4MD7A

Crystal structure of full-length symmetric ck2 holoenzyme
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
199
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 199
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md7A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md7A02
1RQFA 1QF8A 2M48A 2JMOA 4MD7A 2M6NA 4MD9A 4DGLA 4MD8A 3EEDA 4NH1C 2RT9A 1JWHC 2R6MA
chains in the Genus database with same CATH superfamily
4DQYB 4BBSI 1K8A2 3FQMA 3M3YI 1Z03A 3JAMf 1I50I 4E32A 2OOXB 3NFZA 3CCJZ 1RO2A 3P5JB 3H3VJ 2V8JA 2V8KA 3CCR1 1Y1VI 3CC71 3S1RI 3T4NB 3OW2Z 1NUIA 3CCUZ 1Z01A 2KI7B 4A3LI 3MONA 3PO3I 5LL6f 2JA6I 1NJI2 1TWAI 1TWGI 3U50C 1VQL1 2E9HA 4XX2A 1YJ9Z 3HOUI 1YUKA 3GTOI 2VPWA 3CC21 2QLVB 2OOYB 1FDOA 5CM2M 2F4OA 5C44I 1M902 2VPYA 4RVHA 1KQSZ 4NOZA 4A3EI 3HOWI 2P3YA 2IZ3A 5D1PA 1YJWZ 3PO2I 2KPIA 2YADA 1Q811 3S1MI 2RPRA 1TFIA 3CCS1 1VQ91 1Q861 1WCMI 1TWCI 1LQLA 1WJ2A 2K5RA 3LUSA 4S1TA 3CMA1 1QVGY 2QEX1 3G6EZ 3G711 1JJ2Y 2E2HI 3CCQZ 4A3KI 4HGZA 2R6MA 4NFRA 1RNIA 4MD8A 3I4NI 4A3FI 4E31A 2QKDA 2BJOA 3IFUA 2R7ZI 1QXFA 4Y52I 1VQM1 2B63I 4AYBA 3CXCZ 1NP6A 1ZH1A 3CCSZ 1VQ9Z 3IX0A 2PMZA 1TWFI 3CMAZ 1Y1VS 2VUMI 3J7A4 2VPZA 4A3MI 4E2WA 3G71Z 1X3ZA 3PO3S 2E2JI 1VQK1 1I3QI 4NH1C 2JNYA 2E2II 1K731 1VQ61 1Q16A 2JIOA 2GTIA 3HOVI 5T6BA 1VQ51 3NDIA 1YJNZ 1VQ8Z 2QR1B 2V8IA 5T67A 2LIYA 3FQQA 3G4SZ 3F3FC 1SFOI 1RO4A 5IP9I 4E2XA 3IR7A 1K9M2 2RBLA 2NVQI 1W2BZ 2OTLZ 4BY7I 2IV2X 1QYPA 3VB9A 2HF1A 3JAMb 3ESWA 2OTJ1 2G2KA 1QVFY 2R92I 5FLXf 4NBGA 2Y0SA 3S2DI 3TE5B 4A3CI 2J6AA 3GKQA 1RQFA 1ML8A 3I561 3CCM1 4RV9A 4A3GI 3CME1 2O53A 5C4XI 3D2LA 1KC81 5FLMI 3CQZI 4NBBA 3NDJA 2PK7A 3HOXI 1VQ41 1WZNA 2QA41 5C4JI 2GTHA 1VQN1 3CCE1 1Z02A 4A3JI 1N2FA 2V3VA 2RT9A 2YU9I 1VLAA 3S16I 2K3RA 1VQO1 2DE7A 5A2Qf 2F4MA 2JIPA 1DL6A 4X6AI 3CCRZ 3CC7Z 2OTJZ 4A3BI 1ZB8A 5AN9F 2WAQA 1P9NA 3M4OI 1TWHI 1QF8A 1KD11 4E33A 3CD61 4A3II 4E2YA 1YIT1 1VQLZ 3VTNA 3I56Z 1M1K1 3CCMZ 2I3CA 3CMEZ 3CC2Z 1I6HI 2Q51A 1VQ4Z 3K7AI 2QA4Z 1YI21 2JIMA 1KC82 3CCEZ 3GTKI 2EGTA 4MRIA 4Y7NI 3HOZI 3OW2Y 1X0TA 5IP7I 1VQP1 5C3EI 3D9XA 1Q812 4MD7A 1YIJ1 1Q862 1Y1WI 2E7ZA 4QTUA 4HGYA 5D1OB 2QEXZ 3CD6Z 1YITZ 2JA5I 4E30A 1KD12 5D1OA 3J80f 1KQSY 2JS4A 1YUAA 4MD9A 1M1K2 3S1NI 1S721 2AYDA 3RZOI 3J80b 3NH8A 3HOYI 2WB1A 3CC41 1K8A1 1YHQ1 3CPWZ 3CCV1 1VQMZ 2IZ4A 3KIHA 1VQPZ 1FDIA 2PM9A 3NH5A 3CCJ1 4NBDA 3S17I 2W04A 4A3DI 4DGLA 4HH4A 4EWCA 1NJI1 2RIQA 3CCU1 1WIIA 1VQKZ 3GTLI 2NVTI 3FKII 3D6WA 1VQ71 1YJ91 1VQ6Z 3QWUA 4NB9A 1QVGZ 3BG0B 3GTJI 1JJ2Z 3CXCY 1K732 4BY1I 3S15I 4MXUA 1RLYA 1VQ5Z 3GTMI 2R93I 2VUGA 5FLXb 3CCL1 2QRDB 1USPB 2M48A 1YJW1 1L1OC 2JIRA 3GCFA 1USPA 1Q7Y1 2QREB 1KRLA 4TNUA 3G6E1 2H85A 3CCQ1 2VPXA 1VQ7Z 3CPWY 4NBFA 3TDHB 4RVDA 5A2Qb 3RZDI 2NVXI 2RHBA 3VMHA 1ZB9A 1S7MA 4RVFA 2V45A 2HU9A 4BBRI 3CCLZ 2JIQA 1JWHC 3S14I 1W2BY 3HKZA 1R9TI 4RS4A 2NAPA 2W03A 1N8R1 3GTPI 2LEXA 4E2ZA 2JA7I 4A93I 1VQNZ 4DK1A 3GTGI 1VQOZ 1Q7Y2 4QTTA 2AKLA 2JA8I 3BG1B 4RVGA 3J81f 1Q821 1Y8CA 2ZAEB 3I551 3IF8A 5IT9f 3MZKB 2O4HA 1X3WA 3J81b 2VF1A 1SIWA 3Q87A 2GU2A 5IT9b 4BXXI 3GTMS 3EERA 1QVFZ 2JMOA 2M6NA 1YJN1 1VQ81 2JUBA 3GTQI 2Q4ZA 3F3PC 1RO0A 3VMGA 2OZKA 3KIFA 1YI2Z 2DE5A 3S2HI 1K9M1 4NB8A 3G4S1 2NVYI 4NBCA 1N8R2 1WW9A 1K83I 2DE6A 3VMIA 4MONA 2OTL1 3I07A 4NBEA 3I55Z 5T64A 4MH4A 1YIJZ 3MZLB 3I4MI 1Q822 1AA6A 3NH4A 3H0GI 4NBAA 2P28A 4NBHA 1S72Z 1PFTA 3EEDA 3S1QI 1M901 4CL1A 3CC4Z 1YHQZ 2LFUA 3CCVZ 2JR6A 2QRCB
chains in the Genus database with same CATH topology
4DQYB 4BBSI 1K8A2 3FQMA 3M3YI 1Z03A 3JAMf 1I50I 4E32A 2OOXB 3NFZA 3CCJZ 1RO2A 3P5JB 3H3VJ 2V8JA 2V8KA 3CCR1 1Y1VI 3CC71 3S1RI 3T4NB 3OW2Z 1NUIA 3CCUZ 1Z01A 2KI7B 4A3LI 3MONA 3PO3I 5LL6f 2JA6I 1NJI2 1TWAI 1TWGI 3U50C 1VQL1 2E9HA 4XX2A 1YJ9Z 3HOUI 1YUKA 3GTOI 3CC21 2QLVB 2OOYB 5CM2M 2F4OA 5C44I 1M902 1KQSZ 4RVHA 4NOZA 4A3EI 3HOWI 2P3YA 2IZ3A 5D1PA 1YJWZ 3PO2I 2KPIA 2YADA 1Q811 3S1MI 2RPRA 1TFIA 3CCS1 1VQ91 1Q861 1WCMI 1TWCI 1LQLA 2K5RA 3LUSA 4S1TA 3CMA1 1QVGY 2QEX1 3G6EZ 3G711 1JJ2Y 2E2HI 3CCQZ 4A3KI 4HGZA 2R6MA 4NFRA 1RNIA 4MD8A 3I4NI 4A3FI 4E31A 2QKDA 2BJOA 3IFUA 2R7ZI 4Y52I 1VQM1 2B63I 4AYBA 3CXCZ 1NP6A 1ZH1A 3CCSZ 1VQ9Z 3IX0A 2PMZA 1TWFI 3CMAZ 1Y1VS 2VUMI 3J7A4 4A3MI 4E2WA 3G71Z 1X3ZA 3PO3S 2E2JI 1VQK1 1I3QI 4NH1C 2JNYA 2E2II 1K731 1VQ61 2GTIA 3HOVI 5T6BA 1VQ51 3NDIA 1YJNZ 1VQ8Z 2QR1B 2V8IA 5T67A 2LIYA 3FQQA 3G4SZ 3F3FC 1SFOI 1RO4A 5IP9I 4E2XA 1K9M2 2RBLA 2NVQI 1W2BZ 2OTLZ 4BY7I 1QYPA 3VB9A 2HF1A 3JAMb 3ESWA 2OTJ1 2G2KA 1QVFY 2R92I 5FLXf 4NBGA 2Y0SA 3S2DI 3TE5B 4A3CI 2J6AA 3GKQA 1RQFA 1ML8A 3I561 3CCM1 4RV9A 4A3GI 3CME1 2O53A 5C4XI 1KC81 5FLMI 3CQZI 4NBBA 3NDJA 2PK7A 3HOXI 1VQ41 2QA41 5C4JI 2GTHA 1VQN1 3CCE1 1Z02A 4A3JI 1N2FA 2RT9A 2YU9I 1VLAA 3S16I 2K3RA 1VQO1 2DE7A 5A2Qf 2F4MA 1DL6A 4X6AI 3CCRZ 3CC7Z 2OTJZ 4A3BI 1ZB8A 5AN9F 2WAQA 1P9NA 3M4OI 1TWHI 1QF8A 1KD11 4E33A 3CD61 4A3II 4E2YA 1YIT1 1VQLZ 3VTNA 3I56Z 1M1K1 3CCMZ 2I3CA 3CMEZ 3CC2Z 1I6HI 2Q51A 1VQ4Z 3K7AI 2QA4Z 1YI21 1KC82 3CCEZ 3GTKI 2EGTA 4MRIA 4Y7NI 3HOZI 3OW2Y 1X0TA 5IP7I 1VQP1 5C3EI 3D9XA 1Q812 4MD7A 1YIJ1 1Q862 1Y1WI 4QTUA 4HGYA 5D1OB 2QEXZ 3CD6Z 1YITZ 2JA5I 4E30A 1KD12 5D1OA 3J80f 1KQSY 2JS4A 1YUAA 4MD9A 1M1K2 3S1NI 1S721 3RZOI 3J80b 3NH8A 3HOYI 2WB1A 3CC41 1K8A1 1YHQ1 3CPWZ 3CCV1 1VQMZ 2IZ4A 3KIHA 1VQPZ 2PM9A 3NH5A 3CCJ1 4NBDA 3S17I 2W04A 4A3DI 4DGLA 4HH4A 4EWCA 1NJI1 2RIQA 3CCU1 1WIIA 1VQKZ 3GTLI 2NVTI 3FKII 3D6WA 1VQ71 1YJ91 1VQ6Z 3QWUA 4NB9A 1QVGZ 3BG0B 3GTJI 1JJ2Z 3CXCY 1K732 4BY1I 3S15I 4MXUA 1RLYA 1VQ5Z 3GTMI 2R93I 2VUGA 5FLXb 3CCL1 2QRDB 1USPB 2M48A 1YJW1 1L1OC 3GCFA 1USPA 1Q7Y1 2QREB 1KRLA 4TNUA 3G6E1 2H85A 3CCQ1 1VQ7Z 3CPWY 4NBFA 3TDHB 4RVDA 5A2Qb 3RZDI 2NVXI 2RHBA 3VMHA 1ZB9A 1S7MA 4RVFA 2HU9A 4BBRI 3CCLZ 1JWHC 3S14I 1W2BY 3HKZA 1R9TI 4RS4A 2W03A 1N8R1 3GTPI 4E2ZA 2JA7I 4A93I 1VQNZ 4DK1A 3GTGI 1VQOZ 1Q7Y2 4QTTA 2AKLA 2JA8I 3BG1B 4RVGA 3J81f 1Q821 2ZAEB 3I551 3IF8A 5IT9f 3MZKB 2O4HA 1X3WA 3J81b 2VF1A 3Q87A 2GU2A 5IT9b 4BXXI 3GTMS 3EERA 1QVFZ 2JMOA 2M6NA 1YJN1 1VQ81 2JUBA 3GTQI 2Q4ZA 3F3PC 1RO0A 3VMGA 2OZKA 3KIFA 1YI2Z 2DE5A 3S2HI 1K9M1 4NB8A 3G4S1 2NVYI 4NBCA 1N8R2 1WW9A 1K83I 2DE6A 3VMIA 4MONA 2OTL1 3I07A 4NBEA 3I55Z 5T64A 4MH4A 1YIJZ 3MZLB 3I4MI 1Q822 3NH4A 3H0GI 4NBAA 2P28A 4NBHA 1S72Z 1PFTA 3EEDA 3S1QI 1M901 4CL1A 3CC4Z 1YHQZ 2LFUA 3CCVZ 2JR6A 2QRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQF A;  1QF8 A;  2M48 A;  2JMO A;  4MD7 A;  2M6N A;  4MD9 A;  4DGL A;  4MD8 A;  3EED A;  4NH1 C;  2RT9 A;  1JWH C;  2R6M A; 
#chains in the Genus database with same CATH topology
 4DQY B;  4BBS I;  1K8A 2;  3FQM A;  3M3Y I;  1Z03 A;  3JAM f;  1I50 I;  4E32 A;  2OOX B;  3NFZ A;  3CCJ Z;  1RO2 A;  3P5J B;  3H3V J;  2V8J A;  2V8K A;  3CCR 1;  1Y1V I;  3CC7 1;  3S1R I;  3T4N B;  3OW2 Z;  1NUI A;  3CCU Z;  1Z01 A;  2KI7 B;  4A3L I;  3MON A;  3PO3 I;  5LL6 f;  2JA6 I;  1NJI 2;  1TWA I;  1TWG I;  3U50 C;  1VQL 1;  2E9H A;  4XX2 A;  1YJ9 Z;  3HOU I;  1YUK A;  3GTO I;  2VPW A;  3CC2 1;  2QLV B;  2OOY B;  1FDO A;  5CM2 M;  2F4O A;  5C44 I;  1M90 2;  2VPY A;  4RVH A;  1KQS Z;  4NOZ A;  4A3E I;  3HOW I;  2P3Y A;  2IZ3 A;  5D1P A;  1YJW Z;  3PO2 I;  2KPI A;  2YAD A;  1Q81 1;  3S1M I;  2RPR A;  1TFI A;  3CCS 1;  1VQ9 1;  1Q86 1;  1WCM I;  1TWC I;  1LQL A;  1WJ2 A;  2K5R A;  3LUS A;  4S1T A;  3CMA 1;  1QVG Y;  2QEX 1;  3G6E Z;  3G71 1;  1JJ2 Y;  2E2H I;  3CCQ Z;  4A3K I;  4HGZ A;  2R6M A;  4NFR A;  1RNI A;  4MD8 A;  3I4N I;  4A3F I;  4E31 A;  2QKD A;  2BJO A;  3IFU A;  2R7Z I;  1QXF A;  4Y52 I;  1VQM 1;  2B63 I;  4AYB A;  3CXC Z;  1NP6 A;  1ZH1 A;  3CCS Z;  1VQ9 Z;  3IX0 A;  2PMZ A;  1TWF I;  3CMA Z;  1Y1V S;  2VUM I;  3J7A 4;  2VPZ A;  4A3M I;  4E2W A;  3G71 Z;  1X3Z A;  3PO3 S;  2E2J I;  1VQK 1;  1I3Q I;  4NH1 C;  2JNY A;  2E2I I;  1K73 1;  1VQ6 1;  1Q16 A;  2JIO A;  2GTI A;  3HOV I;  5T6B A;  1VQ5 1;  3NDI A;  1YJN Z;  1VQ8 Z;  2QR1 B;  2V8I A;  5T67 A;  2LIY A;  3FQQ A;  3G4S Z;  3F3F C;  1SFO I;  1RO4 A;  5IP9 I;  4E2X A;  3IR7 A;  1K9M 2;  2RBL A;  2NVQ I;  1W2B Z;  2OTL Z;  4BY7 I;  2IV2 X;  1QYP A;  3VB9 A;  2HF1 A;  3JAM b;  3ESW A;  2OTJ 1;  2G2K A;  1QVF Y;  2R92 I;  5FLX f;  4NBG A;  2Y0S A;  3S2D I;  3TE5 B;  4A3C I;  2J6A A;  3GKQ A;  1RQF A;  1ML8 A;  3I56 1;  3CCM 1;  4RV9 A;  4A3G I;  3CME 1;  2O53 A;  5C4X I;  3D2L A;  1KC8 1;  5FLM I;  3CQZ I;  4NBB A;  3NDJ A;  2PK7 A;  3HOX I;  1VQ4 1;  1WZN A;  2QA4 1;  5C4J I;  2GTH A;  1VQN 1;  3CCE 1;  1Z02 A;  4A3J I;  1N2F A;  2V3V A;  2RT9 A;  2YU9 I;  1VLA A;  3S16 I;  2K3R A;  1VQO 1;  2DE7 A;  5A2Q f;  2F4M A;  2JIP A;  1DL6 A;  4X6A I;  3CCR Z;  3CC7 Z;  2OTJ Z;  4A3B I;  1ZB8 A;  5AN9 F;  2WAQ A;  1P9N A;  3M4O I;  1TWH I;  1QF8 A;  1KD1 1;  4E33 A;  3CD6 1;  4A3I I;  4E2Y A;  1YIT 1;  1VQL Z;  3VTN A;  3I56 Z;  1M1K 1;  3CCM Z;  2I3C A;  3CME Z;  3CC2 Z;  1I6H I;  2Q51 A;  1VQ4 Z;  3K7A I;  2QA4 Z;  1YI2 1;  2JIM A;  1KC8 2;  3CCE Z;  3GTK I;  2EGT A;  4MRI A;  4Y7N I;  3HOZ I;  3OW2 Y;  1X0T A;  5IP7 I;  1VQP 1;  5C3E I;  3D9X A;  1Q81 2;  4MD7 A;  1YIJ 1;  1Q86 2;  1Y1W I;  2E7Z A;  4QTU A;  4HGY A;  5D1O B;  2QEX Z;  3CD6 Z;  1YIT Z;  2JA5 I;  4E30 A;  1KD1 2;  5D1O A;  3J80 f;  1KQS Y;  2JS4 A;  1YUA A;  4MD9 A;  1M1K 2;  3S1N I;  1S72 1;  2AYD A;  3RZO I;  3J80 b;  3NH8 A;  3HOY I;  2WB1 A;  3CC4 1;  1K8A 1;  1YHQ 1;  3CPW Z;  3CCV 1;  1VQM Z;  2IZ4 A;  3KIH A;  1VQP Z;  1FDI A;  2PM9 A;  3NH5 A;  3CCJ 1;  4NBD A;  3S17 I;  2W04 A;  4A3D I;  4DGL A;  4HH4 A;  4EWC A;  1NJI 1;  2RIQ A;  3CCU 1;  1WII A;  1VQK Z;  3GTL I;  2NVT I;  3FKI I;  3D6W A;  1VQ7 1;  1YJ9 1;  1VQ6 Z;  3QWU A;  4NB9 A;  1QVG Z;  3BG0 B;  3GTJ I;  1JJ2 Z;  3CXC Y;  1K73 2;  4BY1 I;  3S15 I;  4MXU A;  1RLY A;  1VQ5 Z;  3GTM I;  2R93 I;  2VUG A;  5FLX b;  3CCL 1;  2QRD B;  1USP B;  2M48 A;  1YJW 1;  1L1O C;  2JIR A;  3GCF A;  1USP A;  1Q7Y 1;  2QRE B;  1KRL A;  4TNU A;  3G6E 1;  2H85 A;  3CCQ 1;  2VPX A;  1VQ7 Z;  3CPW Y;  4NBF A;  3TDH B;  4RVD A;  5A2Q b;  3RZD I;  2NVX I;  2RHB A;  3VMH A;  1ZB9 A;  1S7M A;  4RVF A;  2V45 A;  2HU9 A;  4BBR I;  3CCL Z;  2JIQ A;  1JWH C;  3S14 I;  1W2B Y;  3HKZ A;  1R9T I;  4RS4 A;  2NAP A;  2W03 A;  1N8R 1;  3GTP I;  2LEX A;  4E2Z A;  2JA7 I;  4A93 I;  1VQN Z;  4DK1 A;  3GTG I;  1VQO Z;  1Q7Y 2;  4QTT A;  2AKL A;  2JA8 I;  3BG1 B;  4RVG A;  3J81 f;  1Q82 1;  1Y8C A;  2ZAE B;  3I55 1;  3IF8 A;  5IT9 f;  3MZK B;  2O4H A;  1X3W A;  3J81 b;  2VF1 A;  1SIW A;  3Q87 A;  2GU2 A;  5IT9 b;  4BXX I;  3GTM S;  3EER A;  1QVF Z;  2JMO A;  2M6N A;  1YJN 1;  1VQ8 1;  2JUB A;  3GTQ I;  2Q4Z A;  3F3P C;  1RO0 A;  3VMG A;  2OZK A;  3KIF A;  1YI2 Z;  2DE5 A;  3S2H I;  1K9M 1;  4NB8 A;  3G4S 1;  2NVY I;  4NBC A;  1N8R 2;  1WW9 A;  1K83 I;  2DE6 A;  3VMI A;  4MON A;  2OTL 1;  3I07 A;  4NBE A;  3I55 Z;  5T64 A;  4MH4 A;  1YIJ Z;  3MZL B;  3I4M I;  1Q82 2;  1AA6 A;  3NH4 A;  3H0G I;  4NBA A;  2P28 A;  4NBH A;  1S72 Z;  1PFT A;  3EED A;  3S1Q I;  1M90 1;  4CL1 A;  3CC4 Z;  1YHQ Z;  2LFU A;  3CCV Z;  2JR6 A;  2QRC B; 
#chains in the Genus database with same CATH homology
 4DQY B;  4BBS I;  1K8A 2;  3FQM A;  3M3Y I;  1Z03 A;  3JAM f;  1I50 I;  4E32 A;  2OOX B;  3NFZ A;  3CCJ Z;  1RO2 A;  3P5J B;  3H3V J;  2V8J A;  2V8K A;  3CCR 1;  1Y1V I;  3CC7 1;  3S1R I;  3T4N B;  3OW2 Z;  1NUI A;  3CCU Z;  1Z01 A;  2KI7 B;  4A3L I;  3MON A;  3PO3 I;  5LL6 f;  2JA6 I;  1NJI 2;  1TWA I;  1TWG I;  3U50 C;  1VQL 1;  2E9H A;  4XX2 A;  1YJ9 Z;  3HOU I;  1YUK A;  3GTO I;  3CC2 1;  2QLV B;  2OOY B;  5CM2 M;  2F4O A;  5C44 I;  1M90 2;  1KQS Z;  4RVH A;  4NOZ A;  4A3E I;  3HOW I;  2P3Y A;  2IZ3 A;  5D1P A;  1YJW Z;  3PO2 I;  2KPI A;  2YAD A;  1Q81 1;  3S1M I;  2RPR A;  1TFI A;  3CCS 1;  1VQ9 1;  1Q86 1;  1WCM I;  1TWC I;  1LQL A;  2K5R A;  3LUS A;  4S1T A;  3CMA 1;  1QVG Y;  2QEX 1;  3G6E Z;  3G71 1;  1JJ2 Y;  2E2H I;  3CCQ Z;  4A3K I;  4HGZ A;  2R6M A;  4NFR A;  1RNI A;  4MD8 A;  3I4N I;  4A3F I;  4E31 A;  2QKD A;  2BJO A;  3IFU A;  2R7Z I;  4Y52 I;  1VQM 1;  2B63 I;  4AYB A;  3CXC Z;  1NP6 A;  1ZH1 A;  3CCS Z;  1VQ9 Z;  3IX0 A;  2PMZ A;  1TWF I;  3CMA Z;  1Y1V S;  2VUM I;  3J7A 4;  4A3M I;  4E2W A;  3G71 Z;  1X3Z A;  3PO3 S;  2E2J I;  1VQK 1;  1I3Q I;  4NH1 C;  2JNY A;  2E2I I;  1K73 1;  1VQ6 1;  2GTI A;  3HOV I;  5T6B A;  1VQ5 1;  3NDI A;  1YJN Z;  1VQ8 Z;  2QR1 B;  2V8I A;  5T67 A;  2LIY A;  3FQQ A;  3G4S Z;  3F3F C;  1SFO I;  1RO4 A;  5IP9 I;  4E2X A;  1K9M 2;  2RBL A;  2NVQ I;  1W2B Z;  2OTL Z;  4BY7 I;  1QYP A;  3VB9 A;  2HF1 A;  3JAM b;  3ESW A;  2OTJ 1;  2G2K A;  1QVF Y;  2R92 I;  5FLX f;  4NBG A;  2Y0S A;  3S2D I;  3TE5 B;  4A3C I;  2J6A A;  3GKQ A;  1RQF A;  1ML8 A;  3I56 1;  3CCM 1;  4RV9 A;  4A3G I;  3CME 1;  2O53 A;  5C4X I;  1KC8 1;  5FLM I;  3CQZ I;  4NBB A;  3NDJ A;  2PK7 A;  3HOX I;  1VQ4 1;  2QA4 1;  5C4J I;  2GTH A;  1VQN 1;  3CCE 1;  1Z02 A;  4A3J I;  1N2F A;  2RT9 A;  2YU9 I;  1VLA A;  3S16 I;  2K3R A;  1VQO 1;  2DE7 A;  5A2Q f;  2F4M A;  1DL6 A;  4X6A I;  3CCR Z;  3CC7 Z;  2OTJ Z;  4A3B I;  1ZB8 A;  5AN9 F;  2WAQ A;  1P9N A;  3M4O I;  1TWH I;  1QF8 A;  1KD1 1;  4E33 A;  3CD6 1;  4A3I I;  4E2Y A;  1YIT 1;  1VQL Z;  3VTN A;  3I56 Z;  1M1K 1;  3CCM Z;  2I3C A;  3CME Z;  3CC2 Z;  1I6H I;  2Q51 A;  1VQ4 Z;  3K7A I;  2QA4 Z;  1YI2 1;  1KC8 2;  3CCE Z;  3GTK I;  2EGT A;  4MRI A;  4Y7N I;  3HOZ I;  3OW2 Y;  1X0T A;  5IP7 I;  1VQP 1;  5C3E I;  3D9X A;  1Q81 2;  4MD7 A;  1YIJ 1;  1Q86 2;  1Y1W I;  4QTU A;  4HGY A;  5D1O B;  2QEX Z;  3CD6 Z;  1YIT Z;  2JA5 I;  4E30 A;  1KD1 2;  5D1O A;  3J80 f;  1KQS Y;  2JS4 A;  1YUA A;  4MD9 A;  1M1K 2;  3S1N I;  1S72 1;  3RZO I;  3J80 b;  3NH8 A;  3HOY I;  2WB1 A;  3CC4 1;  1K8A 1;  1YHQ 1;  3CPW Z;  3CCV 1;  1VQM Z;  2IZ4 A;  3KIH A;  1VQP Z;  2PM9 A;  3NH5 A;  3CCJ 1;  4NBD A;  3S17 I;  2W04 A;  4A3D I;  4DGL A;  4HH4 A;  4EWC A;  1NJI 1;  2RIQ A;  3CCU 1;  1WII A;  1VQK Z;  3GTL I;  2NVT I;  3FKI I;  3D6W A;  1VQ7 1;  1YJ9 1;  1VQ6 Z;  3QWU A;  4NB9 A;  1QVG Z;  3BG0 B;  3GTJ I;  1JJ2 Z;  3CXC Y;  1K73 2;  4BY1 I;  3S15 I;  4MXU A;  1RLY A;  1VQ5 Z;  3GTM I;  2R93 I;  2VUG A;  5FLX b;  3CCL 1;  2QRD B;  1USP B;  2M48 A;  1YJW 1;  1L1O C;  3GCF A;  1USP A;  1Q7Y 1;  2QRE B;  1KRL A;  4TNU A;  3G6E 1;  2H85 A;  3CCQ 1;  1VQ7 Z;  3CPW Y;  4NBF A;  3TDH B;  4RVD A;  5A2Q b;  3RZD I;  2NVX I;  2RHB A;  3VMH A;  1ZB9 A;  1S7M A;  4RVF A;  2HU9 A;  4BBR I;  3CCL Z;  1JWH C;  3S14 I;  1W2B Y;  3HKZ A;  1R9T I;  4RS4 A;  2W03 A;  1N8R 1;  3GTP I;  4E2Z A;  2JA7 I;  4A93 I;  1VQN Z;  4DK1 A;  3GTG I;  1VQO Z;  1Q7Y 2;  4QTT A;  2AKL A;  2JA8 I;  3BG1 B;  4RVG A;  3J81 f;  1Q82 1;  2ZAE B;  3I55 1;  3IF8 A;  5IT9 f;  3MZK B;  2O4H A;  1X3W A;  3J81 b;  2VF1 A;  3Q87 A;  2GU2 A;  5IT9 b;  4BXX I;  3GTM S;  3EER A;  1QVF Z;  2JMO A;  2M6N A;  1YJN 1;  1VQ8 1;  2JUB A;  3GTQ I;  2Q4Z A;  3F3P C;  1RO0 A;  3VMG A;  2OZK A;  3KIF A;  1YI2 Z;  2DE5 A;  3S2H I;  1K9M 1;  4NB8 A;  3G4S 1;  2NVY I;  4NBC A;  1N8R 2;  1WW9 A;  1K83 I;  2DE6 A;  3VMI A;  4MON A;  2OTL 1;  3I07 A;  4NBE A;  3I55 Z;  5T64 A;  4MH4 A;  1YIJ Z;  3MZL B;  3I4M I;  1Q82 2;  3NH4 A;  3H0G I;  4NBA A;  2P28 A;  4NBH A;  1S72 Z;  1PFT A;  3EED A;  3S1Q I;  1M90 1;  4CL1 A;  3CC4 Z;  1YHQ Z;  2LFU A;  3CCV Z;  2JR6 A;  2QRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...