4MD7A

Crystal structure of full-length symmetric ck2 holoenzyme
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
199
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 199
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md7A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md7A02
2JMOA 4MD7A 2R6MA 3EEDA 4DGLA 1QF8A 2M6NA 2M48A 1JWHC 4NH1C 1RQFA 4MD8A 2RT9A 4MD9A
chains in the Genus database with same CATH superfamily
1VQ9Z 2W03A 2R92I 2QRDB 3GTOI 1KC82 1KD12 3CCMZ 1ZB8A 3CC7Z 1VQ51 1WIIA 1K8A1 3TDHB 3ESWA 2Y0SA 1X0TA 2V8JA 1M901 3IR7A 3CCL1 4QTUA 2OOYB 3M3YI 2B63I 1VQ71 2YADA 1VQ5Z 1K732 1L1OC 3CPWZ 1Z02A 3FQQA 2EGTA 4MRIA 4TNUA 3CCLZ 2IV2X 3HKZA 2AKLA 1M1K1 1VQ7Z 4A3GI 4NBAA 1QVGY 2RT9A 4X6AI 2JIMA 1Y1WI 3BG1B 3J81f 4DGLA 2DE6A 2DE7A 2JA7I 1RQFA 3H3VJ 2K3RA 1K8A2 3I4NI 3VMHA 1VQM1 1M902 1TWHI 3GTGI 2VF1A 1VQO1 2R6MA 1RNIA 3HOUI 1TWCI 3S1RI 2HU9A 3I561 3CXCY 2JIRA 4E2ZA 2M48A 2PK7A 2VPXA 1VQMZ 4Y52I 3G4S1 1VQOZ 1Z03A 3GTKI 4E2YA 2WAQA 1M1K2 3GTLI 1Q16A 3I551 4NB8A 2RHBA 1YUAA 3I56Z 2DE5A 3G4SZ 4RS4A 5C4JI 1X3ZA 1VQK1 1WW9A 1Z01A 2K5RA 3GTJI 1NJI1 3I55Z 4RVGA 2KI7B 4NBDA 2JA6I 1KRLA 2M6NA 1VQP1 3CCR1 1QVGZ 1VQKZ 3CCE1 2ZAEB 2JR6A 4NBBA 2O4HA 1WJ2A 2VPZA 3T4NB 1I3QI 4QTTA 1VQPZ 1KQSY 1NP6A 3CCRZ 1JJ2Z 3KIFA 3S17I 3CCEZ 4MH4A 2R93I 1ZB9A 4DQYB 1PFTA 1Q861 3S2DI 4Y7NI 1I50I 2VUMI 2QA41 3GKQA 1YIT1 2LFUA 2QLVB 3JAMf 3CXCZ 4RVHA 3S1NI 1NJI2 4S1TA 2V3VA 2NVXI 4NOZA 2G2KA 4A3CI 4MXUA 3J80b 2QA4Z 3P5JB 4E31A 1YITZ 3RZOI 5C4XI 2QRCB 2QREB 3PO2I 1NUIA 4BXXI 1Q811 4HH4A 5IT9f 4AYBA 2E2HI 1LQLA 1SIWA 3GTQI 3S2HI 4DK1A 2OOXB 5A2Qf 1Y1VI 1QF8A 3NDJA 3CC21 4NBGA 3VMIA 3CCJ1 1Q862 1Y1VS 3S14I 2WB1A 3MZLB 4MD7A 2GTIA 4A93I 3GTMI 1VQN1 1K9M1 1YHQ1 1W2BY 1X3WA 2VPYA 4NBFA 1YIJ1 3GTMS 1RO0A 5FLMI 1QVFY 3CC2Z 3CCJZ 1VLAA 1TWAI 4RV9A 4A3BI 3D6WA 3PO3S 1VQNZ 1YHQZ 1S7MA 1YIJZ 2R7ZI 1Q812 4A3JI 3IX0A 2JIOA 3MONA 5LL6f 2Q4ZA 4E2WA 5CM2M 2JMOA 3D9XA 2H85A 2PM9A 3H0GI 2HF1A 4RVFA 1ZH1A 2F4OA 2I3CA 1USPA 4NB9A 3J7A4 5IP9I 3VMGA 4E32A 2JA8I 2JIQA 1K9M2 4MD8A 2OZKA 2QEX1 3LUSA 1ML8A 1VQ41 2NVTI 1N2FA 1Q822 2GU2A 1JWHC 3S1MI 1WCMI 1TWFI 2OTL1 1P9NA 2QEXZ 3G711 1YJN1 2RBLA 1VQ81 1VQ4Z 1WZNA 4BY1I 3S1QI 4NBCA 1DL6A 3CPWY 3MZKB 3IFUA 5T67A 1RO4A 3U50C 2OTLZ 2E2II 2NVYI 1I6HI 3D2LA 3G71Z 1VQ8Z 1YJNZ 3J81b 1K83I 1QXFA 1Y8CA 3M4OI 1S721 4RVDA 3HOXI 3OW2Y 2E7ZA 4NBHA 1VQ61 1YI21 3VTNA 5FLXf 4A3LI 3IF8A 2JIPA 2LIYA 4E30A 4NH1C 1S72Z 5T64A 3QWUA 3Q87A 3GCFA 2W04A 1VQ6Z 1R9TI 4E33A 1YI2Z 2O53A 4A3KI 2E9HA 3CQZI 2RPRA 2OTJ1 3HOVI 2VUGA 4BBSI 5C44I 3F3FC 1TWGI 2V8IA 5D1PA 2OTJZ 4HGZA 3KIHA 2BJOA 3GTPI 4NBEA 3CME1 3VB9A 3EERA 1N8R1 5D1OA 1USPB 4A3FI 3NFZA 3NDIA 4A3MI 1KQSZ 3PO3I 2KPIA 2NAPA 3I4MI 1TFIA 1YJ91 3FKII 2JUBA 1Q821 3CMEZ 2E2JI 3CC41 3CCS1 3HOYI 2Q51A 2IZ4A 3NH8A 2F4MA 4BY7I 3OW2Z 2GTHA 2JNYA 1YUKA 1YJ9Z 4NFRA 2YU9I 4CL1A 4E2XA 3CC4Z 1FDIA 3CCSZ 2QKDA 1JJ2Y 3I07A 1Q7Y1 4EWCA 3G6E1 2V8KA 1FDOA 3J80f 3CCU1 3JAMb 1QYPA 3EEDA 1RLYA 3S15I 5FLXb 2NVQI 1N8R2 2RIQA 3G6EZ 3CCQ1 4MD9A 5C3EI 3CCUZ 4XX2A 2LEXA 2JA5I 4MONA 3CMA1 1YJW1 3HOZI 5T6BA 3BG0B 3TE5B 5IT9b 2J6AA 3CCQZ 2QR1B 2V45A 2AYDA 1VQL1 3S16I 1KC81 1KD11 3CMAZ 1W2BZ 1YJWZ 1RO2A 4HGYA 5A2Qb 3CD61 5IP7I 1QVFZ 2JS4A 5AN9F 1AA6A 1Q7Y2 3NH5A 3HOWI 2P28A 3FQMA 1VQLZ 3CCV1 3CD6Z 3RZDI 4A3DI 3K7AI 3NH4A 4A3EI 3F3PC 2IZ3A 1K731 4BBRI 1SFOI 2PMZA 1VQ91 3CCVZ 2P3YA 4A3II 3CCM1 5D1OB 2VPWA 3CC71
chains in the Genus database with same CATH topology
1VQ9Z 2W03A 2R92I 2QRDB 3GTOI 1KC82 1KD12 3CCMZ 1ZB8A 3CC7Z 1VQ51 1WIIA 1K8A1 3TDHB 3ESWA 2Y0SA 1X0TA 2V8JA 1M901 3CCL1 4QTUA 2OOYB 3M3YI 2B63I 1VQ71 2YADA 1VQ5Z 1K732 1L1OC 3CPWZ 1Z02A 3FQQA 2EGTA 4MRIA 4TNUA 3CCLZ 3HKZA 2AKLA 1M1K1 1VQ7Z 4A3GI 4NBAA 1QVGY 2RT9A 4X6AI 1Y1WI 3BG1B 3J81f 4DGLA 2DE6A 2DE7A 2JA7I 1RQFA 3H3VJ 2K3RA 1K8A2 3I4NI 3VMHA 1VQM1 1M902 1TWHI 3GTGI 2VF1A 1VQO1 2R6MA 1RNIA 3HOUI 1TWCI 3S1RI 2HU9A 3I561 3CXCY 4E2ZA 2M48A 2PK7A 1VQMZ 4Y52I 3G4S1 1VQOZ 1Z03A 3GTKI 4E2YA 2WAQA 1M1K2 3GTLI 3I551 4NB8A 2RHBA 1YUAA 3I56Z 2DE5A 3G4SZ 4RS4A 5C4JI 1X3ZA 1VQK1 1WW9A 1Z01A 2K5RA 3GTJI 1NJI1 3I55Z 4RVGA 2KI7B 4NBDA 2JA6I 1KRLA 2M6NA 1VQP1 3CCR1 1QVGZ 1VQKZ 3CCE1 2ZAEB 2JR6A 4NBBA 2O4HA 3T4NB 1I3QI 4QTTA 1VQPZ 1KQSY 1NP6A 3CCRZ 1JJ2Z 3KIFA 3S17I 3CCEZ 4MH4A 2R93I 1ZB9A 4DQYB 1PFTA 1Q861 3S2DI 4Y7NI 1I50I 2VUMI 2QA41 3GKQA 1YIT1 2LFUA 2QLVB 3JAMf 3CXCZ 4RVHA 3S1NI 1NJI2 4S1TA 2NVXI 4NOZA 2G2KA 4A3CI 4MXUA 3J80b 2QA4Z 3P5JB 4E31A 1YITZ 3RZOI 5C4XI 2QRCB 2QREB 3PO2I 1NUIA 4BXXI 1Q811 4HH4A 5IT9f 4AYBA 2E2HI 1LQLA 3GTQI 3S2HI 4DK1A 2OOXB 5A2Qf 1Y1VI 1QF8A 3NDJA 3CC21 4NBGA 3VMIA 3CCJ1 1Q862 1Y1VS 3S14I 2WB1A 3MZLB 4MD7A 2GTIA 4A93I 3GTMI 1VQN1 1K9M1 1YHQ1 1W2BY 1X3WA 4NBFA 1YIJ1 3GTMS 1RO0A 5FLMI 1QVFY 3CC2Z 3CCJZ 1VLAA 1TWAI 4RV9A 4A3BI 3D6WA 3PO3S 1VQNZ 1YHQZ 1S7MA 1YIJZ 2R7ZI 1Q812 4A3JI 3IX0A 3MONA 5LL6f 2Q4ZA 4E2WA 5CM2M 2JMOA 3D9XA 2H85A 2PM9A 3H0GI 2HF1A 4RVFA 1ZH1A 2F4OA 2I3CA 1USPA 4NB9A 3J7A4 5IP9I 3VMGA 4E32A 2JA8I 1K9M2 4MD8A 2OZKA 2QEX1 3LUSA 1ML8A 1VQ41 2NVTI 1N2FA 1Q822 2GU2A 1JWHC 3S1MI 1WCMI 1TWFI 2OTL1 1P9NA 2QEXZ 3G711 1YJN1 2RBLA 1VQ81 1VQ4Z 4BY1I 3S1QI 4NBCA 1DL6A 3CPWY 3MZKB 3IFUA 5T67A 1RO4A 3U50C 2OTLZ 2E2II 2NVYI 1I6HI 3G71Z 1VQ8Z 1YJNZ 3J81b 1K83I 3M4OI 1S721 4RVDA 3HOXI 3OW2Y 4NBHA 1VQ61 1YI21 3VTNA 5FLXf 4A3LI 3IF8A 2LIYA 4E30A 4NH1C 1S72Z 5T64A 3QWUA 3Q87A 3GCFA 2W04A 1VQ6Z 1R9TI 4E33A 1YI2Z 2O53A 4A3KI 2E9HA 3CQZI 2RPRA 2OTJ1 3HOVI 2VUGA 4BBSI 5C44I 3F3FC 1TWGI 2V8IA 5D1PA 2OTJZ 4HGZA 3KIHA 2BJOA 3GTPI 4NBEA 3CME1 3VB9A 3EERA 1N8R1 5D1OA 1USPB 4A3FI 3NFZA 3NDIA 4A3MI 1KQSZ 3PO3I 2KPIA 3I4MI 1TFIA 1YJ91 3FKII 2JUBA 1Q821 3CMEZ 2E2JI 3CC41 3CCS1 3HOYI 2Q51A 2IZ4A 3NH8A 2F4MA 4BY7I 3OW2Z 2GTHA 2JNYA 1YUKA 1YJ9Z 4NFRA 2YU9I 4CL1A 4E2XA 3CC4Z 3CCSZ 2QKDA 1JJ2Y 3I07A 1Q7Y1 4EWCA 3G6E1 2V8KA 3J80f 3CCU1 3JAMb 1QYPA 3EEDA 1RLYA 3S15I 5FLXb 2NVQI 1N8R2 2RIQA 3G6EZ 3CCQ1 4MD9A 5C3EI 3CCUZ 4XX2A 2JA5I 4MONA 3CMA1 1YJW1 3HOZI 5T6BA 3BG0B 3TE5B 5IT9b 2J6AA 3CCQZ 2QR1B 1VQL1 3S16I 1KC81 1KD11 3CMAZ 1W2BZ 1YJWZ 1RO2A 4HGYA 5A2Qb 3CD61 5IP7I 1QVFZ 2JS4A 5AN9F 1Q7Y2 3NH5A 3HOWI 2P28A 3FQMA 1VQLZ 3CCV1 3CD6Z 3RZDI 4A3DI 3K7AI 3NH4A 4A3EI 3F3PC 2IZ3A 1K731 4BBRI 1SFOI 2PMZA 1VQ91 3CCVZ 2P3YA 4A3II 3CCM1 5D1OB 3CC71
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JMO A;  4MD7 A;  2R6M A;  3EED A;  4DGL A;  1QF8 A;  2M6N A;  2M48 A;  1JWH C;  4NH1 C;  1RQF A;  4MD8 A;  2RT9 A;  4MD9 A; 
#chains in the Genus database with same CATH topology
 1VQ9 Z;  2W03 A;  2R92 I;  2QRD B;  3GTO I;  1KC8 2;  1KD1 2;  3CCM Z;  1ZB8 A;  3CC7 Z;  1VQ5 1;  1WII A;  1K8A 1;  3TDH B;  3ESW A;  2Y0S A;  1X0T A;  2V8J A;  1M90 1;  3IR7 A;  3CCL 1;  4QTU A;  2OOY B;  3M3Y I;  2B63 I;  1VQ7 1;  2YAD A;  1VQ5 Z;  1K73 2;  1L1O C;  3CPW Z;  1Z02 A;  3FQQ A;  2EGT A;  4MRI A;  4TNU A;  3CCL Z;  2IV2 X;  3HKZ A;  2AKL A;  1M1K 1;  1VQ7 Z;  4A3G I;  4NBA A;  1QVG Y;  2RT9 A;  4X6A I;  2JIM A;  1Y1W I;  3BG1 B;  3J81 f;  4DGL A;  2DE6 A;  2DE7 A;  2JA7 I;  1RQF A;  3H3V J;  2K3R A;  1K8A 2;  3I4N I;  3VMH A;  1VQM 1;  1M90 2;  1TWH I;  3GTG I;  2VF1 A;  1VQO 1;  2R6M A;  1RNI A;  3HOU I;  1TWC I;  3S1R I;  2HU9 A;  3I56 1;  3CXC Y;  2JIR A;  4E2Z A;  2M48 A;  2PK7 A;  2VPX A;  1VQM Z;  4Y52 I;  3G4S 1;  1VQO Z;  1Z03 A;  3GTK I;  4E2Y A;  2WAQ A;  1M1K 2;  3GTL I;  1Q16 A;  3I55 1;  4NB8 A;  2RHB A;  1YUA A;  3I56 Z;  2DE5 A;  3G4S Z;  4RS4 A;  5C4J I;  1X3Z A;  1VQK 1;  1WW9 A;  1Z01 A;  2K5R A;  3GTJ I;  1NJI 1;  3I55 Z;  4RVG A;  2KI7 B;  4NBD A;  2JA6 I;  1KRL A;  2M6N A;  1VQP 1;  3CCR 1;  1QVG Z;  1VQK Z;  3CCE 1;  2ZAE B;  2JR6 A;  4NBB A;  2O4H A;  1WJ2 A;  2VPZ A;  3T4N B;  1I3Q I;  4QTT A;  1VQP Z;  1KQS Y;  1NP6 A;  3CCR Z;  1JJ2 Z;  3KIF A;  3S17 I;  3CCE Z;  4MH4 A;  2R93 I;  1ZB9 A;  4DQY B;  1PFT A;  1Q86 1;  3S2D I;  4Y7N I;  1I50 I;  2VUM I;  2QA4 1;  3GKQ A;  1YIT 1;  2LFU A;  2QLV B;  3JAM f;  3CXC Z;  4RVH A;  3S1N I;  1NJI 2;  4S1T A;  2V3V A;  2NVX I;  4NOZ A;  2G2K A;  4A3C I;  4MXU A;  3J80 b;  2QA4 Z;  3P5J B;  4E31 A;  1YIT Z;  3RZO I;  5C4X I;  2QRC B;  2QRE B;  3PO2 I;  1NUI A;  4BXX I;  1Q81 1;  4HH4 A;  5IT9 f;  4AYB A;  2E2H I;  1LQL A;  1SIW A;  3GTQ I;  3S2H I;  4DK1 A;  2OOX B;  5A2Q f;  1Y1V I;  1QF8 A;  3NDJ A;  3CC2 1;  4NBG A;  3VMI A;  3CCJ 1;  1Q86 2;  1Y1V S;  3S14 I;  2WB1 A;  3MZL B;  4MD7 A;  2GTI A;  4A93 I;  3GTM I;  1VQN 1;  1K9M 1;  1YHQ 1;  1W2B Y;  1X3W A;  2VPY A;  4NBF A;  1YIJ 1;  3GTM S;  1RO0 A;  5FLM I;  1QVF Y;  3CC2 Z;  3CCJ Z;  1VLA A;  1TWA I;  4RV9 A;  4A3B I;  3D6W A;  3PO3 S;  1VQN Z;  1YHQ Z;  1S7M A;  1YIJ Z;  2R7Z I;  1Q81 2;  4A3J I;  3IX0 A;  2JIO A;  3MON A;  5LL6 f;  2Q4Z A;  4E2W A;  5CM2 M;  2JMO A;  3D9X A;  2H85 A;  2PM9 A;  3H0G I;  2HF1 A;  4RVF A;  1ZH1 A;  2F4O A;  2I3C A;  1USP A;  4NB9 A;  3J7A 4;  5IP9 I;  3VMG A;  4E32 A;  2JA8 I;  2JIQ A;  1K9M 2;  4MD8 A;  2OZK A;  2QEX 1;  3LUS A;  1ML8 A;  1VQ4 1;  2NVT I;  1N2F A;  1Q82 2;  2GU2 A;  1JWH C;  3S1M I;  1WCM I;  1TWF I;  2OTL 1;  1P9N A;  2QEX Z;  3G71 1;  1YJN 1;  2RBL A;  1VQ8 1;  1VQ4 Z;  1WZN A;  4BY1 I;  3S1Q I;  4NBC A;  1DL6 A;  3CPW Y;  3MZK B;  3IFU A;  5T67 A;  1RO4 A;  3U50 C;  2OTL Z;  2E2I I;  2NVY I;  1I6H I;  3D2L A;  3G71 Z;  1VQ8 Z;  1YJN Z;  3J81 b;  1K83 I;  1QXF A;  1Y8C A;  3M4O I;  1S72 1;  4RVD A;  3HOX I;  3OW2 Y;  2E7Z A;  4NBH A;  1VQ6 1;  1YI2 1;  3VTN A;  5FLX f;  4A3L I;  3IF8 A;  2JIP A;  2LIY A;  4E30 A;  4NH1 C;  1S72 Z;  5T64 A;  3QWU A;  3Q87 A;  3GCF A;  2W04 A;  1VQ6 Z;  1R9T I;  4E33 A;  1YI2 Z;  2O53 A;  4A3K I;  2E9H A;  3CQZ I;  2RPR A;  2OTJ 1;  3HOV I;  2VUG A;  4BBS I;  5C44 I;  3F3F C;  1TWG I;  2V8I A;  5D1P A;  2OTJ Z;  4HGZ A;  3KIH A;  2BJO A;  3GTP I;  4NBE A;  3CME 1;  3VB9 A;  3EER A;  1N8R 1;  5D1O A;  1USP B;  4A3F I;  3NFZ A;  3NDI A;  4A3M I;  1KQS Z;  3PO3 I;  2KPI A;  2NAP A;  3I4M I;  1TFI A;  1YJ9 1;  3FKI I;  2JUB A;  1Q82 1;  3CME Z;  2E2J I;  3CC4 1;  3CCS 1;  3HOY I;  2Q51 A;  2IZ4 A;  3NH8 A;  2F4M A;  4BY7 I;  3OW2 Z;  2GTH A;  2JNY A;  1YUK A;  1YJ9 Z;  4NFR A;  2YU9 I;  4CL1 A;  4E2X A;  3CC4 Z;  1FDI A;  3CCS Z;  2QKD A;  1JJ2 Y;  3I07 A;  1Q7Y 1;  4EWC A;  3G6E 1;  2V8K A;  1FDO A;  3J80 f;  3CCU 1;  3JAM b;  1QYP A;  3EED A;  1RLY A;  3S15 I;  5FLX b;  2NVQ I;  1N8R 2;  2RIQ A;  3G6E Z;  3CCQ 1;  4MD9 A;  5C3E I;  3CCU Z;  4XX2 A;  2LEX A;  2JA5 I;  4MON A;  3CMA 1;  1YJW 1;  3HOZ I;  5T6B A;  3BG0 B;  3TE5 B;  5IT9 b;  2J6A A;  3CCQ Z;  2QR1 B;  2V45 A;  2AYD A;  1VQL 1;  3S16 I;  1KC8 1;  1KD1 1;  3CMA Z;  1W2B Z;  1YJW Z;  1RO2 A;  4HGY A;  5A2Q b;  3CD6 1;  5IP7 I;  1QVF Z;  2JS4 A;  5AN9 F;  1AA6 A;  1Q7Y 2;  3NH5 A;  3HOW I;  2P28 A;  3FQM A;  1VQL Z;  3CCV 1;  3CD6 Z;  3RZD I;  4A3D I;  3K7A I;  3NH4 A;  4A3E I;  3F3P C;  2IZ3 A;  1K73 1;  4BBR I;  1SFO I;  2PMZ A;  1VQ9 1;  3CCV Z;  2P3Y A;  4A3I I;  3CCM 1;  5D1O B;  2VPW A;  3CC7 1; 
#chains in the Genus database with same CATH homology
 1VQ9 Z;  2W03 A;  2R92 I;  2QRD B;  3GTO I;  1KC8 2;  1KD1 2;  3CCM Z;  1ZB8 A;  3CC7 Z;  1VQ5 1;  1WII A;  1K8A 1;  3TDH B;  3ESW A;  2Y0S A;  1X0T A;  2V8J A;  1M90 1;  3CCL 1;  4QTU A;  2OOY B;  3M3Y I;  2B63 I;  1VQ7 1;  2YAD A;  1VQ5 Z;  1K73 2;  1L1O C;  3CPW Z;  1Z02 A;  3FQQ A;  2EGT A;  4MRI A;  4TNU A;  3CCL Z;  3HKZ A;  2AKL A;  1M1K 1;  1VQ7 Z;  4A3G I;  4NBA A;  1QVG Y;  2RT9 A;  4X6A I;  1Y1W I;  3BG1 B;  3J81 f;  4DGL A;  2DE6 A;  2DE7 A;  2JA7 I;  1RQF A;  3H3V J;  2K3R A;  1K8A 2;  3I4N I;  3VMH A;  1VQM 1;  1M90 2;  1TWH I;  3GTG I;  2VF1 A;  1VQO 1;  2R6M A;  1RNI A;  3HOU I;  1TWC I;  3S1R I;  2HU9 A;  3I56 1;  3CXC Y;  4E2Z A;  2M48 A;  2PK7 A;  1VQM Z;  4Y52 I;  3G4S 1;  1VQO Z;  1Z03 A;  3GTK I;  4E2Y A;  2WAQ A;  1M1K 2;  3GTL I;  3I55 1;  4NB8 A;  2RHB A;  1YUA A;  3I56 Z;  2DE5 A;  3G4S Z;  4RS4 A;  5C4J I;  1X3Z A;  1VQK 1;  1WW9 A;  1Z01 A;  2K5R A;  3GTJ I;  1NJI 1;  3I55 Z;  4RVG A;  2KI7 B;  4NBD A;  2JA6 I;  1KRL A;  2M6N A;  1VQP 1;  3CCR 1;  1QVG Z;  1VQK Z;  3CCE 1;  2ZAE B;  2JR6 A;  4NBB A;  2O4H A;  3T4N B;  1I3Q I;  4QTT A;  1VQP Z;  1KQS Y;  1NP6 A;  3CCR Z;  1JJ2 Z;  3KIF A;  3S17 I;  3CCE Z;  4MH4 A;  2R93 I;  1ZB9 A;  4DQY B;  1PFT A;  1Q86 1;  3S2D I;  4Y7N I;  1I50 I;  2VUM I;  2QA4 1;  3GKQ A;  1YIT 1;  2LFU A;  2QLV B;  3JAM f;  3CXC Z;  4RVH A;  3S1N I;  1NJI 2;  4S1T A;  2NVX I;  4NOZ A;  2G2K A;  4A3C I;  4MXU A;  3J80 b;  2QA4 Z;  3P5J B;  4E31 A;  1YIT Z;  3RZO I;  5C4X I;  2QRC B;  2QRE B;  3PO2 I;  1NUI A;  4BXX I;  1Q81 1;  4HH4 A;  5IT9 f;  4AYB A;  2E2H I;  1LQL A;  3GTQ I;  3S2H I;  4DK1 A;  2OOX B;  5A2Q f;  1Y1V I;  1QF8 A;  3NDJ A;  3CC2 1;  4NBG A;  3VMI A;  3CCJ 1;  1Q86 2;  1Y1V S;  3S14 I;  2WB1 A;  3MZL B;  4MD7 A;  2GTI A;  4A93 I;  3GTM I;  1VQN 1;  1K9M 1;  1YHQ 1;  1W2B Y;  1X3W A;  4NBF A;  1YIJ 1;  3GTM S;  1RO0 A;  5FLM I;  1QVF Y;  3CC2 Z;  3CCJ Z;  1VLA A;  1TWA I;  4RV9 A;  4A3B I;  3D6W A;  3PO3 S;  1VQN Z;  1YHQ Z;  1S7M A;  1YIJ Z;  2R7Z I;  1Q81 2;  4A3J I;  3IX0 A;  3MON A;  5LL6 f;  2Q4Z A;  4E2W A;  5CM2 M;  2JMO A;  3D9X A;  2H85 A;  2PM9 A;  3H0G I;  2HF1 A;  4RVF A;  1ZH1 A;  2F4O A;  2I3C A;  1USP A;  4NB9 A;  3J7A 4;  5IP9 I;  3VMG A;  4E32 A;  2JA8 I;  1K9M 2;  4MD8 A;  2OZK A;  2QEX 1;  3LUS A;  1ML8 A;  1VQ4 1;  2NVT I;  1N2F A;  1Q82 2;  2GU2 A;  1JWH C;  3S1M I;  1WCM I;  1TWF I;  2OTL 1;  1P9N A;  2QEX Z;  3G71 1;  1YJN 1;  2RBL A;  1VQ8 1;  1VQ4 Z;  4BY1 I;  3S1Q I;  4NBC A;  1DL6 A;  3CPW Y;  3MZK B;  3IFU A;  5T67 A;  1RO4 A;  3U50 C;  2OTL Z;  2E2I I;  2NVY I;  1I6H I;  3G71 Z;  1VQ8 Z;  1YJN Z;  3J81 b;  1K83 I;  3M4O I;  1S72 1;  4RVD A;  3HOX I;  3OW2 Y;  4NBH A;  1VQ6 1;  1YI2 1;  3VTN A;  5FLX f;  4A3L I;  3IF8 A;  2LIY A;  4E30 A;  4NH1 C;  1S72 Z;  5T64 A;  3QWU A;  3Q87 A;  3GCF A;  2W04 A;  1VQ6 Z;  1R9T I;  4E33 A;  1YI2 Z;  2O53 A;  4A3K I;  2E9H A;  3CQZ I;  2RPR A;  2OTJ 1;  3HOV I;  2VUG A;  4BBS I;  5C44 I;  3F3F C;  1TWG I;  2V8I A;  5D1P A;  2OTJ Z;  4HGZ A;  3KIH A;  2BJO A;  3GTP I;  4NBE A;  3CME 1;  3VB9 A;  3EER A;  1N8R 1;  5D1O A;  1USP B;  4A3F I;  3NFZ A;  3NDI A;  4A3M I;  1KQS Z;  3PO3 I;  2KPI A;  3I4M I;  1TFI A;  1YJ9 1;  3FKI I;  2JUB A;  1Q82 1;  3CME Z;  2E2J I;  3CC4 1;  3CCS 1;  3HOY I;  2Q51 A;  2IZ4 A;  3NH8 A;  2F4M A;  4BY7 I;  3OW2 Z;  2GTH A;  2JNY A;  1YUK A;  1YJ9 Z;  4NFR A;  2YU9 I;  4CL1 A;  4E2X A;  3CC4 Z;  3CCS Z;  2QKD A;  1JJ2 Y;  3I07 A;  1Q7Y 1;  4EWC A;  3G6E 1;  2V8K A;  3J80 f;  3CCU 1;  3JAM b;  1QYP A;  3EED A;  1RLY A;  3S15 I;  5FLX b;  2NVQ I;  1N8R 2;  2RIQ A;  3G6E Z;  3CCQ 1;  4MD9 A;  5C3E I;  3CCU Z;  4XX2 A;  2JA5 I;  4MON A;  3CMA 1;  1YJW 1;  3HOZ I;  5T6B A;  3BG0 B;  3TE5 B;  5IT9 b;  2J6A A;  3CCQ Z;  2QR1 B;  1VQL 1;  3S16 I;  1KC8 1;  1KD1 1;  3CMA Z;  1W2B Z;  1YJW Z;  1RO2 A;  4HGY A;  5A2Q b;  3CD6 1;  5IP7 I;  1QVF Z;  2JS4 A;  5AN9 F;  1Q7Y 2;  3NH5 A;  3HOW I;  2P28 A;  3FQM A;  1VQL Z;  3CCV 1;  3CD6 Z;  3RZD I;  4A3D I;  3K7A I;  3NH4 A;  4A3E I;  3F3P C;  2IZ3 A;  1K73 1;  4BBR I;  1SFO I;  2PMZ A;  1VQ9 1;  3CCV Z;  2P3Y A;  4A3I I;  3CCM 1;  5D1O B;  3CC7 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...