3TE5B

Structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with nadh
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
103
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 18
structure length 103
sequence length 111
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3te5B01
2QLVB 2QRCB 2OOXB 3TDHB 2QREB 3TE5B 2QR1B 2QRDB 2OOYB 3T4NB
chains in the Genus database with same CATH superfamily
2JNYA 5C4XI 5CM2M 4NBEA 2E7ZA 1ML8A 1QYPA 1YHQ1 1VQKZ 1VQ41 2IV2X 3GTOI 2E2II 1VQ9Z 3CME1 1YJWZ 4NBGA 3PO2I 1AA6A 2OTJZ 1YI2Z 1ZH1A 4E2ZA 5AN9F 1I50I 3G71Z 3CCQ1 3JAMb 3G6E1 3M4OI 3GTKI 3CCV1 2M48A 2V8KA 1YIT1 3H0GI 4Y52I 1RNIA 3NH4A 1K732 1KC82 4CL1A 1S7MA 4E31A 3GTGI 3GTQI 1NJI1 1VQL1 4BXXI 1JJ2Y 3CD61 1VQNZ 2QLVB 1RO2A 5D1PA 3IX0A 3I55Z 3VB9A 3EEDA 1M1K2 1WW9A 4E33A 2LFUA 3KIFA 3MZKB 1YJN1 3CXCZ 1X3ZA 3RZDI 1S721 1USPA 4BY7I 2F4OA 3S16I 4Y7NI 2W04A 3I4NI 1VQK1 2V3VA 3RZOI 3D9XA 3MZLB 1VQ71 4RVGA 1I3QI 4RVFA 1VQMZ 1YJW1 3I561 1YI21 5IT9b 3G711 2PMZA 4MD7A 2JMOA 1KD12 1X3WA 3CCEZ 4E32A 2GU2A 2P28A 2WB1A 3P5JB 3S1MI 1VQ51 1JWHC 3CMEZ 2O4HA 3CC4Z 1Q822 1FDIA 1VQN1 4S1TA 3HOZI 3NH5A 1K9M1 5D1OB 2R6MA 3GTMI 1W2BZ 3CCVZ 3D6WA 3MONA 4QTTA 3PO3S 4A3JI 1Q812 2HF1A 1ZB8A 1VQLZ 1K83I 1Q862 1KQSY 4X6AI 2QRDB 3CCS1 4AYBA 3T4NB 3EERA 3J7A4 1QVGZ 2W03A 2M6NA 3S17I 5FLMI 1TWHI 1VQM1 1Q821 1WCMI 2QA4Z 1Z03A 2Y0SA 2LIYA 1M902 1PFTA 4NOZA 3CCE1 2I3CA 3FKII 1VQ7Z 1Q811 3Q87A 2JA5I 4A3DI 5C3EI 3CC41 2YU9I 4E30A 2PM9A 3I56Z 1L1OC 2JA7I 3D2LA 2RHBA 2VPZA 4MONA 3CPWY 2R7ZI 3HOUI 3CCU1 2V8IA 3CC7Z 1VQ5Z 3CCMZ 3CCLZ 2VPWA 1Z01A 1NP6A 1QVFY 3J80f 1SFOI 1Y1VS 2JIQA 1WJ2A 2NVTI 1RO0A 1Y8CA 3LUSA 2H85A 3NDIA 2NVXI 3OW2Y 2QRCB 5T64A 2QA41 4NBAA 2BJOA 1RO4A 1DL6A 5C44I 4NBFA 2AYDA 3GTPI 3VMHA 3CCSZ 3IFUA 4A3II 3HOWI 4E2YA 1K731 5FLXf 1KC81 1TWAI 1N8R2 3QWUA 1JJ2Z 2KI7B 3NH8A 4A93I 4MD9A 4E2WA 1USPB 2P3YA 1M1K1 2R93I 2JS4A 3S2DI 3CC2Z 2Q4ZA 4HGYA 3BG0B 3CC71 3CCM1 3CCL1 5D1OA 4NBCA 1ZB9A 3G4SZ 4NFRA 4MRIA 2QKDA 1Z02A 3TDHB 2V45A 1RLYA 3GTLI 2RPRA 1TWCI 2OTL1 4NBDA 1N8R1 1VQ81 3CCUZ 2VUMI 3KIHA 3J81b 3S14I 4BBSI 2OZKA 2LEXA 3S2HI 1R9TI 1KD11 2O53A 3I07A 3FQMA 5A2Qb 1KRLA 4RVHA 1Y1WI 2G2KA 3J80b 3GTJI 2IZ3A 5C4JI 1YJ91 1P9NA 1N2FA 2RT9A 4MD8A 3CCR1 2J6AA 2B63I 4A3BI 3CC21 2NAPA 1YUKA 3VMGA 2QEXZ 3GCFA 2IZ4A 5LL6f 3GTMS 3G4S1 1Q861 1FDOA 1YUAA 2VUGA 3H3VJ 4NB9A 1YIJZ 1Q16A 1VQO1 2E2JI 1TWFI 4MXUA 4RVDA 5FLXb 1NJI2 2JIPA 3J81f 2R92I 1I6HI 1QF8A 5T67A 2GTHA 2E9HA 2JUBA 5A2Qf 1RQFA 4DGLA 1WZNA 1WIIA 3VMIA 1Q7Y2 3S1NI 3HOYI 3CXCY 1M901 1TWGI 2NVQI 4BY1I 2OTLZ 3CCJ1 1VQ8Z 4HGZA 5IP9I 3TE5B 2QR1B 2Q51A 4DQYB 1X0TA 3IF8A 4RS4A 4A3CI 1VQPZ 1TFIA 3CPWZ 3FQQA 2JA6I 1K8A2 3S1QI 3HOVI 2QEX1 2WAQA 2QREB 4BBRI 2JIMA 1Q7Y1 2K5RA 4NH1C 1QVFZ 3CMAZ 2JR6A 1YJ9Z 1YIJ1 2EGTA 2YADA 4NBHA 2K3RA 3CCRZ 3PO3I 1K9M2 1NUIA 3OW2Z 4A3EI 2F4MA 2HU9A 1W2BY 3I4MI 2JIRA 3IR7A 3JAMf 2PK7A 3F3PC 1VQ91 3S15I 3U50C 2JIOA 1VQ6Z 2OTJ1 3K7AI 1VQOZ 1K8A1 2KPIA 4A3LI 3NDJA 1QVGY 1YHQZ 1VQ4Z 2OOYB 4QTUA 2RIQA 2OOXB 2RBLA 4A3MI 1LQLA 2VPYA 4HH4A 2ZAEB 1SIWA 2DE5A 1VQP1 4NB8A 3CCQZ 2DE6A 4NBBA 5IP7I 3S1RI 3I551 2DE7A 3G6EZ 4DK1A 3GKQA 4A3FI 2AKLA 3HKZA 3CCJZ 1YITZ 4A3KI 4TNUA 3CQZI 3CMA1 3F3FC 3HOXI 3BG1B 3VTNA 3CD6Z 4XX2A 2V8JA 2VPXA 2VF1A 4A3GI 5IT9f 4E2XA 2GTIA 2JA8I 4MH4A 2NVYI 2E2HI 1Y1VI 3M3YI 1QXFA 4EWCA 1KQSZ 4RV9A 1VLAA 1VQ61 1YJNZ 3NFZA 5T6BA 3ESWA 1S72Z
chains in the Genus database with same CATH topology
2JNYA 5C4XI 5CM2M 4NBEA 1ML8A 1QYPA 1YHQ1 1VQKZ 1VQ41 3GTOI 2E2II 1VQ9Z 3CME1 1YJWZ 4NBGA 3PO2I 2OTJZ 1YI2Z 1ZH1A 4E2ZA 5AN9F 1I50I 3G71Z 3CCQ1 3JAMb 3G6E1 3M4OI 3GTKI 3CCV1 2M48A 2V8KA 1YIT1 3H0GI 4Y52I 1RNIA 3NH4A 1K732 1KC82 4CL1A 1S7MA 4E31A 3GTGI 3GTQI 1NJI1 1VQL1 4BXXI 1JJ2Y 3CD61 1VQNZ 2QLVB 1RO2A 5D1PA 3IX0A 3I55Z 3VB9A 3EEDA 1M1K2 1WW9A 4E33A 2LFUA 3KIFA 3MZKB 1YJN1 3CXCZ 1X3ZA 3RZDI 1S721 1USPA 4BY7I 2F4OA 3S16I 4Y7NI 2W04A 3I4NI 1VQK1 3RZOI 3D9XA 3MZLB 1VQ71 4RVGA 1I3QI 4RVFA 1VQMZ 1YJW1 3I561 1YI21 5IT9b 3G711 2PMZA 4MD7A 2JMOA 1KD12 1X3WA 3CCEZ 4E32A 2GU2A 2P28A 2WB1A 3P5JB 3S1MI 1VQ51 1JWHC 3CMEZ 2O4HA 3CC4Z 1Q822 1VQN1 3HOZI 4S1TA 3NH5A 1K9M1 5D1OB 2R6MA 3GTMI 1W2BZ 3CCVZ 3D6WA 3MONA 4QTTA 3PO3S 4A3JI 1Q812 2HF1A 1ZB8A 1VQLZ 1K83I 1Q862 1KQSY 4X6AI 2QRDB 3CCS1 4AYBA 3T4NB 3EERA 3J7A4 1QVGZ 2W03A 2M6NA 3S17I 5FLMI 1TWHI 1VQM1 1Q821 1WCMI 2QA4Z 1Z03A 2Y0SA 2LIYA 1M902 1PFTA 4NOZA 3CCE1 2I3CA 3FKII 1VQ7Z 1Q811 3Q87A 2JA5I 4A3DI 5C3EI 3CC41 2YU9I 4E30A 2PM9A 3I56Z 1L1OC 2JA7I 2RHBA 4MONA 3CPWY 2R7ZI 3HOUI 3CCU1 2V8IA 3CC7Z 1VQ5Z 3CCMZ 3CCLZ 1Z01A 1NP6A 1QVFY 3J80f 1SFOI 1Y1VS 2NVTI 1RO0A 3LUSA 2H85A 3NDIA 2NVXI 3OW2Y 2QRCB 5T64A 2QA41 4NBAA 2BJOA 1RO4A 1DL6A 5C44I 4NBFA 3GTPI 3VMHA 3CCSZ 3IFUA 4A3II 3HOWI 4E2YA 1K731 5FLXf 1KC81 1TWAI 1N8R2 3QWUA 1JJ2Z 2KI7B 3NH8A 4A93I 4MD9A 4E2WA 1USPB 2P3YA 1M1K1 2R93I 2JS4A 3S2DI 3CC2Z 2Q4ZA 4HGYA 3BG0B 3CC71 3CCM1 3CCL1 5D1OA 4NBCA 1ZB9A 3G4SZ 4NFRA 4MRIA 2QKDA 1Z02A 3TDHB 1RLYA 3GTLI 2RPRA 1TWCI 2OTL1 4NBDA 1N8R1 1VQ81 3CCUZ 2VUMI 3KIHA 3J81b 3S14I 4BBSI 2OZKA 3S2HI 1R9TI 1KD11 2O53A 3I07A 3FQMA 5A2Qb 1KRLA 4RVHA 1Y1WI 2G2KA 3J80b 3GTJI 2IZ3A 5C4JI 1YJ91 1P9NA 1N2FA 2RT9A 4MD8A 3CCR1 2J6AA 2B63I 4A3BI 3CC21 1YUKA 3VMGA 2QEXZ 3GCFA 2IZ4A 5LL6f 3GTMS 3G4S1 1Q861 1YUAA 2VUGA 3H3VJ 4NB9A 1YIJZ 1VQO1 2E2JI 1TWFI 4MXUA 4RVDA 5FLXb 1NJI2 3J81f 2R92I 1I6HI 1QF8A 5T67A 2GTHA 2E9HA 2JUBA 5A2Qf 1RQFA 4DGLA 1WIIA 3VMIA 1Q7Y2 3S1NI 3HOYI 3CXCY 1M901 1TWGI 2NVQI 4BY1I 2OTLZ 3CCJ1 1VQ8Z 4HGZA 5IP9I 3TE5B 2QR1B 2Q51A 4DQYB 1X0TA 3IF8A 4RS4A 4A3CI 1VQPZ 1TFIA 3CPWZ 3FQQA 2JA6I 1K8A2 3S1QI 3HOVI 2QEX1 2WAQA 2QREB 4BBRI 1Q7Y1 2K5RA 4NH1C 1QVFZ 3CMAZ 2JR6A 1YJ9Z 1YIJ1 2EGTA 2YADA 4NBHA 2K3RA 3CCRZ 3PO3I 1K9M2 1NUIA 3OW2Z 4A3EI 2F4MA 2HU9A 1W2BY 3I4MI 3JAMf 2PK7A 3F3PC 1VQ91 3S15I 3U50C 1VQ6Z 2OTJ1 3K7AI 1VQOZ 1K8A1 2KPIA 4A3LI 3NDJA 1QVGY 1YHQZ 1VQ4Z 2OOYB 4QTUA 2RIQA 2OOXB 2RBLA 4A3MI 1LQLA 4HH4A 2ZAEB 2DE5A 1VQP1 4NB8A 2DE6A 4NBBA 5IP7I 3CCQZ 3S1RI 3I551 2DE7A 3G6EZ 4DK1A 3GKQA 4A3FI 2AKLA 3HKZA 3CCJZ 1YITZ 4A3KI 4TNUA 3CQZI 3CMA1 3F3FC 3HOXI 3BG1B 3VTNA 3CD6Z 4XX2A 2V8JA 2VF1A 4A3GI 5IT9f 4E2XA 2GTIA 2JA8I 4MH4A 2NVYI 2E2HI 1Y1VI 3M3YI 4EWCA 1KQSZ 4RV9A 1VLAA 1VQ61 1YJNZ 3NFZA 5T6BA 3ESWA 1S72Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLV B;  2QRC B;  2OOX B;  3TDH B;  2QRE B;  3TE5 B;  2QR1 B;  2QRD B;  2OOY B;  3T4N B; 
#chains in the Genus database with same CATH topology
 2JNY A;  5C4X I;  5CM2 M;  4NBE A;  2E7Z A;  1ML8 A;  1QYP A;  1YHQ 1;  1VQK Z;  1VQ4 1;  2IV2 X;  3GTO I;  2E2I I;  1VQ9 Z;  3CME 1;  1YJW Z;  4NBG A;  3PO2 I;  1AA6 A;  2OTJ Z;  1YI2 Z;  1ZH1 A;  4E2Z A;  5AN9 F;  1I50 I;  3G71 Z;  3CCQ 1;  3JAM b;  3G6E 1;  3M4O I;  3GTK I;  3CCV 1;  2M48 A;  2V8K A;  1YIT 1;  3H0G I;  4Y52 I;  1RNI A;  3NH4 A;  1K73 2;  1KC8 2;  4CL1 A;  1S7M A;  4E31 A;  3GTG I;  3GTQ I;  1NJI 1;  1VQL 1;  4BXX I;  1JJ2 Y;  3CD6 1;  1VQN Z;  2QLV B;  1RO2 A;  5D1P A;  3IX0 A;  3I55 Z;  3VB9 A;  3EED A;  1M1K 2;  1WW9 A;  4E33 A;  2LFU A;  3KIF A;  3MZK B;  1YJN 1;  3CXC Z;  1X3Z A;  3RZD I;  1S72 1;  1USP A;  4BY7 I;  2F4O A;  3S16 I;  4Y7N I;  2W04 A;  3I4N I;  1VQK 1;  2V3V A;  3RZO I;  3D9X A;  3MZL B;  1VQ7 1;  4RVG A;  1I3Q I;  4RVF A;  1VQM Z;  1YJW 1;  3I56 1;  1YI2 1;  5IT9 b;  3G71 1;  2PMZ A;  4MD7 A;  2JMO A;  1KD1 2;  1X3W A;  3CCE Z;  4E32 A;  2GU2 A;  2P28 A;  2WB1 A;  3P5J B;  3S1M I;  1VQ5 1;  1JWH C;  3CME Z;  2O4H A;  3CC4 Z;  1Q82 2;  1FDI A;  1VQN 1;  4S1T A;  3HOZ I;  3NH5 A;  1K9M 1;  5D1O B;  2R6M A;  3GTM I;  1W2B Z;  3CCV Z;  3D6W A;  3MON A;  4QTT A;  3PO3 S;  4A3J I;  1Q81 2;  2HF1 A;  1ZB8 A;  1VQL Z;  1K83 I;  1Q86 2;  1KQS Y;  4X6A I;  2QRD B;  3CCS 1;  4AYB A;  3T4N B;  3EER A;  3J7A 4;  1QVG Z;  2W03 A;  2M6N A;  3S17 I;  5FLM I;  1TWH I;  1VQM 1;  1Q82 1;  1WCM I;  2QA4 Z;  1Z03 A;  2Y0S A;  2LIY A;  1M90 2;  1PFT A;  4NOZ A;  3CCE 1;  2I3C A;  3FKI I;  1VQ7 Z;  1Q81 1;  3Q87 A;  2JA5 I;  4A3D I;  5C3E I;  3CC4 1;  2YU9 I;  4E30 A;  2PM9 A;  3I56 Z;  1L1O C;  2JA7 I;  3D2L A;  2RHB A;  2VPZ A;  4MON A;  3CPW Y;  2R7Z I;  3HOU I;  3CCU 1;  2V8I A;  3CC7 Z;  1VQ5 Z;  3CCM Z;  3CCL Z;  2VPW A;  1Z01 A;  1NP6 A;  1QVF Y;  3J80 f;  1SFO I;  1Y1V S;  2JIQ A;  1WJ2 A;  2NVT I;  1RO0 A;  1Y8C A;  3LUS A;  2H85 A;  3NDI A;  2NVX I;  3OW2 Y;  2QRC B;  5T64 A;  2QA4 1;  4NBA A;  2BJO A;  1RO4 A;  1DL6 A;  5C44 I;  4NBF A;  2AYD A;  3GTP I;  3VMH A;  3CCS Z;  3IFU A;  4A3I I;  3HOW I;  4E2Y A;  1K73 1;  5FLX f;  1KC8 1;  1TWA I;  1N8R 2;  3QWU A;  1JJ2 Z;  2KI7 B;  3NH8 A;  4A93 I;  4MD9 A;  4E2W A;  1USP B;  2P3Y A;  1M1K 1;  2R93 I;  2JS4 A;  3S2D I;  3CC2 Z;  2Q4Z A;  4HGY A;  3BG0 B;  3CC7 1;  3CCM 1;  3CCL 1;  5D1O A;  4NBC A;  1ZB9 A;  3G4S Z;  4NFR A;  4MRI A;  2QKD A;  1Z02 A;  3TDH B;  2V45 A;  1RLY A;  3GTL I;  2RPR A;  1TWC I;  2OTL 1;  4NBD A;  1N8R 1;  1VQ8 1;  3CCU Z;  2VUM I;  3KIH A;  3J81 b;  3S14 I;  4BBS I;  2OZK A;  2LEX A;  3S2H I;  1R9T I;  1KD1 1;  2O53 A;  3I07 A;  3FQM A;  5A2Q b;  1KRL A;  4RVH A;  1Y1W I;  2G2K A;  3J80 b;  3GTJ I;  2IZ3 A;  5C4J I;  1YJ9 1;  1P9N A;  1N2F A;  2RT9 A;  4MD8 A;  3CCR 1;  2J6A A;  2B63 I;  4A3B I;  3CC2 1;  2NAP A;  1YUK A;  3VMG A;  2QEX Z;  3GCF A;  2IZ4 A;  5LL6 f;  3GTM S;  3G4S 1;  1Q86 1;  1FDO A;  1YUA A;  2VUG A;  3H3V J;  4NB9 A;  1YIJ Z;  1Q16 A;  1VQO 1;  2E2J I;  1TWF I;  4MXU A;  4RVD A;  5FLX b;  1NJI 2;  2JIP A;  3J81 f;  2R92 I;  1I6H I;  1QF8 A;  5T67 A;  2GTH A;  2E9H A;  2JUB A;  5A2Q f;  1RQF A;  4DGL A;  1WZN A;  1WII A;  3VMI A;  1Q7Y 2;  3S1N I;  3HOY I;  3CXC Y;  1M90 1;  1TWG I;  2NVQ I;  4BY1 I;  2OTL Z;  3CCJ 1;  1VQ8 Z;  4HGZ A;  5IP9 I;  3TE5 B;  2QR1 B;  2Q51 A;  4DQY B;  1X0T A;  3IF8 A;  4RS4 A;  4A3C I;  1VQP Z;  1TFI A;  3CPW Z;  3FQQ A;  2JA6 I;  1K8A 2;  3S1Q I;  3HOV I;  2QEX 1;  2WAQ A;  2QRE B;  4BBR I;  2JIM A;  1Q7Y 1;  2K5R A;  4NH1 C;  1QVF Z;  3CMA Z;  2JR6 A;  1YJ9 Z;  1YIJ 1;  2EGT A;  2YAD A;  4NBH A;  2K3R A;  3CCR Z;  3PO3 I;  1K9M 2;  1NUI A;  3OW2 Z;  4A3E I;  2F4M A;  2HU9 A;  1W2B Y;  3I4M I;  2JIR A;  3IR7 A;  3JAM f;  2PK7 A;  3F3P C;  1VQ9 1;  3S15 I;  3U50 C;  2JIO A;  1VQ6 Z;  2OTJ 1;  3K7A I;  1VQO Z;  1K8A 1;  2KPI A;  4A3L I;  3NDJ A;  1QVG Y;  1YHQ Z;  1VQ4 Z;  2OOY B;  4QTU A;  2RIQ A;  2OOX B;  2RBL A;  4A3M I;  1LQL A;  2VPY A;  4HH4 A;  2ZAE B;  1SIW A;  2DE5 A;  1VQP 1;  4NB8 A;  3CCQ Z;  2DE6 A;  4NBB A;  5IP7 I;  3S1R I;  3I55 1;  2DE7 A;  3G6E Z;  4DK1 A;  3GKQ A;  4A3F I;  2AKL A;  3HKZ A;  3CCJ Z;  1YIT Z;  4A3K I;  4TNU A;  3CQZ I;  3CMA 1;  3F3F C;  3HOX I;  3BG1 B;  3VTN A;  3CD6 Z;  4XX2 A;  2V8J A;  2VPX A;  2VF1 A;  4A3G I;  5IT9 f;  4E2X A;  2GTI A;  2JA8 I;  4MH4 A;  2NVY I;  2E2H I;  1Y1V I;  3M3Y I;  1QXF A;  4EWC A;  1KQS Z;  4RV9 A;  1VLA A;  1VQ6 1;  1YJN Z;  3NFZ A;  5T6B A;  3ESW A;  1S72 Z; 
#chains in the Genus database with same CATH homology
 2JNY A;  5C4X I;  5CM2 M;  4NBE A;  1ML8 A;  1QYP A;  1YHQ 1;  1VQK Z;  1VQ4 1;  3GTO I;  2E2I I;  1VQ9 Z;  3CME 1;  1YJW Z;  4NBG A;  3PO2 I;  2OTJ Z;  1YI2 Z;  1ZH1 A;  4E2Z A;  5AN9 F;  1I50 I;  3G71 Z;  3CCQ 1;  3JAM b;  3G6E 1;  3M4O I;  3GTK I;  3CCV 1;  2M48 A;  2V8K A;  1YIT 1;  3H0G I;  4Y52 I;  1RNI A;  3NH4 A;  1K73 2;  1KC8 2;  4CL1 A;  1S7M A;  4E31 A;  3GTG I;  3GTQ I;  1NJI 1;  1VQL 1;  4BXX I;  1JJ2 Y;  3CD6 1;  1VQN Z;  2QLV B;  1RO2 A;  5D1P A;  3IX0 A;  3I55 Z;  3VB9 A;  3EED A;  1M1K 2;  1WW9 A;  4E33 A;  2LFU A;  3KIF A;  3MZK B;  1YJN 1;  3CXC Z;  1X3Z A;  3RZD I;  1S72 1;  1USP A;  4BY7 I;  2F4O A;  3S16 I;  4Y7N I;  2W04 A;  3I4N I;  1VQK 1;  3RZO I;  3D9X A;  3MZL B;  1VQ7 1;  4RVG A;  1I3Q I;  4RVF A;  1VQM Z;  1YJW 1;  3I56 1;  1YI2 1;  5IT9 b;  3G71 1;  2PMZ A;  4MD7 A;  2JMO A;  1KD1 2;  1X3W A;  3CCE Z;  4E32 A;  2GU2 A;  2P28 A;  2WB1 A;  3P5J B;  3S1M I;  1VQ5 1;  1JWH C;  3CME Z;  2O4H A;  3CC4 Z;  1Q82 2;  1VQN 1;  3HOZ I;  4S1T A;  3NH5 A;  1K9M 1;  5D1O B;  2R6M A;  3GTM I;  1W2B Z;  3CCV Z;  3D6W A;  3MON A;  4QTT A;  3PO3 S;  4A3J I;  1Q81 2;  2HF1 A;  1ZB8 A;  1VQL Z;  1K83 I;  1Q86 2;  1KQS Y;  4X6A I;  2QRD B;  3CCS 1;  4AYB A;  3T4N B;  3EER A;  3J7A 4;  1QVG Z;  2W03 A;  2M6N A;  3S17 I;  5FLM I;  1TWH I;  1VQM 1;  1Q82 1;  1WCM I;  2QA4 Z;  1Z03 A;  2Y0S A;  2LIY A;  1M90 2;  1PFT A;  4NOZ A;  3CCE 1;  2I3C A;  3FKI I;  1VQ7 Z;  1Q81 1;  3Q87 A;  2JA5 I;  4A3D I;  5C3E I;  3CC4 1;  2YU9 I;  4E30 A;  2PM9 A;  3I56 Z;  1L1O C;  2JA7 I;  2RHB A;  4MON A;  3CPW Y;  2R7Z I;  3HOU I;  3CCU 1;  2V8I A;  3CC7 Z;  1VQ5 Z;  3CCM Z;  3CCL Z;  1Z01 A;  1NP6 A;  1QVF Y;  3J80 f;  1SFO I;  1Y1V S;  2NVT I;  1RO0 A;  3LUS A;  2H85 A;  3NDI A;  2NVX I;  3OW2 Y;  2QRC B;  5T64 A;  2QA4 1;  4NBA A;  2BJO A;  1RO4 A;  1DL6 A;  5C44 I;  4NBF A;  3GTP I;  3VMH A;  3CCS Z;  3IFU A;  4A3I I;  3HOW I;  4E2Y A;  1K73 1;  5FLX f;  1KC8 1;  1TWA I;  1N8R 2;  3QWU A;  1JJ2 Z;  2KI7 B;  3NH8 A;  4A93 I;  4MD9 A;  4E2W A;  1USP B;  2P3Y A;  1M1K 1;  2R93 I;  2JS4 A;  3S2D I;  3CC2 Z;  2Q4Z A;  4HGY A;  3BG0 B;  3CC7 1;  3CCM 1;  3CCL 1;  5D1O A;  4NBC A;  1ZB9 A;  3G4S Z;  4NFR A;  4MRI A;  2QKD A;  1Z02 A;  3TDH B;  1RLY A;  3GTL I;  2RPR A;  1TWC I;  2OTL 1;  4NBD A;  1N8R 1;  1VQ8 1;  3CCU Z;  2VUM I;  3KIH A;  3J81 b;  3S14 I;  4BBS I;  2OZK A;  3S2H I;  1R9T I;  1KD1 1;  2O53 A;  3I07 A;  3FQM A;  5A2Q b;  1KRL A;  4RVH A;  1Y1W I;  2G2K A;  3J80 b;  3GTJ I;  2IZ3 A;  5C4J I;  1YJ9 1;  1P9N A;  1N2F A;  2RT9 A;  4MD8 A;  3CCR 1;  2J6A A;  2B63 I;  4A3B I;  3CC2 1;  1YUK A;  3VMG A;  2QEX Z;  3GCF A;  2IZ4 A;  5LL6 f;  3GTM S;  3G4S 1;  1Q86 1;  1YUA A;  2VUG A;  3H3V J;  4NB9 A;  1YIJ Z;  1VQO 1;  2E2J I;  1TWF I;  4MXU A;  4RVD A;  5FLX b;  1NJI 2;  3J81 f;  2R92 I;  1I6H I;  1QF8 A;  5T67 A;  2GTH A;  2E9H A;  2JUB A;  5A2Q f;  1RQF A;  4DGL A;  1WII A;  3VMI A;  1Q7Y 2;  3S1N I;  3HOY I;  3CXC Y;  1M90 1;  1TWG I;  2NVQ I;  4BY1 I;  2OTL Z;  3CCJ 1;  1VQ8 Z;  4HGZ A;  5IP9 I;  3TE5 B;  2QR1 B;  2Q51 A;  4DQY B;  1X0T A;  3IF8 A;  4RS4 A;  4A3C I;  1VQP Z;  1TFI A;  3CPW Z;  3FQQ A;  2JA6 I;  1K8A 2;  3S1Q I;  3HOV I;  2QEX 1;  2WAQ A;  2QRE B;  4BBR I;  1Q7Y 1;  2K5R A;  4NH1 C;  1QVF Z;  3CMA Z;  2JR6 A;  1YJ9 Z;  1YIJ 1;  2EGT A;  2YAD A;  4NBH A;  2K3R A;  3CCR Z;  3PO3 I;  1K9M 2;  1NUI A;  3OW2 Z;  4A3E I;  2F4M A;  2HU9 A;  1W2B Y;  3I4M I;  3JAM f;  2PK7 A;  3F3P C;  1VQ9 1;  3S15 I;  3U50 C;  1VQ6 Z;  2OTJ 1;  3K7A I;  1VQO Z;  1K8A 1;  2KPI A;  4A3L I;  3NDJ A;  1QVG Y;  1YHQ Z;  1VQ4 Z;  2OOY B;  4QTU A;  2RIQ A;  2OOX B;  2RBL A;  4A3M I;  1LQL A;  4HH4 A;  2ZAE B;  2DE5 A;  1VQP 1;  4NB8 A;  2DE6 A;  4NBB A;  5IP7 I;  3CCQ Z;  3S1R I;  3I55 1;  2DE7 A;  3G6E Z;  4DK1 A;  3GKQ A;  4A3F I;  2AKL A;  3HKZ A;  3CCJ Z;  1YIT Z;  4A3K I;  4TNU A;  3CQZ I;  3CMA 1;  3F3F C;  3HOX I;  3BG1 B;  3VTN A;  3CD6 Z;  4XX2 A;  2V8J A;  2VF1 A;  4A3G I;  5IT9 f;  4E2X A;  2GTI A;  2JA8 I;  4MH4 A;  2NVY I;  2E2H I;  1Y1V I;  3M3Y I;  4EWC A;  1KQS Z;  4RV9 A;  1VLA A;  1VQ6 1;  1YJN Z;  3NFZ A;  5T6B A;  3ESW A;  1S72 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...