  4MRI A;  2AKL A;  5C3E I;  1VQ8 1;  4E31 A;  4A3E I;  3F3F C;  4E2W A;  3JAM b;  3HKZ A;  4XX2 A;  2R7Z I;  1N8R 2;  1M90 2;  2K5R A;  2VUM I;  1Q82 1;  1VQ9 Z;  4BXX I;  3CCL 1;  3CD6 1;  3J81 b;  3CMA 1;  1Y1V S;  3I4M I;  5IP7 I;  2GTH A;  1VQP Z;  5C4J I;  1I6H I;  2LEX A;  3S1M I;  3VMH A;  2JR6 A;  3NDI A;  2OTL 1;  5C4X I;  4BY7 I;  4NBC A;  3S15 I;  1YJW Z;  1N2F A;  3I56 Z;  1KC8 2;  1K8A 1;  2V8K A;  1Q86 2;  5T67 A;  2P28 A;  1I50 I;  1Y1V I;  1NJI 2;  2VUG A;  1M1K 2;  4MON A;  2Q4Z A;  2JA7 I;  4S1T A;  1QVF Y;  1X3Z A;  4MD9 A;  5A2Q f;  5FLX f;  3CC4 1;  1ML8 A;  2RHB A;  1KQS Y;  3CXC Y;  1LQL A;  2YAD A;  2JA8 I;  2M6N A;  2PMZ A;  2PM9 A;  2JA5 I;  3CCQ 1;  1SIW A;  1Z02 A;  1N8R 1;  1M90 1;  5T6B A;  4E2Z A;  2HF1 A;  3IF8 A;  1YUK A;  1W2B Y;  4NBF A;  3G4S 1;  2J6A A;  2RBL A;  2PK7 A;  3F3P C;  3GTJ I;  2B63 I;  1VQ5 Z;  3CCS 1;  1Z01 A;  4RV9 A;  3CQZ I;  1Q82 2;  1TFI A;  3EER A;  2EGT A;  2NVY I;  1K73 1;  2JMO A;  2V8I A;  3CC7 Z;  1YHQ Z;  3CCU 1;  3CCM 1;  1Q86 1;  1Z03 A;  2P3Y A;  3M4O I;  1NJI 1;  1YJ9 1; 
#chains in the Genus database with same CATH homology
 1M1K 1;  2NVT I;  1VLA A;  2NVQ I;  2RPR A;  5D1P A;  3U50 C;  1VQM Z;  2W03 A;  4DGL A;  2JS4 A;  3G71 Z;  4A3I I;  1RO0 A;  1YJN 1;  3MZK B;  2QA4 1;  5D1O B;  4A3D I;  1VQN 1;  1VQ8 Z;  1WW9 A;  4RVD A;  2R93 I;  4X6A I;  2QRC B;  1YI2 1;  1QVF Z;  1VQL Z;  3NH8 A;  2DE7 A;  4A3J I;  3I55 Z;  4NB9 A;  1KQS Z;  2QR1 B;  1VQO Z;  3I07 A;  1Y1W I;  3CD6 Z;  3CMA Z;  2BJO A;  4A3M I;  2G2K A;  3BG1 B;  1X0T A;  4TNU A;  1VQK 1;  3GTM I;  1RNI A;  3CCV 1;  2YU9 I;  3OW2 Y;  2OTL Z;  5IT9 b;  4BBS I;  1KRL A;  1TWG I;  1YIT Z;  1K9M 2;  3CCR 1;  1RO4 A;  4NBA A;  2RIQ A;  3FKI I;  4NB8 A;  3S1R I;  1VQ6 1;  1JJ2 Y;  1NUI A;  3CME Z;  1K73 2;  3M3Y I;  1VQ4 Z;  4NH1 C;  2O4H A;  4CL1 A;  3CC4 Z;  4RVF A;  4A3G I;  1QVG Y;  2E2I I;  2R6M A;  1X3W A;  3S2H I;  5IP9 I;  1ZB9 A;  3CCQ Z;  2DE5 A;  2LIY A;  3S17 I;  3P5J B;  1P9N A;  1VQ9 1;  3G6E Z;  3G4S Z;  3LUS A;  4NBB A;  1S72 Z;  3CPW Z;  2E2J I;  1R9T I;  3GCF A;  3CC2 1;  4EWC A;  1VQP 1;  2OOX B;  4RVG A;  2K3R A;  4RS4 A;  3CCS Z;  2LFU A;  2QKD A;  3HOV I;  3ESW A;  1DL6 A;  3MON A;  4NFR A;  2GTI A;  1L1O C;  5A2Q b;  1K9M 1;  2Q51 A;  5FLX b;  3I56 1;  2E2H I;  4BY1 I;  3CCM Z;  2I3C A;  5LL6 f;  1Q7Y 2;  1YJ9 Z;  3H0G I;  2R92 I;  2IZ4 A;  3D6W A;  4DQY B;  5CM2 M;  2QEX Z;  4NBE A;  4NBG A;  3KIH A;  3HOU I;  3K7A I;  3I4N I;  4MD7 A;  4A3K I;  3GTM S;  2JA6 I;  1RO2 A;  1USP B;  3GTP I;  2WB1 A;  2Y0S A;  3CCV Z;  4E2X A;  3CCJ 1;  3J80 f;  2V8J A;  4MXU A;  2ZAE B;  3RZD I;  3GTO I;  3CXC Z;  4Y7N I;  3CCL Z;  1VQ7 1;  2O53 A;  4E32 A;  3PO3 I;  1YHQ 1;  1Q7Y 1;  1TWF I;  3TDH B;  3TE5 B;  4E30 A;  5FLM I;  3JAM f;  1I3Q I;  3FQM A;  1W2B Z;  1PFT A;  2JUB A;  3Q87 A;  5AN9 F;  1KD1 2;  1YIJ 1;  2IZ3 A;  3J81 f;  1ZB8 A;  3IFU A;  5T64 A;  4BBR I;  1SFO I;  3T4N B;  2OTJ 1;  3NH5 A;  4HH4 A;  1ZH1 A;  3CCE 1;  1VQL 1;  3GTG I;  2GU2 A;  3S16 I;  3RZO I;  3I55 1;  4HGZ A;  3S1N I;  4A3L I;  1Q81 1;  1VQO 1;  2RT9 A;  1S7M A;  1TWA I;  3CC2 Z;  2F4O A;  1WII A;  1WCM I;  5D1O A;  1RLY A;  3GTL I;  1USP A;  1YIT 1;  1RQF A;  2OOY B;  1JWH C;  3QWU A;  4E33 A;  3S1Q I;  3NFZ A;  3EED A;  4MD8 A;  2QLV B;  4AYB A;  2M48 A;  4A3F I;  2H85 A;  2WAQ A;  2DE6 A;  3VMI A;  4DK1 A;  3CME 1;  1KD1 1;  1YJW 1;  2QRD B;  3OW2 Z;  1VQ4 1;  3FQQ A;  3CCU Z;  3IX0 A;  1K83 I;  4NBD A;  1YUA A;  2HU9 A;  4A3C I;  2JNY A;  3VMG A;  2F4M A;  4MH4 A;  1YJN Z;  2QA4 Z;  1VQN Z;  4RVH A;  1JJ2 Z;  3S2D I;  3G6E 1;  4QTU A;  1YI2 Z;  3PO2 I;  3CCJ Z;  3J7A 4;  1S72 1;  3BG0 B;  4NBH A;  1QYP A;  1QVG Z;  3D9X A;  2NVX I;  3PO3 S;  1TWC I;  4E2Y A;  2E9H A;  2KI7 B;  1VQ7 Z;  1Q81 2;  1NP6 A;  3HOW I;  1QF8 A;  3VB9 A;  1KC8 1;  3VTN A;  2VF1 A;  1VQK Z;  2KPI A;  3NH4 A;  4Y52 I;  3KIF A;  4A3B I;  3GTQ I;  1VQ5 1;  3HOY I;  4HGY A;  4NOZ A;  3CCR Z;  1YIJ Z;  5C44 I;  3HOZ I;  4A93 I;  1K8A 2;  2QEX 1;  3CC7 1;  3HOX I;  2OTJ Z;  3CCE Z;  3NDJ A;  1VQ6 Z;  3H3V J;  4QTT A;  3J80 b;  5IT9 f;  2OZK A;  3MZL B;  3GKQ A;  3GTK I;  1VQM 1;  3CPW Y;  1TWH I;  3G71 1;  2W04 A;  3S14 I;  2QRE B;  4MRI A;  2AKL A;  5C3E I;  1VQ8 1;  4E31 A;  4A3E I;  3F3F C;  4E2W A;  3JAM b;  3HKZ A;  4XX2 A;  2R7Z I;  1N8R 2;  1M90 2;  2K5R A;  2VUM I;  1Q82 1;  1VQ9 Z;  4BXX I;  3CCL 1;  3CD6 1;  3J81 b;  3CMA 1;  1Y1V S;  3I4M I;  5IP7 I;  2GTH A;  1VQP Z;  5C4J I;  1I6H I;  3S1M I;  3VMH A;  2JR6 A;  3NDI A;  2OTL 1;  5C4X I;  4BY7 I;  4NBC A;  3S15 I;  1YJW Z;  1N2F A;  3I56 Z;  1KC8 2;  1K8A 1;  2V8K A;  1Q86 2;  5T67 A;  2P28 A;  1I50 I;  1Y1V I;  1NJI 2;  2VUG A;  1M1K 2;  4MON A;  2Q4Z A;  2JA7 I;  4S1T A;  1QVF Y;  1X3Z A;  4MD9 A;  5A2Q f;  5FLX f;  3CC4 1;  1ML8 A;  2RHB A;  1KQS Y;  3CXC Y;  1LQL A;  2YAD A;  2JA8 I;  2M6N A;  2PMZ A;  2PM9 A;  2JA5 I;  3CCQ 1;  1Z02 A;  1N8R 1;  1M90 1;  5T6B A;  4E2Z A;  2HF1 A;  3IF8 A;  1YUK A;  1W2B Y;  4NBF A;  3G4S 1;  2J6A A;  2RBL A;  2PK7 A;  3F3P C;  3GTJ I;  2B63 I;  1VQ5 Z;  3CCS 1;  1Z01 A;  4RV9 A;  3CQZ I;  1Q82 2;  1TFI A;  3EER A;  2EGT A;  2NVY I;  1K73 1;  2JMO A;  2V8I A;  3CC7 Z;  1YHQ Z;  3CCU 1;  3CCM 1;  1Q86 1;  1Z03 A;  2P3Y A;  3M4O I;  1NJI 1;  1YJ9 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...