4MD7A

Crystal structure of full-length symmetric ck2 holoenzyme
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
202
structure length
199
Chain Sequence
b'EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 199
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 4md7A01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4md7A02
4MD7A 2M48A 4DGLA 4MD9A 2M6NA 2RT9A 4NH1C 1QF8A 1RQFA 3EEDA 2R6MA 1JWHC 4MD8A 2JMOA
chains in the Genus database with same CATH superfamily
1RLYA 2JA7I 2QREB 1YJN1 3CMA1 3D6WA 4QTTA 1JWHC 3J80b 4QTUA 1Y1VS 2J6AA 3HOUI 3S2DI 5IP9I 2OZKA 2O53A 3CCJ1 2V45A 1VQ5Z 1I50I 2IZ4A 1Q7Y1 4Y52I 3H3VJ 3FQQA 3OW2Z 5T6BA 1N2FA 2VF1A 3I4MI 2Q51A 3CD61 1WW9A 4XX2A 3J80f 2OTLZ 1TWAI 2RIQA 2RBLA 2JR6A 1Q16A 1YI2Z 5T67A 1VQKZ 1KRLA 1Q861 1WIIA 3VMIA 4RVFA 4A3KI 2PK7A 3BG0B 3IF8A 3GTGI 2NAPA 2F4MA 5A2Qb 3EERA 2JIPA 3M3YI 2M48A 2V3VA 2AYDA 3CXCZ 1X3WA 1M902 2GTHA 1L1OC 1K8A2 2ZAEB 3GTLI 3S2HI 1VQ81 4BY7I 3NFZA 4E31A 3TE5B 2VUGA 5A2Qf 4A3II 4DGLA 2VPZA 3CCV1 4HH4A 3S14I 1YJ91 4E30A 1WJ2A 2QEX1 1N8R1 1Q812 1RQFA 1K83I 3MZLB 4MD8A 1NP6A 2JMOA 3GTJI 1S7MA 2JIQA 1YITZ 3KIFA 3CC71 5D1OA 1YJWZ 2M6NA 3CCE1 3MZKB 2R93I 2PMZA 1Y8CA 2KPIA 2OOXB 1USPB 4Y7NI 1Y1VI 3GTOI 4A3GI 3F3FC 1N8R2 2V8KA 5CM2M 3CME1 1VQOZ 3CCR1 1M1K1 2RT9A 5D1PA 4NB9A 2R6MA 2IV2X 1NUIA 1VQLZ 4A93I 1FDIA 2P28A 2LIYA 1FDOA 2QLVB 1LQLA 2YADA 2NVXI 2QA41 3OW2Y 4BBSI 3I55Z 1VQPZ 1SIWA 1RNIA 3GTKI 1VLAA 2QRDB 4BBRI 3CCM1 3I56Z 1AA6A 3CC4Z 3IFUA 4MD7A 3HOXI 4NBFA 4A3EI 1VQMZ 3GTMS 2VPWA 3NH4A 3CCS1 3IX0A 3CCLZ 4A3BI 3GKQA 1VQ61 2P3YA 3PO3S 3VB9A 3NDJA 4E33A 4RVHA 3CXCY 1VQ71 1YJNZ 3CMAZ 3EEDA 1YUKA 2OTJ1 3CCQ1 1VQ4Z 1VQN1 1K732 2G2KA 4HGZA 1M901 1ZH1A 1K8A1 1Z01A 5AN9F 3D2LA 3PO2I 1R9TI 4DK1A 1QVFZ 2I3CA 1TWFI 2K3RA 1KQSZ 3KIHA 3VMGA 4A3LI 4AYBA 4NBEA 3CD6Z 3CC21 5C4XI 2IZ3A 1PFTA 3I07A 1Q811 3BG1B 3HKZA 1X0TA 2Q4ZA 3S16I 3HOVI 1JJ2Z 3K7AI 1DL6A 3RZDI 1NJI1 3GTQI 2QKDA 3G6E1 1W2BZ 4MONA 4S1TA 1Z03A 2BJOA 1I3QI 2JIMA 5LL6f 3MONA 2E9HA 3G4S1 1S721 3GCFA 2HU9A 3Q87A 3CCVZ 1YJ9Z 5C3EI 1K9M1 2GU2A 1NJI2 2H85A 1Z02A 3P5JB 4NBHA 2QEXZ 1Y1WI 3GTMI 4A3JI 4BXXI 2V8JA 2DE7A 4RS4A 5D1OB 3G711 3PO3I 3HOWI 3CC7Z 2E2JI 1QYPA 2QR1B 3CCEZ 3QWUA 2W04A 3CQZI 4NBDA 4E2XA 3S1RI 3S1QI 3I4NI 3U50C 1K9M2 4E2WA 1YHQ1 4MXUA 5C44I 1QXFA 1VQO1 3CPWY 3HOYI 3CMEZ 4MH4A 5T64A 1VQ91 3CCRZ 2LEXA 1TWHI 1VQL1 1ML8A 3CCU1 4HGYA 1K731 4A3CI 3NH8A 1QVFY 1KD11 1Q821 3T4NB 1YIJ1 2QA4Z 4NOZA 1KQSY 1SFOI 4NBGA 2WB1A 1KC82 2JUBA 4MD9A 3NDIA 3FQMA 1WZNA 1RO4A 2JA8I 4EWCA 1QF8A 1RO2A 3CCSZ 3CPWZ 1QVGZ 2NVTI 1JJ2Y 1VQ6Z 2RHBA 4E32A 1W2BY 3J81b 1KD12 1Q822 2GTIA 4E2YA 1VQ7Z 1VQ41 1VQ51 3M4OI 4A3FI 1TWCI 2Y0SA 3CCJZ 3CCQZ 2OTJZ 1VQNZ 3JAMb 2O4HA 3D9XA 5FLXb 2OTL1 1TFIA 1YI21 4X6AI 1VQK1 2DE5A 4NBBA 3J81f 4E2ZA 1I6HI 4NH1C 2KI7B 2QRCB 2B63I 2JA5I 2VPYA 3CC2Z 3JAMf 2AKLA 5FLXf 2NVYI 2E7ZA 3ESWA 3NH5A 2JNYA 1Q7Y2 2YU9I 2HF1A 3S1NI 3G6EZ 2W03A 2VPXA 1VQ8Z 4CL1A 3LUSA 3VMHA 3G4SZ 3H0GI 1Q862 1S72Z 3S17I 4RV9A 1TWGI 2R92I 2RPRA 2DE6A 3IR7A 2JS4A 2F4OA 1YIT1 3TDHB 1X3ZA 1YJW1 2NVQI 5IP7I 1WCMI 2PM9A 2K5RA 4MRIA 2EGTA 4RVGA 2E2II 1RO0A 4TNUA 5FLMI 4A3DI 3G71Z 1KC81 4RVDA 1ZB9A 2E2HI 1YUAA 2R7ZI 1USPA 1QVGY 3J7A4 5IT9b 3F3PC 2JIRA 2LFUA 4NB8A 3GTPI 3RZOI 1ZB8A 3FKII 1YHQZ 4A3MI 1VQ9Z 1P9NA 2JIOA 2JA6I 2OOYB 3VTNA 3I551 1VQP1 2V8IA 2WAQA 5C4JI 3CCUZ 4DQYB 5IT9f 4NBCA 3I561 3CC41 3CCMZ 1VQM1 4NFRA 1YIJZ 2VUMI 3CCL1 4NBAA 4BY1I 3S15I 3HOZI 3S1MI 1M1K2
chains in the Genus database with same CATH topology
1RLYA 2JA7I 2QREB 1YJN1 3CMA1 3D6WA 4QTTA 1JWHC 3J80b 4QTUA 1Y1VS 2J6AA 3HOUI 3S2DI 5IP9I 2OZKA 2O53A 3CCJ1 1VQ5Z 1I50I 2IZ4A 1Q7Y1 4Y52I 3H3VJ 3FQQA 3OW2Z 5T6BA 1N2FA 2VF1A 3I4MI 2Q51A 3CD61 1WW9A 4XX2A 3J80f 2OTLZ 1TWAI 2RIQA 2RBLA 2JR6A 1YI2Z 5T67A 1VQKZ 1KRLA 1Q861 1WIIA 3VMIA 4RVFA 4A3KI 2PK7A 3BG0B 3IF8A 3GTGI 2F4MA 5A2Qb 3EERA 3M3YI 2M48A 3CXCZ 1X3WA 1M902 2GTHA 1L1OC 1K8A2 2ZAEB 3GTLI 3S2HI 1VQ81 4BY7I 3NFZA 4E31A 3TE5B 2VUGA 5A2Qf 4A3II 4DGLA 3CCV1 4HH4A 3S14I 1YJ91 4E30A 2QEX1 1N8R1 1Q812 1RQFA 1K83I 3MZLB 4MD8A 1NP6A 2JMOA 3GTJI 1S7MA 1YITZ 3KIFA 3CC71 5D1OA 1YJWZ 2M6NA 3CCE1 3MZKB 2R93I 2PMZA 2KPIA 2OOXB 1USPB 4Y7NI 1Y1VI 3GTOI 4A3GI 3F3FC 1N8R2 2V8KA 5CM2M 3CME1 1VQOZ 3CCR1 1M1K1 2RT9A 5D1PA 4NB9A 2R6MA 1NUIA 1VQLZ 4A93I 2P28A 2LIYA 2QLVB 1LQLA 2YADA 2NVXI 2QA41 3OW2Y 4BBSI 3I55Z 1VQPZ 1RNIA 3GTKI 1VLAA 2QRDB 4BBRI 3CCM1 3I56Z 3CC4Z 3IFUA 4MD7A 3HOXI 4NBFA 1VQMZ 4A3EI 3GTMS 3NH4A 3CCS1 3IX0A 3CCLZ 4A3BI 3GKQA 1VQ61 2P3YA 3PO3S 3VB9A 3NDJA 4E33A 4RVHA 3CXCY 1VQ71 1YJNZ 3CMAZ 3EEDA 1YUKA 2OTJ1 3CCQ1 1VQ4Z 1VQN1 1K732 2G2KA 4HGZA 1M901 1ZH1A 1K8A1 1Z01A 5AN9F 3PO2I 1R9TI 4DK1A 1QVFZ 2I3CA 1TWFI 2K3RA 1KQSZ 3KIHA 3VMGA 4A3LI 4AYBA 4NBEA 3CD6Z 3CC21 5C4XI 2IZ3A 1PFTA 3I07A 1Q811 3BG1B 3HKZA 1X0TA 2Q4ZA 3S16I 3HOVI 1JJ2Z 3K7AI 1DL6A 3RZDI 1NJI1 3GTQI 2QKDA 3G6E1 1W2BZ 4MONA 4S1TA 1Z03A 2BJOA 1I3QI 5LL6f 3MONA 2E9HA 3G4S1 1S721 3GCFA 2HU9A 3Q87A 3CCVZ 1YJ9Z 5C3EI 1K9M1 2GU2A 1NJI2 2H85A 1Z02A 3P5JB 4NBHA 2QEXZ 1Y1WI 3GTMI 4A3JI 4BXXI 2V8JA 2DE7A 4RS4A 5D1OB 3G711 3PO3I 3HOWI 3CC7Z 2E2JI 1QYPA 2QR1B 3CCEZ 3QWUA 2W04A 3CQZI 4NBDA 4E2XA 3S1RI 3S1QI 3I4NI 3U50C 1K9M2 1YHQ1 4E2WA 4MXUA 5C44I 1VQO1 3CPWY 3HOYI 3CMEZ 4MH4A 5T64A 1VQ91 3CCRZ 1TWHI 1VQL1 1ML8A 3CCU1 4HGYA 1K731 4A3CI 3NH8A 1QVFY 1KD11 1Q821 3T4NB 1YIJ1 2QA4Z 4NOZA 1KQSY 1SFOI 4NBGA 2WB1A 1KC82 2JUBA 4MD9A 3NDIA 3FQMA 1RO4A 2JA8I 4EWCA 1QF8A 1RO2A 3CCSZ 3CPWZ 1QVGZ 2NVTI 1JJ2Y 1VQ6Z 2RHBA 4E32A 1W2BY 3J81b 1KD12 1Q822 2GTIA 4E2YA 1VQ7Z 1VQ41 1VQ51 3M4OI 4A3FI 1TWCI 2Y0SA 3CCJZ 3CCQZ 2OTJZ 1VQNZ 3JAMb 2O4HA 3D9XA 5FLXb 2OTL1 1TFIA 1YI21 4X6AI 1VQK1 2DE5A 4NBBA 3J81f 4E2ZA 1I6HI 4NH1C 2KI7B 2QRCB 2B63I 2JA5I 3CC2Z 3JAMf 2AKLA 5FLXf 2NVYI 3ESWA 3NH5A 2JNYA 1Q7Y2 2YU9I 2HF1A 3S1NI 3G6EZ 2W03A 1VQ8Z 4CL1A 3LUSA 3VMHA 3G4SZ 3H0GI 1Q862 1S72Z 3S17I 4RV9A 1TWGI 2R92I 2RPRA 2DE6A 2JS4A 2F4OA 1YIT1 3TDHB 1X3ZA 1YJW1 2NVQI 5IP7I 1WCMI 2PM9A 2K5RA 4MRIA 2EGTA 4RVGA 2E2II 1RO0A 4TNUA 5FLMI 4A3DI 3G71Z 1KC81 4RVDA 1ZB9A 2E2HI 1YUAA 2R7ZI 1USPA 1QVGY 3J7A4 5IT9b 3F3PC 2LFUA 4NB8A 3GTPI 3RZOI 1ZB8A 3FKII 1YHQZ 4A3MI 1VQ9Z 1P9NA 2JA6I 2OOYB 3VTNA 3I551 1VQP1 2V8IA 2WAQA 5C4JI 3CCUZ 5IT9f 4DQYB 4NBCA 3I561 3CC41 3CCMZ 1VQM1 4NFRA 1YIJZ 2VUMI 3CCL1 4NBAA 4BY1I 3S15I 3HOZI 3S1MI 1M1K2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD7 A;  2M48 A;  4DGL A;  4MD9 A;  2M6N A;  2RT9 A;  4NH1 C;  1QF8 A;  1RQF A;  3EED A;  2R6M A;  1JWH C;  4MD8 A;  2JMO A; 
#chains in the Genus database with same CATH topology
 1RLY A;  2JA7 I;  2QRE B;  1YJN 1;  3CMA 1;  3D6W A;  4QTT A;  1JWH C;  3J80 b;  4QTU A;  1Y1V S;  2J6A A;  3HOU I;  3S2D I;  5IP9 I;  2OZK A;  2O53 A;  3CCJ 1;  2V45 A;  1VQ5 Z;  1I50 I;  2IZ4 A;  1Q7Y 1;  4Y52 I;  3H3V J;  3FQQ A;  3OW2 Z;  5T6B A;  1N2F A;  2VF1 A;  3I4M I;  2Q51 A;  3CD6 1;  1WW9 A;  4XX2 A;  3J80 f;  2OTL Z;  1TWA I;  2RIQ A;  2RBL A;  2JR6 A;  1Q16 A;  1YI2 Z;  5T67 A;  1VQK Z;  1KRL A;  1Q86 1;  1WII A;  3VMI A;  4RVF A;  4A3K I;  2PK7 A;  3BG0 B;  3IF8 A;  3GTG I;  2NAP A;  2F4M A;  5A2Q b;  3EER A;  2JIP A;  3M3Y I;  2M48 A;  2V3V A;  2AYD A;  3CXC Z;  1X3W A;  1M90 2;  2GTH A;  1L1O C;  1K8A 2;  2ZAE B;  3GTL I;  3S2H I;  1VQ8 1;  4BY7 I;  3NFZ A;  4E31 A;  3TE5 B;  2VUG A;  5A2Q f;  4A3I I;  4DGL A;  2VPZ A;  3CCV 1;  4HH4 A;  3S14 I;  1YJ9 1;  4E30 A;  1WJ2 A;  2QEX 1;  1N8R 1;  1Q81 2;  1RQF A;  1K83 I;  3MZL B;  4MD8 A;  1NP6 A;  2JMO A;  3GTJ I;  1S7M A;  2JIQ A;  1YIT Z;  3KIF A;  3CC7 1;  5D1O A;  1YJW Z;  2M6N A;  3CCE 1;  3MZK B;  2R93 I;  2PMZ A;  1Y8C A;  2KPI A;  2OOX B;  1USP B;  4Y7N I;  1Y1V I;  3GTO I;  4A3G I;  3F3F C;  1N8R 2;  2V8K A;  5CM2 M;  3CME 1;  1VQO Z;  3CCR 1;  1M1K 1;  2RT9 A;  5D1P A;  4NB9 A;  2R6M A;  2IV2 X;  1NUI A;  1VQL Z;  4A93 I;  1FDI A;  2P28 A;  2LIY A;  1FDO A;  2QLV B;  1LQL A;  2YAD A;  2NVX I;  2QA4 1;  3OW2 Y;  4BBS I;  3I55 Z;  1VQP Z;  1SIW A;  1RNI A;  3GTK I;  1VLA A;  2QRD B;  4BBR I;  3CCM 1;  3I56 Z;  1AA6 A;  3CC4 Z;  3IFU A;  4MD7 A;  3HOX I;  4NBF A;  4A3E I;  1VQM Z;  3GTM S;  2VPW A;  3NH4 A;  3CCS 1;  3IX0 A;  3CCL Z;  4A3B I;  3GKQ A;  1VQ6 1;  2P3Y A;  3PO3 S;  3VB9 A;  3NDJ A;  4E33 A;  4RVH A;  3CXC Y;  1VQ7 1;  1YJN Z;  3CMA Z;  3EED A;  1YUK A;  2OTJ 1;  3CCQ 1;  1VQ4 Z;  1VQN 1;  1K73 2;  2G2K A;  4HGZ A;  1M90 1;  1ZH1 A;  1K8A 1;  1Z01 A;  5AN9 F;  3D2L A;  3PO2 I;  1R9T I;  4DK1 A;  1QVF Z;  2I3C A;  1TWF I;  2K3R A;  1KQS Z;  3KIH A;  3VMG A;  4A3L I;  4AYB A;  4NBE A;  3CD6 Z;  3CC2 1;  5C4X I;  2IZ3 A;  1PFT A;  3I07 A;  1Q81 1;  3BG1 B;  3HKZ A;  1X0T A;  2Q4Z A;  3S16 I;  3HOV I;  1JJ2 Z;  3K7A I;  1DL6 A;  3RZD I;  1NJI 1;  3GTQ I;  2QKD A;  3G6E 1;  1W2B Z;  4MON A;  4S1T A;  1Z03 A;  2BJO A;  1I3Q I;  2JIM A;  5LL6 f;  3MON A;  2E9H A;  3G4S 1;  1S72 1;  3GCF A;  2HU9 A;  3Q87 A;  3CCV Z;  1YJ9 Z;  5C3E I;  1K9M 1;  2GU2 A;  1NJI 2;  2H85 A;  1Z02 A;  3P5J B;  4NBH A;  2QEX Z;  1Y1W I;  3GTM I;  4A3J I;  4BXX I;  2V8J A;  2DE7 A;  4RS4 A;  5D1O B;  3G71 1;  3PO3 I;  3HOW I;  3CC7 Z;  2E2J I;  1QYP A;  2QR1 B;  3CCE Z;  3QWU A;  2W04 A;  3CQZ I;  4NBD A;  4E2X A;  3S1R I;  3S1Q I;  3I4N I;  3U50 C;  1K9M 2;  4E2W A;  1YHQ 1;  4MXU A;  5C44 I;  1QXF A;  1VQO 1;  3CPW Y;  3HOY I;  3CME Z;  4MH4 A;  5T64 A;  1VQ9 1;  3CCR Z;  2LEX A;  1TWH I;  1VQL 1;  1ML8 A;  3CCU 1;  4HGY A;  1K73 1;  4A3C I;  3NH8 A;  1QVF Y;  1KD1 1;  1Q82 1;  3T4N B;  1YIJ 1;  2QA4 Z;  4NOZ A;  1KQS Y;  1SFO I;  4NBG A;  2WB1 A;  1KC8 2;  2JUB A;  4MD9 A;  3NDI A;  3FQM A;  1WZN A;  1RO4 A;  2JA8 I;  4EWC A;  1QF8 A;  1RO2 A;  3CCS Z;  3CPW Z;  1QVG Z;  2NVT I;  1JJ2 Y;  1VQ6 Z;  2RHB A;  4E32 A;  1W2B Y;  3J81 b;  1KD1 2;  1Q82 2;  2GTI A;  4E2Y A;  1VQ7 Z;  1VQ4 1;  1VQ5 1;  3M4O I;  4A3F I;  1TWC I;  2Y0S A;  3CCJ Z;  3CCQ Z;  2OTJ Z;  1VQN Z;  3JAM b;  2O4H A;  3D9X A;  5FLX b;  2OTL 1;  1TFI A;  1YI2 1;  4X6A I;  1VQK 1;  2DE5 A;  4NBB A;  3J81 f;  4E2Z A;  1I6H I;  4NH1 C;  2KI7 B;  2QRC B;  2B63 I;  2JA5 I;  2VPY A;  3CC2 Z;  3JAM f;  2AKL A;  5FLX f;  2NVY I;  2E7Z A;  3ESW A;  3NH5 A;  2JNY A;  1Q7Y 2;  2YU9 I;  2HF1 A;  3S1N I;  3G6E Z;  2W03 A;  2VPX A;  1VQ8 Z;  4CL1 A;  3LUS A;  3VMH A;  3G4S Z;  3H0G I;  1Q86 2;  1S72 Z;  3S17 I;  4RV9 A;  1TWG I;  2R92 I;  2RPR A;  2DE6 A;  3IR7 A;  2JS4 A;  2F4O A;  1YIT 1;  3TDH B;  1X3Z A;  1YJW 1;  2NVQ I;  5IP7 I;  1WCM I;  2PM9 A;  2K5R A;  4MRI A;  2EGT A;  4RVG A;  2E2I I;  1RO0 A;  4TNU A;  5FLM I;  4A3D I;  3G71 Z;  1KC8 1;  4RVD A;  1ZB9 A;  2E2H I;  1YUA A;  2R7Z I;  1USP A;  1QVG Y;  3J7A 4;  5IT9 b;  3F3P C;  2JIR A;  2LFU A;  4NB8 A;  3GTP I;  3RZO I;  1ZB8 A;  3FKI I;  1YHQ Z;  4A3M I;  1VQ9 Z;  1P9N A;  2JIO A;  2JA6 I;  2OOY B;  3VTN A;  3I55 1;  1VQP 1;  2V8I A;  2WAQ A;  5C4J I;  3CCU Z;  4DQY B;  5IT9 f;  4NBC A;  3I56 1;  3CC4 1;  3CCM Z;  1VQM 1;  4NFR A;  1YIJ Z;  2VUM I;  3CCL 1;  4NBA A;  4BY1 I;  3S15 I;  3HOZ I;  3S1M I;  1M1K 2; 
#chains in the Genus database with same CATH homology
 1RLY A;  2JA7 I;  2QRE B;  1YJN 1;  3CMA 1;  3D6W A;  4QTT A;  1JWH C;  3J80 b;  4QTU A;  1Y1V S;  2J6A A;  3HOU I;  3S2D I;  5IP9 I;  2OZK A;  2O53 A;  3CCJ 1;  1VQ5 Z;  1I50 I;  2IZ4 A;  1Q7Y 1;  4Y52 I;  3H3V J;  3FQQ A;  3OW2 Z;  5T6B A;  1N2F A;  2VF1 A;  3I4M I;  2Q51 A;  3CD6 1;  1WW9 A;  4XX2 A;  3J80 f;  2OTL Z;  1TWA I;  2RIQ A;  2RBL A;  2JR6 A;  1YI2 Z;  5T67 A;  1VQK Z;  1KRL A;  1Q86 1;  1WII A;  3VMI A;  4RVF A;  4A3K I;  2PK7 A;  3BG0 B;  3IF8 A;  3GTG I;  2F4M A;  5A2Q b;  3EER A;  3M3Y I;  2M48 A;  3CXC Z;  1X3W A;  1M90 2;  2GTH A;  1L1O C;  1K8A 2;  2ZAE B;  3GTL I;  3S2H I;  1VQ8 1;  4BY7 I;  3NFZ A;  4E31 A;  3TE5 B;  2VUG A;  5A2Q f;  4A3I I;  4DGL A;  3CCV 1;  4HH4 A;  3S14 I;  1YJ9 1;  4E30 A;  2QEX 1;  1N8R 1;  1Q81 2;  1RQF A;  1K83 I;  3MZL B;  4MD8 A;  1NP6 A;  2JMO A;  3GTJ I;  1S7M A;  1YIT Z;  3KIF A;  3CC7 1;  5D1O A;  1YJW Z;  2M6N A;  3CCE 1;  3MZK B;  2R93 I;  2PMZ A;  2KPI A;  2OOX B;  1USP B;  4Y7N I;  1Y1V I;  3GTO I;  4A3G I;  3F3F C;  1N8R 2;  2V8K A;  5CM2 M;  3CME 1;  1VQO Z;  3CCR 1;  1M1K 1;  2RT9 A;  5D1P A;  4NB9 A;  2R6M A;  1NUI A;  1VQL Z;  4A93 I;  2P28 A;  2LIY A;  2QLV B;  1LQL A;  2YAD A;  2NVX I;  2QA4 1;  3OW2 Y;  4BBS I;  3I55 Z;  1VQP Z;  1RNI A;  3GTK I;  1VLA A;  2QRD B;  4BBR I;  3CCM 1;  3I56 Z;  3CC4 Z;  3IFU A;  4MD7 A;  3HOX I;  4NBF A;  1VQM Z;  4A3E I;  3GTM S;  3NH4 A;  3CCS 1;  3IX0 A;  3CCL Z;  4A3B I;  3GKQ A;  1VQ6 1;  2P3Y A;  3PO3 S;  3VB9 A;  3NDJ A;  4E33 A;  4RVH A;  3CXC Y;  1VQ7 1;  1YJN Z;  3CMA Z;  3EED A;  1YUK A;  2OTJ 1;  3CCQ 1;  1VQ4 Z;  1VQN 1;  1K73 2;  2G2K A;  4HGZ A;  1M90 1;  1ZH1 A;  1K8A 1;  1Z01 A;  5AN9 F;  3PO2 I;  1R9T I;  4DK1 A;  1QVF Z;  2I3C A;  1TWF I;  2K3R A;  1KQS Z;  3KIH A;  3VMG A;  4A3L I;  4AYB A;  4NBE A;  3CD6 Z;  3CC2 1;  5C4X I;  2IZ3 A;  1PFT A;  3I07 A;  1Q81 1;  3BG1 B;  3HKZ A;  1X0T A;  2Q4Z A;  3S16 I;  3HOV I;  1JJ2 Z;  3K7A I;  1DL6 A;  3RZD I;  1NJI 1;  3GTQ I;  2QKD A;  3G6E 1;  1W2B Z;  4MON A;  4S1T A;  1Z03 A;  2BJO A;  1I3Q I;  5LL6 f;  3MON A;  2E9H A;  3G4S 1;  1S72 1;  3GCF A;  2HU9 A;  3Q87 A;  3CCV Z;  1YJ9 Z;  5C3E I;  1K9M 1;  2GU2 A;  1NJI 2;  2H85 A;  1Z02 A;  3P5J B;  4NBH A;  2QEX Z;  1Y1W I;  3GTM I;  4A3J I;  4BXX I;  2V8J A;  2DE7 A;  4RS4 A;  5D1O B;  3G71 1;  3PO3 I;  3HOW I;  3CC7 Z;  2E2J I;  1QYP A;  2QR1 B;  3CCE Z;  3QWU A;  2W04 A;  3CQZ I;  4NBD A;  4E2X A;  3S1R I;  3S1Q I;  3I4N I;  3U50 C;  1K9M 2;  1YHQ 1;  4E2W A;  4MXU A;  5C44 I;  1VQO 1;  3CPW Y;  3HOY I;  3CME Z;  4MH4 A;  5T64 A;  1VQ9 1;  3CCR Z;  1TWH I;  1VQL 1;  1ML8 A;  3CCU 1;  4HGY A;  1K73 1;  4A3C I;  3NH8 A;  1QVF Y;  1KD1 1;  1Q82 1;  3T4N B;  1YIJ 1;  2QA4 Z;  4NOZ A;  1KQS Y;  1SFO I;  4NBG A;  2WB1 A;  1KC8 2;  2JUB A;  4MD9 A;  3NDI A;  3FQM A;  1RO4 A;  2JA8 I;  4EWC A;  1QF8 A;  1RO2 A;  3CCS Z;  3CPW Z;  1QVG Z;  2NVT I;  1JJ2 Y;  1VQ6 Z;  2RHB A;  4E32 A;  1W2B Y;  3J81 b;  1KD1 2;  1Q82 2;  2GTI A;  4E2Y A;  1VQ7 Z;  1VQ4 1;  1VQ5 1;  3M4O I;  4A3F I;  1TWC I;  2Y0S A;  3CCJ Z;  3CCQ Z;  2OTJ Z;  1VQN Z;  3JAM b;  2O4H A;  3D9X A;  5FLX b;  2OTL 1;  1TFI A;  1YI2 1;  4X6A I;  1VQK 1;  2DE5 A;  4NBB A;  3J81 f;  4E2Z A;  1I6H I;  4NH1 C;  2KI7 B;  2QRC B;  2B63 I;  2JA5 I;  3CC2 Z;  3JAM f;  2AKL A;  5FLX f;  2NVY I;  3ESW A;  3NH5 A;  2JNY A;  1Q7Y 2;  2YU9 I;  2HF1 A;  3S1N I;  3G6E Z;  2W03 A;  1VQ8 Z;  4CL1 A;  3LUS A;  3VMH A;  3G4S Z;  3H0G I;  1Q86 2;  1S72 Z;  3S17 I;  4RV9 A;  1TWG I;  2R92 I;  2RPR A;  2DE6 A;  2JS4 A;  2F4O A;  1YIT 1;  3TDH B;  1X3Z A;  1YJW 1;  2NVQ I;  5IP7 I;  1WCM I;  2PM9 A;  2K5R A;  4MRI A;  2EGT A;  4RVG A;  2E2I I;  1RO0 A;  4TNU A;  5FLM I;  4A3D I;  3G71 Z;  1KC8 1;  4RVD A;  1ZB9 A;  2E2H I;  1YUA A;  2R7Z I;  1USP A;  1QVG Y;  3J7A 4;  5IT9 b;  3F3P C;  2LFU A;  4NB8 A;  3GTP I;  3RZO I;  1ZB8 A;  3FKI I;  1YHQ Z;  4A3M I;  1VQ9 Z;  1P9N A;  2JA6 I;  2OOY B;  3VTN A;  3I55 1;  1VQP 1;  2V8I A;  2WAQ A;  5C4J I;  3CCU Z;  5IT9 f;  4DQY B;  4NBC A;  3I56 1;  3CC4 1;  3CCM Z;  1VQM 1;  4NFR A;  1YIJ Z;  2VUM I;  3CCL 1;  4NBA A;  4BY1 I;  3S15 I;  3HOZ I;  3S1M I;  1M1K 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...