3TE5B

Structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with nadh
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
111
structure length
103
Chain Sequence
MEYTTDIPAVFTDPSVMERYYYTLTSWLTPPQLPPQLENVILNKYYATQDQFNENNSGALPIPNHVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 103
sequence length 111
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3te5B01
3T4NB 3TE5B 2OOXB 2QREB 2OOYB 2QR1B 3TDHB 2QRCB 2QLVB 2QRDB
chains in the Genus database with same CATH superfamily
2F4MA 2IZ4A 2VPWA 1VQM1 1I3QI 5IT9b 1YJWZ 2DE5A 2YU9I 4A3LI 2QLVB 1YUKA 5T6BA 3G71Z 1M902 3CD61 1VQO1 2V45A 2GTHA 4HGZA 5LL6f 1ZB9A 1VQ6Z 5D1OB 2H85A 1SIWA 3HOZI 1JWHC 2OTJZ 3CCJ1 3IX0A 1P9NA 3VB9A 1VQN1 4BY7I 4A93I 2VF1A 1I50I 3FKII 5C3EI 3CCEZ 3CCQZ 2RHBA 3NH5A 4A3JI 1PFTA 2JIOA 1Q822 2KPIA 2R93I 4RVFA 2E9HA 2E2HI 3OW2Z 3MZLB 2E2II 2JA7I 5T67A 2F4OA 3QWUA 1Y8CA 1YJ91 1VQ71 3T4NB 3KIFA 3NDJA 3U50C 1K9M1 3RZDI 5T64A 4BXXI 4TNUA 4MD7A 1KC81 3FQQA 1S72Z 1DL6A 2AKLA 2Q51A 1VQL1 3ESWA 1WW9A 3CCLZ 1TWHI 2JUBA 2JIPA 3GTPI 3S2DI 1NJI1 3CMA1 2QA41 4MD9A 3BG1B 1S7MA 1USPA 5IP7I 2J6AA 1Y1WI 4MH4A 3GTMS 4MD8A 2JA5I 3MZKB 3VMHA 2HU9A 3NFZA 4XX2A 3PO3S 1TWGI 1VQMZ 4A3EI 3CQZI 4QTTA 3CCM1 1WCMI 4A3CI 2OOXB 1M901 1VQ81 3S16I 3CD6Z 1VQOZ 1K83I 3S1RI 1AA6A 4RVDA 2NVTI 2PMZA 3D6WA 2W03A 1L1OC 3CPWZ 1QF8A 2E7ZA 1NP6A 3CCJZ 1YI21 2O4HA 3BG0B 1VQNZ 3HOXI 4NBGA 1KD11 3NH4A 1NUIA 3Q87A 4E30A 3F3FC 1JJ2Y 1QVFY 3OW2Y 3CCV1 4A3KI 1Q821 2IV2X 2VUMI 3VMGA 3M4OI 3CXCZ 1QVGY 4NBHA 4E2WA 1K732 4A3BI 3EERA 1YJ9Z 4MXUA 1N8R2 1QXFA 1YIT1 5A2Qf 3JAMf 3I07A 3PO2I 1Q16A 4NBBA 4NBFA 1VQ4Z 1VQLZ 2JS4A 2P3YA 2JIRA 1W2BZ 2JIQA 4E2XA 2BJOA 1KQSZ 3HOWI 3JAMb 3CMAZ 3CCR1 1KD12 2QA4Z 1Y1VI 1RO0A 3IFUA 5C4XI 4QTUA 1Q862 4RV9A 5D1PA 1Z03A 3I4MI 3CCS1 4NOZA 3GTMI 1YHQ1 4HGYA 3CCMZ 3PO3I 2RT9A 2NVYI 1ZH1A 4NFRA 3GTOI 1VQ8Z 2ZAEB 3NH8A 3GTQI 3GTGI 2QRCB 4E32A 5FLMI 2QEX1 1VQ51 4NBDA 1TFIA 2IZ3A 2GTIA 1USPB 4BBRI 5FLXf 3P5JB 4A3GI 2QR1B 2YADA 1VQP1 4NH1C 3S17I 3K7AI 3J81f 4NBEA 1YI2Z 3G711 2E2JI 5C44I 1YJN1 2JMOA 3FQMA 2Y0SA 2OOYB 1K8A2 3HOUI 3CCVZ 1WIIA 1M1K2 1X3WA 3S15I 2G2KA 2OTJ1 2JA6I 4NBCA 4NB9A 1K731 2VPYA 3MONA 3CC71 3S1QI 2V3VA 1N8R1 2OTL1 2V8JA 1TWCI 1Z02A 3RZOI 2P28A 1LQLA 1Z01A 2DE6A 2EGTA 1YITZ 1Q7Y2 2RBLA 2WAQA 1RO2A 1QYPA 3KIHA 1VQK1 5IP9I 4Y52I 2R92I 2LIYA 2JIMA 1TWAI 3I561 1WZNA 1ML8A 4DK1A 2JA8I 3S14I 1VLAA 2OZKA 3CCRZ 1YUAA 4EWCA 1Q861 2RIQA 2QREB 3J7A4 4E31A 1SFOI 2NVXI 1ZB8A 4MONA 2R6MA 3NDIA 1YHQZ 3D2LA 2KI7B 1R9TI 3S2HI 3CC41 3HKZA 4MRIA 5IT9f 3VMIA 4DGLA 1VQ7Z 3CCU1 4CL1A 1YIJ1 3F3PC 3IF8A 3CC21 3VTNA 2QEXZ 4A3DI 3HOVI 2Q4ZA 4A3MI 5C4JI 2W04A 4A3FI 1VQPZ 5A2Qb 2JNYA 3I551 3TE5B 4BY1I 3G4S1 1YJNZ 1K8A1 1TWFI 1KRLA 2WB1A 1RLYA 1FDOA 1M1K1 3H0GI 2GU2A 4E2YA 1Q812 3GKQA 4E33A 2R7ZI 2K3RA 2O53A 1FDIA 2M6NA 2VUGA 3CC7Z 2NVQI 3CPWY 3TDHB 4A3II 1VQ91 2OTLZ 1RQFA 2HF1A 3G6E1 1Q7Y1 5D1OA 3D9XA 3CME1 2LFUA 3GCFA 2VPXA 4RVGA 2LEXA 1JJ2Z 3IR7A 1VQKZ 4X6AI 1YJW1 3GTLI 1QVFZ 3M3YI 3I56Z 4HH4A 2VPZA 4S1TA 4Y7NI 3I4NI 3LUSA 3CXCY 2DE7A 1WJ2A 1QVGZ 2NAPA 5FLXb 5AN9F 2V8KA 1RNIA 1VQ61 3J81b 4DQYB 3H3VJ 1VQ41 5CM2M 3HOYI 1Y1VS 3CC4Z 2QRDB 3CCE1 3CCQ1 3CCUZ 1YIJZ 1W2BY 2B63I 3J80f 3CC2Z 1KQSY 4BBSI 2RPRA 1X0TA 1RO4A 4NBAA 2QKDA 2PK7A 2I3CA 2V8IA 3S1NI 2PM9A 3J80b 4AYBA 2M48A 4RVHA 3I55Z 3G4SZ 3GTJI 1Q811 1K9M2 1S721 1I6HI 3S1MI 3CCL1 1KC82 3CCSZ 4E2ZA 3EEDA 4RS4A 1N2FA 4NB8A 1NJI2 2JR6A 1VQ9Z 3G6EZ 2AYDA 2K5RA 3GTKI 1X3ZA 1VQ5Z 3CMEZ
chains in the Genus database with same CATH topology
2F4MA 2IZ4A 1VQM1 1I3QI 5IT9b 1YJWZ 2DE5A 2YU9I 4A3LI 2QLVB 1YUKA 5T6BA 3G71Z 1M902 3CD61 1VQO1 2GTHA 4HGZA 5LL6f 1ZB9A 1VQ6Z 5D1OB 2H85A 3HOZI 1JWHC 2OTJZ 3CCJ1 3IX0A 1P9NA 3VB9A 1VQN1 4BY7I 4A93I 2VF1A 1I50I 3FKII 5C3EI 3CCEZ 3CCQZ 2RHBA 3NH5A 4A3JI 1PFTA 1Q822 2KPIA 2R93I 4RVFA 2E9HA 2E2HI 3OW2Z 3MZLB 2E2II 2JA7I 5T67A 2F4OA 3QWUA 1YJ91 1VQ71 3T4NB 3KIFA 3NDJA 3U50C 1K9M1 3RZDI 5T64A 4BXXI 4TNUA 4MD7A 1KC81 3FQQA 1S72Z 1DL6A 2AKLA 2Q51A 1VQL1 3ESWA 1WW9A 3CCLZ 1TWHI 2JUBA 3GTPI 3S2DI 1NJI1 3CMA1 2QA41 4MD9A 3BG1B 1S7MA 1USPA 5IP7I 2J6AA 1Y1WI 4MH4A 3GTMS 4MD8A 2JA5I 3MZKB 3VMHA 2HU9A 3NFZA 4XX2A 3PO3S 1TWGI 1VQMZ 4A3EI 3CQZI 4QTTA 3CCM1 1WCMI 4A3CI 2OOXB 1M901 1VQ81 3S16I 3CD6Z 1VQOZ 1K83I 3S1RI 4RVDA 2NVTI 2PMZA 3D6WA 2W03A 1L1OC 3CPWZ 1QF8A 1NP6A 3CCJZ 1YI21 2O4HA 3BG0B 1VQNZ 3HOXI 4NBGA 1KD11 3NH4A 1NUIA 3Q87A 4E30A 3F3FC 1JJ2Y 1QVFY 3OW2Y 3CCV1 4A3KI 1Q821 2VUMI 3VMGA 3M4OI 3CXCZ 1QVGY 4NBHA 4E2WA 1K732 4A3BI 3EERA 1YJ9Z 4MXUA 1N8R2 1YIT1 5A2Qf 3JAMf 3I07A 3PO2I 4NBBA 4NBFA 1VQ4Z 1VQLZ 2JS4A 2P3YA 1W2BZ 4E2XA 2BJOA 1KQSZ 3HOWI 3JAMb 3CMAZ 3CCR1 1KD12 2QA4Z 1Y1VI 1RO0A 3IFUA 5C4XI 4QTUA 1Q862 4RV9A 5D1PA 1Z03A 3I4MI 3CCS1 4NOZA 3GTMI 1YHQ1 4HGYA 3CCMZ 3PO3I 2RT9A 2NVYI 1ZH1A 4NFRA 3GTOI 1VQ8Z 2ZAEB 3NH8A 3GTQI 3GTGI 2QRCB 4E32A 1VQ51 5FLMI 2QEX1 4NBDA 1TFIA 2IZ3A 2GTIA 1USPB 4BBRI 5FLXf 3P5JB 4A3GI 2QR1B 2YADA 1VQP1 4NH1C 3S17I 3K7AI 3J81f 4NBEA 1YI2Z 3G711 2E2JI 5C44I 1YJN1 2JMOA 3FQMA 2Y0SA 2OOYB 1K8A2 3HOUI 3CCVZ 1WIIA 1M1K2 1X3WA 3S15I 2G2KA 2OTJ1 2JA6I 4NBCA 4NB9A 1K731 3MONA 3CC71 3S1QI 1N8R1 2OTL1 2V8JA 1TWCI 1Z02A 3RZOI 2P28A 1LQLA 1Z01A 2DE6A 2EGTA 1YITZ 1Q7Y2 2RBLA 2WAQA 1RO2A 1QYPA 3KIHA 1VQK1 5IP9I 4Y52I 2R92I 2LIYA 1TWAI 3I561 1ML8A 4DK1A 2JA8I 3S14I 1VLAA 2OZKA 3CCRZ 1YUAA 4EWCA 1Q861 2RIQA 2QREB 3J7A4 4E31A 1SFOI 2NVXI 1ZB8A 4MONA 2R6MA 3NDIA 1YHQZ 2KI7B 1R9TI 3S2HI 3CC41 3HKZA 4MRIA 5IT9f 3VMIA 4DGLA 1VQ7Z 3CCU1 4CL1A 1YIJ1 3F3PC 3IF8A 3CC21 3VTNA 2QEXZ 4A3DI 3HOVI 2Q4ZA 4A3MI 5C4JI 2W04A 4A3FI 1VQPZ 5A2Qb 2JNYA 3I551 3TE5B 4BY1I 3G4S1 1YJNZ 1K8A1 1TWFI 1KRLA 2WB1A 1RLYA 1M1K1 3H0GI 2GU2A 4E2YA 1Q812 3GKQA 4E33A 2R7ZI 2K3RA 2O53A 2M6NA 2VUGA 3CC7Z 2NVQI 3CPWY 3TDHB 4A3II 1VQ91 2OTLZ 1RQFA 2HF1A 3G6E1 1Q7Y1 5D1OA 3D9XA 3CME1 2LFUA 3GCFA 4RVGA 1JJ2Z 1VQKZ 4X6AI 1YJW1 3GTLI 1QVFZ 3M3YI 3I56Z 4HH4A 4S1TA 4Y7NI 3I4NI 3LUSA 3CXCY 2DE7A 1QVGZ 5FLXb 5AN9F 2V8KA 1RNIA 1VQ61 3J81b 4DQYB 3H3VJ 1VQ41 5CM2M 3HOYI 1Y1VS 3CC4Z 2QRDB 3CCE1 3CCQ1 3CCUZ 1YIJZ 1W2BY 2B63I 3J80f 3CC2Z 1KQSY 4BBSI 2RPRA 1X0TA 1RO4A 4NBAA 2QKDA 2PK7A 2I3CA 2V8IA 3S1NI 2PM9A 3J80b 4AYBA 2M48A 4RVHA 3I55Z 3G4SZ 3GTJI 1Q811 1K9M2 1S721 1I6HI 3S1MI 3CCL1 1KC82 3CCSZ 4E2ZA 3EEDA 4RS4A 1N2FA 4NB8A 1NJI2 2JR6A 1VQ9Z 3G6EZ 2K5RA 3GTKI 1X3ZA 1VQ5Z 3CMEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4N B;  3TE5 B;  2OOX B;  2QRE B;  2OOY B;  2QR1 B;  3TDH B;  2QRC B;  2QLV B;  2QRD B; 
#chains in the Genus database with same CATH topology
 2F4M A;  2IZ4 A;  2VPW A;  1VQM 1;  1I3Q I;  5IT9 b;  1YJW Z;  2DE5 A;  2YU9 I;  4A3L I;  2QLV B;  1YUK A;  5T6B A;  3G71 Z;  1M90 2;  3CD6 1;  1VQO 1;  2V45 A;  2GTH A;  4HGZ A;  5LL6 f;  1ZB9 A;  1VQ6 Z;  5D1O B;  2H85 A;  1SIW A;  3HOZ I;  1JWH C;  2OTJ Z;  3CCJ 1;  3IX0 A;  1P9N A;  3VB9 A;  1VQN 1;  4BY7 I;  4A93 I;  2VF1 A;  1I50 I;  3FKI I;  5C3E I;  3CCE Z;  3CCQ Z;  2RHB A;  3NH5 A;  4A3J I;  1PFT A;  2JIO A;  1Q82 2;  2KPI A;  2R93 I;  4RVF A;  2E9H A;  2E2H I;  3OW2 Z;  3MZL B;  2E2I I;  2JA7 I;  5T67 A;  2F4O A;  3QWU A;  1Y8C A;  1YJ9 1;  1VQ7 1;  3T4N B;  3KIF A;  3NDJ A;  3U50 C;  1K9M 1;  3RZD I;  5T64 A;  4BXX I;  4TNU A;  4MD7 A;  1KC8 1;  3FQQ A;  1S72 Z;  1DL6 A;  2AKL A;  2Q51 A;  1VQL 1;  3ESW A;  1WW9 A;  3CCL Z;  1TWH I;  2JUB A;  2JIP A;  3GTP I;  3S2D I;  1NJI 1;  3CMA 1;  2QA4 1;  4MD9 A;  3BG1 B;  1S7M A;  1USP A;  5IP7 I;  2J6A A;  1Y1W I;  4MH4 A;  3GTM S;  4MD8 A;  2JA5 I;  3MZK B;  3VMH A;  2HU9 A;  3NFZ A;  4XX2 A;  3PO3 S;  1TWG I;  1VQM Z;  4A3E I;  3CQZ I;  4QTT A;  3CCM 1;  1WCM I;  4A3C I;  2OOX B;  1M90 1;  1VQ8 1;  3S16 I;  3CD6 Z;  1VQO Z;  1K83 I;  3S1R I;  1AA6 A;  4RVD A;  2NVT I;  2PMZ A;  3D6W A;  2W03 A;  1L1O C;  3CPW Z;  1QF8 A;  2E7Z A;  1NP6 A;  3CCJ Z;  1YI2 1;  2O4H A;  3BG0 B;  1VQN Z;  3HOX I;  4NBG A;  1KD1 1;  3NH4 A;  1NUI A;  3Q87 A;  4E30 A;  3F3F C;  1JJ2 Y;  1QVF Y;  3OW2 Y;  3CCV 1;  4A3K I;  1Q82 1;  2IV2 X;  2VUM I;  3VMG A;  3M4O I;  3CXC Z;  1QVG Y;  4NBH A;  4E2W A;  1K73 2;  4A3B I;  3EER A;  1YJ9 Z;  4MXU A;  1N8R 2;  1QXF A;  1YIT 1;  5A2Q f;  3JAM f;  3I07 A;  3PO2 I;  1Q16 A;  4NBB A;  4NBF A;  1VQ4 Z;  1VQL Z;  2JS4 A;  2P3Y A;  2JIR A;  1W2B Z;  2JIQ A;  4E2X A;  2BJO A;  1KQS Z;  3HOW I;  3JAM b;  3CMA Z;  3CCR 1;  1KD1 2;  2QA4 Z;  1Y1V I;  1RO0 A;  3IFU A;  5C4X I;  4QTU A;  1Q86 2;  4RV9 A;  5D1P A;  1Z03 A;  3I4M I;  3CCS 1;  4NOZ A;  3GTM I;  1YHQ 1;  4HGY A;  3CCM Z;  3PO3 I;  2RT9 A;  2NVY I;  1ZH1 A;  4NFR A;  3GTO I;  1VQ8 Z;  2ZAE B;  3NH8 A;  3GTQ I;  3GTG I;  2QRC B;  4E32 A;  5FLM I;  2QEX 1;  1VQ5 1;  4NBD A;  1TFI A;  2IZ3 A;  2GTI A;  1USP B;  4BBR I;  5FLX f;  3P5J B;  4A3G I;  2QR1 B;  2YAD A;  1VQP 1;  4NH1 C;  3S17 I;  3K7A I;  3J81 f;  4NBE A;  1YI2 Z;  3G71 1;  2E2J I;  5C44 I;  1YJN 1;  2JMO A;  3FQM A;  2Y0S A;  2OOY B;  1K8A 2;  3HOU I;  3CCV Z;  1WII A;  1M1K 2;  1X3W A;  3S15 I;  2G2K A;  2OTJ 1;  2JA6 I;  4NBC A;  4NB9 A;  1K73 1;  2VPY A;  3MON A;  3CC7 1;  3S1Q I;  2V3V A;  1N8R 1;  2OTL 1;  2V8J A;  1TWC I;  1Z02 A;  3RZO I;  2P28 A;  1LQL A;  1Z01 A;  2DE6 A;  2EGT A;  1YIT Z;  1Q7Y 2;  2RBL A;  2WAQ A;  1RO2 A;  1QYP A;  3KIH A;  1VQK 1;  5IP9 I;  4Y52 I;  2R92 I;  2LIY A;  2JIM A;  1TWA I;  3I56 1;  1WZN A;  1ML8 A;  4DK1 A;  2JA8 I;  3S14 I;  1VLA A;  2OZK A;  3CCR Z;  1YUA A;  4EWC A;  1Q86 1;  2RIQ A;  2QRE B;  3J7A 4;  4E31 A;  1SFO I;  2NVX I;  1ZB8 A;  4MON A;  2R6M A;  3NDI A;  1YHQ Z;  3D2L A;  2KI7 B;  1R9T I;  3S2H I;  3CC4 1;  3HKZ A;  4MRI A;  5IT9 f;  3VMI A;  4DGL A;  1VQ7 Z;  3CCU 1;  4CL1 A;  1YIJ 1;  3F3P C;  3IF8 A;  3CC2 1;  3VTN A;  2QEX Z;  4A3D I;  3HOV I;  2Q4Z A;  4A3M I;  5C4J I;  2W04 A;  4A3F I;  1VQP Z;  5A2Q b;  2JNY A;  3I55 1;  3TE5 B;  4BY1 I;  3G4S 1;  1YJN Z;  1K8A 1;  1TWF I;  1KRL A;  2WB1 A;  1RLY A;  1FDO A;  1M1K 1;  3H0G I;  2GU2 A;  4E2Y A;  1Q81 2;  3GKQ A;  4E33 A;  2R7Z I;  2K3R A;  2O53 A;  1FDI A;  2M6N A;  2VUG A;  3CC7 Z;  2NVQ I;  3CPW Y;  3TDH B;  4A3I I;  1VQ9 1;  2OTL Z;  1RQF A;  2HF1 A;  3G6E 1;  1Q7Y 1;  5D1O A;  3D9X A;  3CME 1;  2LFU A;  3GCF A;  2VPX A;  4RVG A;  2LEX A;  1JJ2 Z;  3IR7 A;  1VQK Z;  4X6A I;  1YJW 1;  3GTL I;  1QVF Z;  3M3Y I;  3I56 Z;  4HH4 A;  2VPZ A;  4S1T A;  4Y7N I;  3I4N I;  3LUS A;  3CXC Y;  2DE7 A;  1WJ2 A;  1QVG Z;  2NAP A;  5FLX b;  5AN9 F;  2V8K A;  1RNI A;  1VQ6 1;  3J81 b;  4DQY B;  3H3V J;  1VQ4 1;  5CM2 M;  3HOY I;  1Y1V S;  3CC4 Z;  2QRD B;  3CCE 1;  3CCQ 1;  3CCU Z;  1YIJ Z;  1W2B Y;  2B63 I;  3J80 f;  3CC2 Z;  1KQS Y;  4BBS I;  2RPR A;  1X0T A;  1RO4 A;  4NBA A;  2QKD A;  2PK7 A;  2I3C A;  2V8I A;  3S1N I;  2PM9 A;  3J80 b;  4AYB A;  2M48 A;  4RVH A;  3I55 Z;  3G4S Z;  3GTJ I;  1Q81 1;  1K9M 2;  1S72 1;  1I6H I;  3S1M I;  3CCL 1;  1KC8 2;  3CCS Z;  4E2Z A;  3EED A;  4RS4 A;  1N2F A;  4NB8 A;  1NJI 2;  2JR6 A;  1VQ9 Z;  3G6E Z;  2AYD A;  2K5R A;  3GTK I;  1X3Z A;  1VQ5 Z;  3CME Z; 
#chains in the Genus database with same CATH homology
 2F4M A;  2IZ4 A;  1VQM 1;  1I3Q I;  5IT9 b;  1YJW Z;  2DE5 A;  2YU9 I;  4A3L I;  2QLV B;  1YUK A;  5T6B A;  3G71 Z;  1M90 2;  3CD6 1;  1VQO 1;  2GTH A;  4HGZ A;  5LL6 f;  1ZB9 A;  1VQ6 Z;  5D1O B;  2H85 A;  3HOZ I;  1JWH C;  2OTJ Z;  3CCJ 1;  3IX0 A;  1P9N A;  3VB9 A;  1VQN 1;  4BY7 I;  4A93 I;  2VF1 A;  1I50 I;  3FKI I;  5C3E I;  3CCE Z;  3CCQ Z;  2RHB A;  3NH5 A;  4A3J I;  1PFT A;  1Q82 2;  2KPI A;  2R93 I;  4RVF A;  2E9H A;  2E2H I;  3OW2 Z;  3MZL B;  2E2I I;  2JA7 I;  5T67 A;  2F4O A;  3QWU A;  1YJ9 1;  1VQ7 1;  3T4N B;  3KIF A;  3NDJ A;  3U50 C;  1K9M 1;  3RZD I;  5T64 A;  4BXX I;  4TNU A;  4MD7 A;  1KC8 1;  3FQQ A;  1S72 Z;  1DL6 A;  2AKL A;  2Q51 A;  1VQL 1;  3ESW A;  1WW9 A;  3CCL Z;  1TWH I;  2JUB A;  3GTP I;  3S2D I;  1NJI 1;  3CMA 1;  2QA4 1;  4MD9 A;  3BG1 B;  1S7M A;  1USP A;  5IP7 I;  2J6A A;  1Y1W I;  4MH4 A;  3GTM S;  4MD8 A;  2JA5 I;  3MZK B;  3VMH A;  2HU9 A;  3NFZ A;  4XX2 A;  3PO3 S;  1TWG I;  1VQM Z;  4A3E I;  3CQZ I;  4QTT A;  3CCM 1;  1WCM I;  4A3C I;  2OOX B;  1M90 1;  1VQ8 1;  3S16 I;  3CD6 Z;  1VQO Z;  1K83 I;  3S1R I;  4RVD A;  2NVT I;  2PMZ A;  3D6W A;  2W03 A;  1L1O C;  3CPW Z;  1QF8 A;  1NP6 A;  3CCJ Z;  1YI2 1;  2O4H A;  3BG0 B;  1VQN Z;  3HOX I;  4NBG A;  1KD1 1;  3NH4 A;  1NUI A;  3Q87 A;  4E30 A;  3F3F C;  1JJ2 Y;  1QVF Y;  3OW2 Y;  3CCV 1;  4A3K I;  1Q82 1;  2VUM I;  3VMG A;  3M4O I;  3CXC Z;  1QVG Y;  4NBH A;  4E2W A;  1K73 2;  4A3B I;  3EER A;  1YJ9 Z;  4MXU A;  1N8R 2;  1YIT 1;  5A2Q f;  3JAM f;  3I07 A;  3PO2 I;  4NBB A;  4NBF A;  1VQ4 Z;  1VQL Z;  2JS4 A;  2P3Y A;  1W2B Z;  4E2X A;  2BJO A;  1KQS Z;  3HOW I;  3JAM b;  3CMA Z;  3CCR 1;  1KD1 2;  2QA4 Z;  1Y1V I;  1RO0 A;  3IFU A;  5C4X I;  4QTU A;  1Q86 2;  4RV9 A;  5D1P A;  1Z03 A;  3I4M I;  3CCS 1;  4NOZ A;  3GTM I;  1YHQ 1;  4HGY A;  3CCM Z;  3PO3 I;  2RT9 A;  2NVY I;  1ZH1 A;  4NFR A;  3GTO I;  1VQ8 Z;  2ZAE B;  3NH8 A;  3GTQ I;  3GTG I;  2QRC B;  4E32 A;  1VQ5 1;  5FLM I;  2QEX 1;  4NBD A;  1TFI A;  2IZ3 A;  2GTI A;  1USP B;  4BBR I;  5FLX f;  3P5J B;  4A3G I;  2QR1 B;  2YAD A;  1VQP 1;  4NH1 C;  3S17 I;  3K7A I;  3J81 f;  4NBE A;  1YI2 Z;  3G71 1;  2E2J I;  5C44 I;  1YJN 1;  2JMO A;  3FQM A;  2Y0S A;  2OOY B;  1K8A 2;  3HOU I;  3CCV Z;  1WII A;  1M1K 2;  1X3W A;  3S15 I;  2G2K A;  2OTJ 1;  2JA6 I;  4NBC A;  4NB9 A;  1K73 1;  3MON A;  3CC7 1;  3S1Q I;  1N8R 1;  2OTL 1;  2V8J A;  1TWC I;  1Z02 A;  3RZO I;  2P28 A;  1LQL A;  1Z01 A;  2DE6 A;  2EGT A;  1YIT Z;  1Q7Y 2;  2RBL A;  2WAQ A;  1RO2 A;  1QYP A;  3KIH A;  1VQK 1;  5IP9 I;  4Y52 I;  2R92 I;  2LIY A;  1TWA I;  3I56 1;  1ML8 A;  4DK1 A;  2JA8 I;  3S14 I;  1VLA A;  2OZK A;  3CCR Z;  1YUA A;  4EWC A;  1Q86 1;  2RIQ A;  2QRE B;  3J7A 4;  4E31 A;  1SFO I;  2NVX I;  1ZB8 A;  4MON A;  2R6M A;  3NDI A;  1YHQ Z;  2KI7 B;  1R9T I;  3S2H I;  3CC4 1;  3HKZ A;  4MRI A;  5IT9 f;  3VMI A;  4DGL A;  1VQ7 Z;  3CCU 1;  4CL1 A;  1YIJ 1;  3F3P C;  3IF8 A;  3CC2 1;  3VTN A;  2QEX Z;  4A3D I;  3HOV I;  2Q4Z A;  4A3M I;  5C4J I;  2W04 A;  4A3F I;  1VQP Z;  5A2Q b;  2JNY A;  3I55 1;  3TE5 B;  4BY1 I;  3G4S 1;  1YJN Z;  1K8A 1;  1TWF I;  1KRL A;  2WB1 A;  1RLY A;  1M1K 1;  3H0G I;  2GU2 A;  4E2Y A;  1Q81 2;  3GKQ A;  4E33 A;  2R7Z I;  2K3R A;  2O53 A;  2M6N A;  2VUG A;  3CC7 Z;  2NVQ I;  3CPW Y;  3TDH B;  4A3I I;  1VQ9 1;  2OTL Z;  1RQF A;  2HF1 A;  3G6E 1;  1Q7Y 1;  5D1O A;  3D9X A;  3CME 1;  2LFU A;  3GCF A;  4RVG A;  1JJ2 Z;  1VQK Z;  4X6A I;  1YJW 1;  3GTL I;  1QVF Z;  3M3Y I;  3I56 Z;  4HH4 A;  4S1T A;  4Y7N I;  3I4N I;  3LUS A;  3CXC Y;  2DE7 A;  1QVG Z;  5FLX b;  5AN9 F;  2V8K A;  1RNI A;  1VQ6 1;  3J81 b;  4DQY B;  3H3V J;  1VQ4 1;  5CM2 M;  3HOY I;  1Y1V S;  3CC4 Z;  2QRD B;  3CCE 1;  3CCQ 1;  3CCU Z;  1YIJ Z;  1W2B Y;  2B63 I;  3J80 f;  3CC2 Z;  1KQS Y;  4BBS I;  2RPR A;  1X0T A;  1RO4 A;  4NBA A;  2QKD A;  2PK7 A;  2I3C A;  2V8I A;  3S1N I;  2PM9 A;  3J80 b;  4AYB A;  2M48 A;  4RVH A;  3I55 Z;  3G4S Z;  3GTJ I;  1Q81 1;  1K9M 2;  1S72 1;  1I6H I;  3S1M I;  3CCL 1;  1KC8 2;  3CCS Z;  4E2Z A;  3EED A;  4RS4 A;  1N2F A;  4NB8 A;  1NJI 2;  2JR6 A;  1VQ9 Z;  3G6E Z;  2K5R A;  3GTK I;  1X3Z A;  1VQ5 Z;  3CME Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...