4MD7A

Crystal structure of full-length symmetric ck2 holoenzyme
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
199
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 199
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md7A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md7A02
2M6NA 2RT9A 1QF8A 1JWHC 2R6MA 4DGLA 4NH1C 2JMOA 4MD9A 4MD8A 1RQFA 4MD7A 2M48A 3EEDA
chains in the Genus database with same CATH superfamily
2P28A 1LQLA 2R7ZI 3S1NI 3F3PC 2QLVB 5C4JI 4NBCA 2R6MA 2JIRA 1VQ8Z 3U50C 1K8A1 2O4HA 3HOXI 1TWHI 2JA5I 2YADA 3CME1 1WJ2A 2DE6A 3HOWI 4E2ZA 2R93I 3S17I 4S1TA 4A3JI 2BJOA 3KIFA 1YJ9Z 2B63I 4A3II 3OW2Z 3GTMS 1VQPZ 4NB8A 2V3VA 3NFZA 4NOZA 3ESWA 1RQFA 2QEXZ 2QREB 1Z03A 3CC71 4A93I 2KI7B 3D6WA 3KIHA 5FLMI 4AYBA 2F4MA 5IT9b 2H85A 1VQOZ 2JA6I 2OZKA 1NJI2 4A3CI 3GCFA 2I3CA 1FDIA 3GTPI 4BY7I 2LEXA 4Y52I 1KC81 3CC41 1TWFI 3CMA1 3IR7A 1Y8CA 1NUIA 3IX0A 2IZ3A 3QWUA 1N8R2 3J81b 3CCSZ 2K3RA 1YIJZ 4MRIA 1VLAA 3JAMb 1N2FA 1K732 1Q812 1S72Z 3HOUI 1KQSY 3IFUA 2JNYA 2WAQA 4QTUA 1VQ7Z 3Q87A 1K9M1 3FKII 3NH8A 4HGYA 3G6E1 1VQMZ 3GKQA 3TDHB 2J6AA 3MONA 3VB9A 2R92I 3S1MI 4NBAA 4CL1A 2HF1A 3GTKI 2G2KA 2OTLZ 1YUAA 1QYPA 3CCMZ 3CCVZ 5A2Qf 2V8IA 2JS4A 3CD6Z 3PO2I 3S15I 2QRDB 1X3WA 1Y1VS 1RLYA 4HGZA 3HOYI 1ML8A 2WB1A 2VUMI 2QEX1 4A3MI 2QR1B 3I55Z 5LL6f 4BXXI 1W2BZ 2OTJZ 4TNUA 1QXFA 2PMZA 4E31A 1W2BY 5IP7I 1KD12 1I3QI 1M902 3CPWY 3VMHA 2F4OA 1VQO1 4RVGA 1VQ4Z 2P3YA 4RVHA 5CM2M 1WW9A 1Q821 1M1K2 2PK7A 3T4NB 3GTOI 5T64A 3HKZA 1VQK1 3GTJI 2JMOA 3CCS1 3IF8A 1YIJ1 3CCLZ 1Q7Y1 1WZNA 3CCQZ 2Q51A 4XX2A 1I6HI 4MD9A 1KD11 1VQ5Z 1S721 3S16I 3OW2Y 4RS4A 3CC2Z 2JIMA 3BG0B 1VQ6Z 2V8JA 3BG1B 3PO3I 3G4SZ 4NBEA 4MD8A 3I4MI 5FLXf 1JWHC 3CCUZ 3JAMf 1Q862 1USPA 2EGTA 1YJN1 1YJWZ 3EEDA 3EERA 2V8KA 4A3BI 3H0GI 4DQYB 3CD61 3J80b 2LIYA 3I561 2E2II 3TE5B 3S1RI 5T6BA 4BBSI 3K7AI 2AYDA 2YU9I 3RZDI 4NBBA 3I551 4E30A 2OOYB 3NH5A 1NJI1 2RHBA 1Y1VI 1YITZ 3S2DI 2Y0SA 3CMEZ 1VQ41 5IP9I 2JUBA 3D9XA 5C4XI 4NFRA 1N8R1 1QVFZ 1VQ81 2VF1A 3NH4A 4A3FI 2M48A 4MXUA 3CCJZ 2HU9A 4BY1I 1WCMI 3VMGA 4MD7A 1Q811 1K731 3CCQ1 3G71Z 1YJ91 3J7A4 1VQ51 2JIOA 1VQP1 2QA4Z 4MH4A 2QRCB 2JIQA 2AKLA 3I07A 2JA7I 2W04A 3LUSA 4E2WA 2JA8I 1USPB 1KRLA 1K83I 3GTMI 1TWCI 3FQMA 3CC4Z 4DK1A 2E9HA 1X3ZA 3S1QI 3HOZI 4A3GI 3G4S1 3CQZI 3CCRZ 1P9NA 3CCU1 5D1PA 1I50I 1JJ2Z 1YHQZ 1K8A2 2NVYI 1YJW1 1JJ2Y 2IV2X 3S2HI 1ZB8A 4NBFA 1L1OC 1WIIA 1PFTA 3CXCZ 4NBDA 2QKDA 5A2Qb 4E33A 3P5JB 4NBGA 3D2LA 1TFIA 4A3EI 5IT9f 2E7ZA 3G6EZ 1FDOA 2DE5A 4RV9A 1M901 1YI2Z 3CCEZ 4EWCA 3FQQA 1VQ71 2VPXA 4RVDA 3MZKB 1YIT1 5D1OA 3NDJA 2VPYA 3J81f 1M1K1 1ZH1A 2RT9A 3J80f 1VQM1 4E2YA 3VMIA 4E32A 1DL6A 4NH1C 2Q4ZA 4NBHA 2GU2A 1Z01A 2OOXB 1KC82 4RVFA 4QTTA 5C44I 1VQNZ 1RO0A 2NVQI 3I4NI 2PM9A 3CCJ1 1VQ9Z 2OTL1 3H3VJ 2NAPA 3NDIA 3CCM1 3CCV1 1RNIA 1VQLZ 4MONA 4Y7NI 1S7MA 3G711 4A3KI 2IZ4A 2M6NA 5C3EI 2NVXI 3VTNA 2QA41 3GTQI 1K9M2 2OTJ1 4BBRI 2JIPA 5AN9F 2GTHA 3M3YI 1Q861 1VQKZ 1NP6A 1TWGI 2ZAEB 1YUKA 2RIQA 3CCR1 3M4OI 4X6AI 2E2JI 1YHQ1 2GTIA 2NVTI 2VPZA 4HH4A 5T67A 1SIWA 5FLXb 1KQSZ 4E2XA 1QVFY 2E2HI 2VUGA 3PO3S 3CC7Z 4NB9A 3GTLI 3CCL1 2VPWA 2RBLA 1QVGZ 1Y1WI 2V45A 5D1OB 1QVGY 2LFUA 1YI21 1Q16A 2O53A 1RO2A 1X0TA 3CCE1 3GTGI 3HOVI 2DE7A 2RPRA 1YJNZ 3CC21 4A3LI 1VQ61 2KPIA 3MZLB 1AA6A 3CMAZ 1SFOI 1TWAI 1RO4A 1Q822 4DGLA 3RZOI 4A3DI 3I56Z 2W03A 3F3FC 1VQN1 1QF8A 1ZB9A 1VQ91 3S14I 1VQL1 1R9TI 1Q7Y2 1Z02A 2K5RA 2JR6A 3CPWZ 3CXCY
chains in the Genus database with same CATH topology
2P28A 1LQLA 2R7ZI 3S1NI 3F3PC 2QLVB 5C4JI 4NBCA 2R6MA 1VQ8Z 3U50C 1K8A1 2O4HA 3HOXI 1TWHI 2JA5I 2YADA 3CME1 2DE6A 3HOWI 4E2ZA 2R93I 3S17I 4S1TA 4A3JI 2BJOA 3KIFA 1YJ9Z 2B63I 4A3II 3OW2Z 3GTMS 1VQPZ 4NB8A 3NFZA 4NOZA 3ESWA 1RQFA 2QEXZ 2QREB 1Z03A 3CC71 4A93I 2KI7B 3D6WA 3KIHA 5FLMI 4AYBA 2F4MA 5IT9b 2H85A 1VQOZ 2JA6I 2OZKA 1NJI2 4A3CI 3GCFA 2I3CA 3GTPI 4BY7I 4Y52I 1KC81 3CC41 1TWFI 3CMA1 1NUIA 3IX0A 2IZ3A 3QWUA 1N8R2 3J81b 3CCSZ 2K3RA 1YIJZ 4MRIA 1VLAA 3JAMb 1N2FA 1K732 1Q812 1S72Z 3HOUI 1KQSY 3IFUA 2JNYA 2WAQA 4QTUA 1VQ7Z 3Q87A 1K9M1 3FKII 3NH8A 4HGYA 3G6E1 1VQMZ 3GKQA 3TDHB 2J6AA 3MONA 3VB9A 2R92I 3S1MI 4NBAA 4CL1A 2HF1A 3GTKI 2G2KA 2OTLZ 1YUAA 1QYPA 3CCMZ 3CCVZ 5A2Qf 2V8IA 2JS4A 3CD6Z 3PO2I 3S15I 2QRDB 1X3WA 1Y1VS 1RLYA 4HGZA 3HOYI 1ML8A 2WB1A 2VUMI 2QEX1 4A3MI 2QR1B 3I55Z 5LL6f 4BXXI 1W2BZ 2OTJZ 4TNUA 2PMZA 4E31A 1W2BY 5IP7I 1KD12 1I3QI 1M902 3CPWY 3VMHA 2F4OA 1VQO1 4RVGA 1VQ4Z 2P3YA 4RVHA 5CM2M 1WW9A 1Q821 1M1K2 2PK7A 3T4NB 3GTOI 5T64A 3HKZA 1VQK1 3GTJI 2JMOA 3CCS1 3IF8A 1YIJ1 3CCLZ 1Q7Y1 3CCQZ 2Q51A 4XX2A 1I6HI 4MD9A 1KD11 1VQ5Z 1S721 3S16I 3OW2Y 4RS4A 3CC2Z 3BG0B 1VQ6Z 2V8JA 3BG1B 3PO3I 3G4SZ 4NBEA 4MD8A 3I4MI 5FLXf 1JWHC 3CCUZ 3JAMf 1Q862 1USPA 2EGTA 1YJN1 1YJWZ 3EEDA 3EERA 2V8KA 4A3BI 3H0GI 4DQYB 3CD61 3J80b 2LIYA 3I561 2E2II 3TE5B 3S1RI 5T6BA 4BBSI 3K7AI 2YU9I 3RZDI 4NBBA 3I551 4E30A 2OOYB 3NH5A 1NJI1 2RHBA 1Y1VI 1YITZ 3S2DI 2Y0SA 3CMEZ 1VQ41 5IP9I 2JUBA 3D9XA 5C4XI 4NFRA 1N8R1 1QVFZ 1VQ81 2VF1A 3NH4A 4A3FI 2M48A 4MXUA 3CCJZ 2HU9A 4BY1I 1WCMI 3VMGA 4MD7A 1Q811 1K731 3CCQ1 3G71Z 1YJ91 3J7A4 1VQ51 1VQP1 2QA4Z 4MH4A 2QRCB 2AKLA 3I07A 2JA7I 2W04A 3LUSA 4E2WA 2JA8I 1USPB 1KRLA 1K83I 3GTMI 1TWCI 3FQMA 3CC4Z 4DK1A 2E9HA 1X3ZA 3S1QI 3HOZI 4A3GI 3G4S1 3CQZI 3CCRZ 1P9NA 3CCU1 5D1PA 1I50I 1JJ2Z 1YHQZ 1K8A2 2NVYI 1YJW1 1JJ2Y 3S2HI 1ZB8A 4NBFA 1L1OC 1WIIA 1PFTA 3CXCZ 4NBDA 2QKDA 5A2Qb 4E33A 3P5JB 4NBGA 1TFIA 4A3EI 5IT9f 3G6EZ 2DE5A 4RV9A 1M901 1YI2Z 3CCEZ 4EWCA 3FQQA 1VQ71 4RVDA 3MZKB 1YIT1 5D1OA 3NDJA 3J81f 1M1K1 1ZH1A 2RT9A 3J80f 1VQM1 4E2YA 3VMIA 4E32A 1DL6A 4NH1C 2Q4ZA 4NBHA 2GU2A 1Z01A 2OOXB 1KC82 4RVFA 4QTTA 5C44I 1VQNZ 1RO0A 2NVQI 3I4NI 2PM9A 3CCJ1 1VQ9Z 2OTL1 3H3VJ 3NDIA 3CCM1 3CCV1 1RNIA 1VQLZ 4MONA 4Y7NI 1S7MA 3G711 4A3KI 2IZ4A 2M6NA 5C3EI 2NVXI 3VTNA 2QA41 3GTQI 1K9M2 2OTJ1 4BBRI 5AN9F 2GTHA 3M3YI 1Q861 1VQKZ 1NP6A 1TWGI 2ZAEB 1YUKA 2RIQA 3CCR1 3M4OI 4X6AI 2E2JI 1YHQ1 2GTIA 2NVTI 4HH4A 5T67A 5FLXb 1KQSZ 4E2XA 1QVFY 2E2HI 2VUGA 3PO3S 3CC7Z 4NB9A 3GTLI 3CCL1 2RBLA 1QVGZ 1Y1WI 5D1OB 1QVGY 2LFUA 1YI21 2O53A 1RO2A 1X0TA 3CCE1 3GTGI 3HOVI 2DE7A 2RPRA 1YJNZ 3CC21 4A3LI 1VQ61 2KPIA 3MZLB 3CMAZ 1SFOI 1TWAI 1RO4A 1Q822 4DGLA 3RZOI 4A3DI 3I56Z 2W03A 3F3FC 1VQN1 1QF8A 1ZB9A 1VQ91 3S14I 1VQL1 1R9TI 1Q7Y2 1Z02A 2K5RA 2JR6A 3CPWZ 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M6N A;  2RT9 A;  1QF8 A;  1JWH C;  2R6M A;  4DGL A;  4NH1 C;  2JMO A;  4MD9 A;  4MD8 A;  1RQF A;  4MD7 A;  2M48 A;  3EED A; 
#chains in the Genus database with same CATH topology
 2P28 A;  1LQL A;  2R7Z I;  3S1N I;  3F3P C;  2QLV B;  5C4J I;  4NBC A;  2R6M A;  2JIR A;  1VQ8 Z;  3U50 C;  1K8A 1;  2O4H A;  3HOX I;  1TWH I;  2JA5 I;  2YAD A;  3CME 1;  1WJ2 A;  2DE6 A;  3HOW I;  4E2Z A;  2R93 I;  3S17 I;  4S1T A;  4A3J I;  2BJO A;  3KIF A;  1YJ9 Z;  2B63 I;  4A3I I;  3OW2 Z;  3GTM S;  1VQP Z;  4NB8 A;  2V3V A;  3NFZ A;  4NOZ A;  3ESW A;  1RQF A;  2QEX Z;  2QRE B;  1Z03 A;  3CC7 1;  4A93 I;  2KI7 B;  3D6W A;  3KIH A;  5FLM I;  4AYB A;  2F4M A;  5IT9 b;  2H85 A;  1VQO Z;  2JA6 I;  2OZK A;  1NJI 2;  4A3C I;  3GCF A;  2I3C A;  1FDI A;  3GTP I;  4BY7 I;  2LEX A;  4Y52 I;  1KC8 1;  3CC4 1;  1TWF I;  3CMA 1;  3IR7 A;  1Y8C A;  1NUI A;  3IX0 A;  2IZ3 A;  3QWU A;  1N8R 2;  3J81 b;  3CCS Z;  2K3R A;  1YIJ Z;  4MRI A;  1VLA A;  3JAM b;  1N2F A;  1K73 2;  1Q81 2;  1S72 Z;  3HOU I;  1KQS Y;  3IFU A;  2JNY A;  2WAQ A;  4QTU A;  1VQ7 Z;  3Q87 A;  1K9M 1;  3FKI I;  3NH8 A;  4HGY A;  3G6E 1;  1VQM Z;  3GKQ A;  3TDH B;  2J6A A;  3MON A;  3VB9 A;  2R92 I;  3S1M I;  4NBA A;  4CL1 A;  2HF1 A;  3GTK I;  2G2K A;  2OTL Z;  1YUA A;  1QYP A;  3CCM Z;  3CCV Z;  5A2Q f;  2V8I A;  2JS4 A;  3CD6 Z;  3PO2 I;  3S15 I;  2QRD B;  1X3W A;  1Y1V S;  1RLY A;  4HGZ A;  3HOY I;  1ML8 A;  2WB1 A;  2VUM I;  2QEX 1;  4A3M I;  2QR1 B;  3I55 Z;  5LL6 f;  4BXX I;  1W2B Z;  2OTJ Z;  4TNU A;  1QXF A;  2PMZ A;  4E31 A;  1W2B Y;  5IP7 I;  1KD1 2;  1I3Q I;  1M90 2;  3CPW Y;  3VMH A;  2F4O A;  1VQO 1;  4RVG A;  1VQ4 Z;  2P3Y A;  4RVH A;  5CM2 M;  1WW9 A;  1Q82 1;  1M1K 2;  2PK7 A;  3T4N B;  3GTO I;  5T64 A;  3HKZ A;  1VQK 1;  3GTJ I;  2JMO A;  3CCS 1;  3IF8 A;  1YIJ 1;  3CCL Z;  1Q7Y 1;  1WZN A;  3CCQ Z;  2Q51 A;  4XX2 A;  1I6H I;  4MD9 A;  1KD1 1;  1VQ5 Z;  1S72 1;  3S16 I;  3OW2 Y;  4RS4 A;  3CC2 Z;  2JIM A;  3BG0 B;  1VQ6 Z;  2V8J A;  3BG1 B;  3PO3 I;  3G4S Z;  4NBE A;  4MD8 A;  3I4M I;  5FLX f;  1JWH C;  3CCU Z;  3JAM f;  1Q86 2;  1USP A;  2EGT A;  1YJN 1;  1YJW Z;  3EED A;  3EER A;  2V8K A;  4A3B I;  3H0G I;  4DQY B;  3CD6 1;  3J80 b;  2LIY A;  3I56 1;  2E2I I;  3TE5 B;  3S1R I;  5T6B A;  4BBS I;  3K7A I;  2AYD A;  2YU9 I;  3RZD I;  4NBB A;  3I55 1;  4E30 A;  2OOY B;  3NH5 A;  1NJI 1;  2RHB A;  1Y1V I;  1YIT Z;  3S2D I;  2Y0S A;  3CME Z;  1VQ4 1;  5IP9 I;  2JUB A;  3D9X A;  5C4X I;  4NFR A;  1N8R 1;  1QVF Z;  1VQ8 1;  2VF1 A;  3NH4 A;  4A3F I;  2M48 A;  4MXU A;  3CCJ Z;  2HU9 A;  4BY1 I;  1WCM I;  3VMG A;  4MD7 A;  1Q81 1;  1K73 1;  3CCQ 1;  3G71 Z;  1YJ9 1;  3J7A 4;  1VQ5 1;  2JIO A;  1VQP 1;  2QA4 Z;  4MH4 A;  2QRC B;  2JIQ A;  2AKL A;  3I07 A;  2JA7 I;  2W04 A;  3LUS A;  4E2W A;  2JA8 I;  1USP B;  1KRL A;  1K83 I;  3GTM I;  1TWC I;  3FQM A;  3CC4 Z;  4DK1 A;  2E9H A;  1X3Z A;  3S1Q I;  3HOZ I;  4A3G I;  3G4S 1;  3CQZ I;  3CCR Z;  1P9N A;  3CCU 1;  5D1P A;  1I50 I;  1JJ2 Z;  1YHQ Z;  1K8A 2;  2NVY I;  1YJW 1;  1JJ2 Y;  2IV2 X;  3S2H I;  1ZB8 A;  4NBF A;  1L1O C;  1WII A;  1PFT A;  3CXC Z;  4NBD A;  2QKD A;  5A2Q b;  4E33 A;  3P5J B;  4NBG A;  3D2L A;  1TFI A;  4A3E I;  5IT9 f;  2E7Z A;  3G6E Z;  1FDO A;  2DE5 A;  4RV9 A;  1M90 1;  1YI2 Z;  3CCE Z;  4EWC A;  3FQQ A;  1VQ7 1;  2VPX A;  4RVD A;  3MZK B;  1YIT 1;  5D1O A;  3NDJ A;  2VPY A;  3J81 f;  1M1K 1;  1ZH1 A;  2RT9 A;  3J80 f;  1VQM 1;  4E2Y A;  3VMI A;  4E32 A;  1DL6 A;  4NH1 C;  2Q4Z A;  4NBH A;  2GU2 A;  1Z01 A;  2OOX B;  1KC8 2;  4RVF A;  4QTT A;  5C44 I;  1VQN Z;  1RO0 A;  2NVQ I;  3I4N I;  2PM9 A;  3CCJ 1;  1VQ9 Z;  2OTL 1;  3H3V J;  2NAP A;  3NDI A;  3CCM 1;  3CCV 1;  1RNI A;  1VQL Z;  4MON A;  4Y7N I;  1S7M A;  3G71 1;  4A3K I;  2IZ4 A;  2M6N A;  5C3E I;  2NVX I;  3VTN A;  2QA4 1;  3GTQ I;  1K9M 2;  2OTJ 1;  4BBR I;  2JIP A;  5AN9 F;  2GTH A;  3M3Y I;  1Q86 1;  1VQK Z;  1NP6 A;  1TWG I;  2ZAE B;  1YUK A;  2RIQ A;  3CCR 1;  3M4O I;  4X6A I;  2E2J I;  1YHQ 1;  2GTI A;  2NVT I;  2VPZ A;  4HH4 A;  5T67 A;  1SIW A;  5FLX b;  1KQS Z;  4E2X A;  1QVF Y;  2E2H I;  2VUG A;  3PO3 S;  3CC7 Z;  4NB9 A;  3GTL I;  3CCL 1;  2VPW A;  2RBL A;  1QVG Z;  1Y1W I;  2V45 A;  5D1O B;  1QVG Y;  2LFU A;  1YI2 1;  1Q16 A;  2O53 A;  1RO2 A;  1X0T A;  3CCE 1;  3GTG I;  3HOV I;  2DE7 A;  2RPR A;  1YJN Z;  3CC2 1;  4A3L I;  1VQ6 1;  2KPI A;  3MZL B;  1AA6 A;  3CMA Z;  1SFO I;  1TWA I;  1RO4 A;  1Q82 2;  4DGL A;  3RZO I;  4A3D I;  3I56 Z;  2W03 A;  3F3F C;  1VQN 1;  1QF8 A;  1ZB9 A;  1VQ9 1;  3S14 I;  1VQL 1;  1R9T I;  1Q7Y 2;  1Z02 A;  2K5R A;  2JR6 A;  3CPW Z;  3CXC Y; 
#chains in the Genus database with same CATH homology
 2P28 A;  1LQL A;  2R7Z I;  3S1N I;  3F3P C;  2QLV B;  5C4J I;  4NBC A;  2R6M A;  1VQ8 Z;  3U50 C;  1K8A 1;  2O4H A;  3HOX I;  1TWH I;  2JA5 I;  2YAD A;  3CME 1;  2DE6 A;  3HOW I;  4E2Z A;  2R93 I;  3S17 I;  4S1T A;  4A3J I;  2BJO A;  3KIF A;  1YJ9 Z;  2B63 I;  4A3I I;  3OW2 Z;  3GTM S;  1VQP Z;  4NB8 A;  3NFZ A;  4NOZ A;  3ESW A;  1RQF A;  2QEX Z;  2QRE B;  1Z03 A;  3CC7 1;  4A93 I;  2KI7 B;  3D6W A;  3KIH A;  5FLM I;  4AYB A;  2F4M A;  5IT9 b;  2H85 A;  1VQO Z;  2JA6 I;  2OZK A;  1NJI 2;  4A3C I;  3GCF A;  2I3C A;  3GTP I;  4BY7 I;  4Y52 I;  1KC8 1;  3CC4 1;  1TWF I;  3CMA 1;  1NUI A;  3IX0 A;  2IZ3 A;  3QWU A;  1N8R 2;  3J81 b;  3CCS Z;  2K3R A;  1YIJ Z;  4MRI A;  1VLA A;  3JAM b;  1N2F A;  1K73 2;  1Q81 2;  1S72 Z;  3HOU I;  1KQS Y;  3IFU A;  2JNY A;  2WAQ A;  4QTU A;  1VQ7 Z;  3Q87 A;  1K9M 1;  3FKI I;  3NH8 A;  4HGY A;  3G6E 1;  1VQM Z;  3GKQ A;  3TDH B;  2J6A A;  3MON A;  3VB9 A;  2R92 I;  3S1M I;  4NBA A;  4CL1 A;  2HF1 A;  3GTK I;  2G2K A;  2OTL Z;  1YUA A;  1QYP A;  3CCM Z;  3CCV Z;  5A2Q f;  2V8I A;  2JS4 A;  3CD6 Z;  3PO2 I;  3S15 I;  2QRD B;  1X3W A;  1Y1V S;  1RLY A;  4HGZ A;  3HOY I;  1ML8 A;  2WB1 A;  2VUM I;  2QEX 1;  4A3M I;  2QR1 B;  3I55 Z;  5LL6 f;  4BXX I;  1W2B Z;  2OTJ Z;  4TNU A;  2PMZ A;  4E31 A;  1W2B Y;  5IP7 I;  1KD1 2;  1I3Q I;  1M90 2;  3CPW Y;  3VMH A;  2F4O A;  1VQO 1;  4RVG A;  1VQ4 Z;  2P3Y A;  4RVH A;  5CM2 M;  1WW9 A;  1Q82 1;  1M1K 2;  2PK7 A;  3T4N B;  3GTO I;  5T64 A;  3HKZ A;  1VQK 1;  3GTJ I;  2JMO A;  3CCS 1;  3IF8 A;  1YIJ 1;  3CCL Z;  1Q7Y 1;  3CCQ Z;  2Q51 A;  4XX2 A;  1I6H I;  4MD9 A;  1KD1 1;  1VQ5 Z;  1S72 1;  3S16 I;  3OW2 Y;  4RS4 A;  3CC2 Z;  3BG0 B;  1VQ6 Z;  2V8J A;  3BG1 B;  3PO3 I;  3G4S Z;  4NBE A;  4MD8 A;  3I4M I;  5FLX f;  1JWH C;  3CCU Z;  3JAM f;  1Q86 2;  1USP A;  2EGT A;  1YJN 1;  1YJW Z;  3EED A;  3EER A;  2V8K A;  4A3B I;  3H0G I;  4DQY B;  3CD6 1;  3J80 b;  2LIY A;  3I56 1;  2E2I I;  3TE5 B;  3S1R I;  5T6B A;  4BBS I;  3K7A I;  2YU9 I;  3RZD I;  4NBB A;  3I55 1;  4E30 A;  2OOY B;  3NH5 A;  1NJI 1;  2RHB A;  1Y1V I;  1YIT Z;  3S2D I;  2Y0S A;  3CME Z;  1VQ4 1;  5IP9 I;  2JUB A;  3D9X A;  5C4X I;  4NFR A;  1N8R 1;  1QVF Z;  1VQ8 1;  2VF1 A;  3NH4 A;  4A3F I;  2M48 A;  4MXU A;  3CCJ Z;  2HU9 A;  4BY1 I;  1WCM I;  3VMG A;  4MD7 A;  1Q81 1;  1K73 1;  3CCQ 1;  3G71 Z;  1YJ9 1;  3J7A 4;  1VQ5 1;  1VQP 1;  2QA4 Z;  4MH4 A;  2QRC B;  2AKL A;  3I07 A;  2JA7 I;  2W04 A;  3LUS A;  4E2W A;  2JA8 I;  1USP B;  1KRL A;  1K83 I;  3GTM I;  1TWC I;  3FQM A;  3CC4 Z;  4DK1 A;  2E9H A;  1X3Z A;  3S1Q I;  3HOZ I;  4A3G I;  3G4S 1;  3CQZ I;  3CCR Z;  1P9N A;  3CCU 1;  5D1P A;  1I50 I;  1JJ2 Z;  1YHQ Z;  1K8A 2;  2NVY I;  1YJW 1;  1JJ2 Y;  3S2H I;  1ZB8 A;  4NBF A;  1L1O C;  1WII A;  1PFT A;  3CXC Z;  4NBD A;  2QKD A;  5A2Q b;  4E33 A;  3P5J B;  4NBG A;  1TFI A;  4A3E I;  5IT9 f;  3G6E Z;  2DE5 A;  4RV9 A;  1M90 1;  1YI2 Z;  3CCE Z;  4EWC A;  3FQQ A;  1VQ7 1;  4RVD A;  3MZK B;  1YIT 1;  5D1O A;  3NDJ A;  3J81 f;  1M1K 1;  1ZH1 A;  2RT9 A;  3J80 f;  1VQM 1;  4E2Y A;  3VMI A;  4E32 A;  1DL6 A;  4NH1 C;  2Q4Z A;  4NBH A;  2GU2 A;  1Z01 A;  2OOX B;  1KC8 2;  4RVF A;  4QTT A;  5C44 I;  1VQN Z;  1RO0 A;  2NVQ I;  3I4N I;  2PM9 A;  3CCJ 1;  1VQ9 Z;  2OTL 1;  3H3V J;  3NDI A;  3CCM 1;  3CCV 1;  1RNI A;  1VQL Z;  4MON A;  4Y7N I;  1S7M A;  3G71 1;  4A3K I;  2IZ4 A;  2M6N A;  5C3E I;  2NVX I;  3VTN A;  2QA4 1;  3GTQ I;  1K9M 2;  2OTJ 1;  4BBR I;  5AN9 F;  2GTH A;  3M3Y I;  1Q86 1;  1VQK Z;  1NP6 A;  1TWG I;  2ZAE B;  1YUK A;  2RIQ A;  3CCR 1;  3M4O I;  4X6A I;  2E2J I;  1YHQ 1;  2GTI A;  2NVT I;  4HH4 A;  5T67 A;  5FLX b;  1KQS Z;  4E2X A;  1QVF Y;  2E2H I;  2VUG A;  3PO3 S;  3CC7 Z;  4NB9 A;  3GTL I;  3CCL 1;  2RBL A;  1QVG Z;  1Y1W I;  5D1O B;  1QVG Y;  2LFU A;  1YI2 1;  2O53 A;  1RO2 A;  1X0T A;  3CCE 1;  3GTG I;  3HOV I;  2DE7 A;  2RPR A;  1YJN Z;  3CC2 1;  4A3L I;  1VQ6 1;  2KPI A;  3MZL B;  3CMA Z;  1SFO I;  1TWA I;  1RO4 A;  1Q82 2;  4DGL A;  3RZO I;  4A3D I;  3I56 Z;  2W03 A;  3F3F C;  1VQN 1;  1QF8 A;  1ZB9 A;  1VQ9 1;  3S14 I;  1VQL 1;  1R9T I;  1Q7Y 2;  1Z02 A;  2K5R A;  2JR6 A;  3CPW Z;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...