2VUMI

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI02
1QYPA 1Y1WI 3S2DI 2JA8I 5C3EI 1Y1VI 3Q87A 3GTPI 1PFTA 1K83I 1VLAA 4NBAA 5C44I 4A3FI 2R93I 4NBDA 3FKII 4A3II 3EERA 3S17I 3M4OI 4Y52I 5C4XI 3RZDI 1TWAI 2PK7A 3VMGA 2E2JI 3S1RI 3GCFA 5IP7I 5CM2M 1RLYA 4MH4A 1ZB8A 4NBGA 4NB8A 1TWFI 2VUMI 1N2FA 2NVQI 2JR6A 2F4MA 3HOVI 1WCMI 2E2HI 4X6AI 1X3ZA 1TWGI 2DE7A 4QTTA 2AKLA 3I4MI 3GTLI 4A3MI 1I6HI 2J6AA 3S15I 1DL6A 4NB9A 1ML8A 1ZB9A 2YU9I 4NBEA 3GTOI 4A93I 2DE6A 5IP9I 1RO4A 4A3BI 4NBFA 1I50I 3GTQI 2BJOA 5C4JI 2JS4A 2E2II 1TFIA 2JA5I 2JA7I 3HOWI 3GTMS 3HOYI 3PO3I 3D6WA 2F4OA 3S1NI 3GKQA 4NOZA 1USPA 3VMIA 4A3EI 3S16I 3RZOI 2P3YA 1USPB 2NVYI 1TWCI 4Y7NI 3CQZI 3I4NI 3S2HI 3GTKI 3HOZI 2HF1A 1TWHI 4NBBA 3S1QI 2R7ZI 3HOXI 1X3WA 2NVXI 4NBCA 4A3DI 3H0GI 4BBRI 2NVTI 3S14I 3I07A 2K5RA 2B63I 3M3YI 4A3CI 1YUAA 2JA6I 3ESWA 1LQLA 3K7AI 3GTGI 4A3LI 2DE5A 3LUSA 4BXXI 4A3KI 4NBHA 4BY1I 4BY7I 4QTUA 4A3GI 3VMHA 3GTMI 1NUIA 3U50C 1Y1VS 1R9TI 1I3QI 5FLMI 3S1MI 2JNYA 2KPIA 3PO2I 3VB9A 1L1OC 2RBLA 4BBSI 1SFOI 4A3JI 1WW9A 4XX2A 3GTJI 2R92I 3H3VJ 3PO3S 3HOUI
chains in the Genus database with same CATH superfamily
1KC81 2JA8I 1Y1VI 3J7A4 3HKZA 1VLAA 3CME1 1Q862 4E31A 1K9M2 1VQL1 2YADA 5IP7I 1Q861 1YJN1 2QREB 2GU2A 1K9M1 2VUMI 2NVQI 1NJI2 5D1OB 1YIT1 2I3CA 3NH8A 3HOVI 4MONA 3I55Z 1Z01A 2PMZA 1NJI1 1I6HI 3S15I 1K732 3CCV1 1ML8A 3CCS1 4NBEA 3F3FC 1W2BZ 4NBFA 1K731 5D1PA 2JS4A 1YIJZ 3CCRZ 2K3RA 2JIMA 3CC4Z 4NOZA 1VQ8Z 4A3EI 1VQM1 1KQSY 3I56Z 4MXUA 3MONA 1TWHI 4NBBA 2W03A 2H85A 4RS4A 1VQ5Z 4A3DI 4BBRI 2K5RA 3EEDA 5A2Qf 3CCMZ 4A3CI 1YUAA 3ESWA 3BG1B 1S7MA 1JJ2Z 1KD12 4BXXI 3CCJZ 3CMA1 1YJ9Z 2E7ZA 3G4S1 2JUBA 4QTUA 4RVHA 1KD11 1QVGY 3VMHA 1Q7Y2 3U50C 1Y1VS 4EWCA 1VQNZ 1R9TI 1I3QI 2O53A 2R6MA 3S1MI 1Q7Y1 2HU9A 3TDHB 1SFOI 4A3JI 4MRIA 2R92I 4HGYA 1VQOZ 3NH5A 2VPZA 3S2DI 1YHQZ 2OOXB 2OTLZ 1VQ61 3CCQ1 3Q87A 5FLXf 4NBAA 5C44I 2R93I 3VTNA 3S17I 5C4XI 3RZDI 3IFUA 4E30A 2E2JI 3S1RI 5IT9f 4NBGA 1ZB8A 3I551 3CCLZ 1FDIA 2W04A 3CCUZ 2QA4Z 1N2FA 2JIOA 3KIFA 5A2Qb 2WAQA 1VQ91 4X6AI 1TWGI 2PM9A 1YIJ1 3CCR1 3D2LA 2QKDA 2J6AA 3CC41 2GTIA 1VQ81 2YU9I 3CC7Z 2VPWA 3I561 2DE6A 5IP9I 3NDIA 1I50I 3GTQI 2Y0SA 2BJOA 5C4JI 2E2II 1VQ41 1VQK1 1YUKA 2JA5I 3HOYI 3D6WA 3CCEZ 3IR7A 3S1NI 3GKQA 1SIWA 3S16I 2JIPA 3RZOI 2NVYI 3I4NI 3CQZI 3CXCY 1WJ2A 4HGZA 3S2HI 3GTKI 1Q812 1RO0A 3G71Z 3CCM1 4E32A 2NVXI 2IV2X 2IZ4A 4NBCA 1Q811 3H0GI 4S1TA 2AYDA 1WIIA 2M48A 3JAMf 3CCJ1 1YJ91 2E9HA 5FLXb 5T67A 1RQFA 3CPWZ 3GTGI 4NFRA 4A3LI 2JIQA 3OW2Y 5IT9b 3MZKB 3G6EZ 1QVGZ 4BY1I 4E33A 1P9NA 2EGTA 1NUIA 1VQO1 2JNYA 1YHQ1 3J80f 2V8KA 1L1OC 1VQPZ 4BBSI 2Q4ZA 2OOYB 1WW9A 4XX2A 3IX0A 1YI2Z 3H3VJ 2P28A 4TNUA 3HOUI 2VPXA 1Y1WI 3CD61 1S72Z 2VUGA 4NBDA 4A3II 4DGLA 3CCU1 2QA41 2QRDB 4Y52I 1QVFZ 3GCFA 4E2ZA 1RNIA 2QRCB 1RO2A 2KI7B 3CC71 5T6BA 2JR6A 3T4NB 2F4MA 1WCMI 3JAMb 1X3ZA 2DE7A 4QTTA 2AKLA 2LIYA 3P5JB 3CCE1 1ZB9A 2QLVB 1RO4A 1NP6A 4RVDA 2JA7I 1TFIA 4E2XA 3HOWI 3GTMS 2JIRA 3IF8A 2V45A 1Q822 3F3PC 2GTHA 3G711 3CXCZ 2VPYA 2G2KA 1USPB 1TWCI 4Y7NI 3J81f 1Q821 1M1K2 4RVFA 1JJ2Y 3J80b 3S1QI 2R7ZI 1M1K1 1JWHC 3HOXI 1X3WA 4MD7A 3CMAZ 2NVTI 4NH1C 1YJWZ 2RHBA 2B63I 1WZNA 2V3VA 3M3YI 3FQMA 3G6E1 2V8JA 1KQSZ 4RV9A 3K7AI 3OW2Z 2DE5A 1VQ51 3LUSA 4A3KI 1VQ7Z 4DQYB 5AN9F 1VQP1 3GTMI 2RT9A 1YI21 2OTJZ 1VQ6Z 3NH4A 3CCQZ 1KRLA 3D9XA 1X0TA 1S721 1Y8CA 2QEXZ 3PO2I 2RBLA 1FDOA 3NDJA 1QF8A 3NFZA 4MD9A 3GTJI 3PO3S 3KIHA 1QYPA 3CC2Z 1VQN1 2RIQA 5C3EI 3GTPI 1PFTA 2V8IA 1K83I 2M6NA 4A3FI 3FKII 3J81b 3EERA 1VQ9Z 3M4OI 4MD8A 1AA6A 1TWAI 2PK7A 3VMGA 5CM2M 3CMEZ 1RLYA 4MH4A 1N8R2 2OTL1 4NB8A 1TWFI 4E2WA 1QXFA 1N8R1 1VQ4Z 1VQKZ 5LL6f 2O4HA 2Q51A 4RVGA 1VQLZ 2E2HI 1YJNZ 3I4MI 3GTLI 2RPRA 4A3MI 2JMOA 1DL6A 4NB9A 1ZH1A 5T64A 3GTOI 3CCL1 4A93I 1YITZ 4A3BI 3FQQA 3PO3I 1W2BY 2F4OA 2IZ3A 3CCVZ 1USPA 3VMIA 1Z02A 3CCSZ 3TE5B 2P3YA 3CPWY 2NAPA 3HOZI 2HF1A 1YJW1 1VQMZ 2WB1A 1M902 3S14I 2QR1B 3I07A 4DK1A 1M901 2LFUA 2JA6I 1VQ71 1LQLA 2LEXA 2VF1A 3QWUA 3MZLB 3BG0B 1Z03A 1K8A2 2OTJ1 1Q16A 2OZKA 4NBHA 2ZAEB 4BY7I 4E2YA 4A3GI 1K8A1 2QEX1 4AYBA 3CD6Z 4CL1A 3G4SZ 5FLMI 1QVFY 3CC21 2KPIA 3VB9A 5D1OA 1KC82 4HH4A
chains in the Genus database with same CATH topology
1KC81 2JA8I 1Y1VI 3J7A4 3HKZA 1VLAA 3CME1 1Q862 4E31A 1K9M2 1VQL1 2YADA 5IP7I 1Q861 1YJN1 2QREB 2GU2A 1K9M1 2VUMI 2NVQI 1NJI2 5D1OB 1YIT1 2I3CA 3NH8A 3HOVI 4MONA 3I55Z 1Z01A 2PMZA 1NJI1 1I6HI 3S15I 1K732 3CCV1 1ML8A 3CCS1 4NBEA 3F3FC 1W2BZ 4NBFA 1K731 5D1PA 2JS4A 1YIJZ 3CCRZ 2K3RA 3CC4Z 4NOZA 1VQ8Z 4A3EI 1VQM1 1KQSY 3I56Z 4MXUA 3MONA 1TWHI 4NBBA 2W03A 2H85A 4RS4A 1VQ5Z 4A3DI 4BBRI 2K5RA 3EEDA 5A2Qf 3CCMZ 4A3CI 1YUAA 3ESWA 3BG1B 1S7MA 1JJ2Z 1KD12 4BXXI 3CCJZ 3CMA1 1YJ9Z 3G4S1 2JUBA 4QTUA 4RVHA 1KD11 1QVGY 3VMHA 1Q7Y2 3U50C 1Y1VS 4EWCA 1VQNZ 1R9TI 1I3QI 2O53A 2R6MA 3S1MI 1Q7Y1 2HU9A 3TDHB 1SFOI 4A3JI 4MRIA 2R92I 4HGYA 1VQOZ 3NH5A 3S2DI 1YHQZ 2OOXB 2OTLZ 1VQ61 3CCQ1 3Q87A 5FLXf 4NBAA 5C44I 2R93I 3VTNA 3S17I 5C4XI 3RZDI 3IFUA 4E30A 2E2JI 3S1RI 5IT9f 4NBGA 1ZB8A 3I551 3CCLZ 2W04A 3CCUZ 2QA4Z 1N2FA 3KIFA 5A2Qb 2WAQA 1VQ91 4X6AI 1TWGI 2PM9A 1YIJ1 3CCR1 2QKDA 2J6AA 3CC41 2GTIA 1VQ81 2YU9I 3CC7Z 3I561 2DE6A 5IP9I 3NDIA 1I50I 3GTQI 2Y0SA 2BJOA 5C4JI 2E2II 1VQ41 1VQK1 1YUKA 2JA5I 3HOYI 3D6WA 3CCEZ 3S1NI 3GKQA 3S16I 3RZOI 2NVYI 3I4NI 3CQZI 3CXCY 4HGZA 3S2HI 3GTKI 1Q812 1RO0A 3G71Z 3CCM1 4E32A 2NVXI 2IZ4A 4NBCA 1Q811 3H0GI 4S1TA 1WIIA 2M48A 3JAMf 3CCJ1 1YJ91 2E9HA 5FLXb 5T67A 1RQFA 3CPWZ 3GTGI 4NFRA 4A3LI 3OW2Y 5IT9b 3MZKB 3G6EZ 1QVGZ 4BY1I 4E33A 1P9NA 2EGTA 1NUIA 1VQO1 2JNYA 1YHQ1 3J80f 2V8KA 1L1OC 1VQPZ 4BBSI 2Q4ZA 2OOYB 1WW9A 4XX2A 3IX0A 1YI2Z 3H3VJ 2P28A 4TNUA 3HOUI 1Y1WI 3CD61 1S72Z 2VUGA 4NBDA 4A3II 4DGLA 3CCU1 2QA41 2QRDB 4Y52I 1QVFZ 3GCFA 4E2ZA 1RNIA 2QRCB 2KI7B 1RO2A 3CC71 5T6BA 2JR6A 3T4NB 2F4MA 1WCMI 3JAMb 1X3ZA 2DE7A 4QTTA 2AKLA 2LIYA 3P5JB 3CCE1 1ZB9A 2QLVB 1RO4A 1NP6A 4RVDA 2JA7I 1TFIA 4E2XA 3HOWI 3GTMS 3IF8A 1Q822 3F3PC 2GTHA 3G711 3CXCZ 2G2KA 1USPB 1TWCI 4Y7NI 3J81f 1Q821 1M1K2 4RVFA 1JJ2Y 3J80b 3S1QI 2R7ZI 1M1K1 1JWHC 3HOXI 1X3WA 4MD7A 3CMAZ 2NVTI 4NH1C 1YJWZ 2RHBA 2B63I 3M3YI 3FQMA 3G6E1 2V8JA 1KQSZ 4RV9A 3K7AI 3OW2Z 2DE5A 1VQ51 3LUSA 4A3KI 1VQ7Z 4DQYB 5AN9F 1VQP1 3GTMI 2RT9A 1YI21 2OTJZ 1VQ6Z 3NH4A 3CCQZ 1KRLA 3D9XA 1X0TA 1S721 2QEXZ 3PO2I 2RBLA 3NFZA 3NDJA 1QF8A 4MD9A 3GTJI 3PO3S 3KIHA 1QYPA 3CC2Z 1VQN1 2RIQA 5C3EI 3GTPI 1PFTA 2V8IA 1K83I 2M6NA 4A3FI 3FKII 3J81b 3EERA 1VQ9Z 3M4OI 4MD8A 1TWAI 2PK7A 3VMGA 5CM2M 3CMEZ 1RLYA 4MH4A 1N8R2 2OTL1 4NB8A 1TWFI 4E2WA 1N8R1 1VQ4Z 1VQKZ 5LL6f 2O4HA 2Q51A 4RVGA 1VQLZ 2E2HI 1YJNZ 3I4MI 3GTLI 2RPRA 4A3MI 2JMOA 1DL6A 4NB9A 1ZH1A 5T64A 3GTOI 3CCL1 4A93I 1YITZ 4A3BI 3FQQA 3PO3I 1W2BY 2F4OA 2IZ3A 3CCVZ 1USPA 3VMIA 1Z02A 3CCSZ 3TE5B 2P3YA 3CPWY 3HOZI 2HF1A 1YJW1 1VQMZ 2WB1A 1M902 3S14I 2QR1B 3I07A 4DK1A 1M901 2LFUA 2JA6I 1VQ71 1LQLA 2VF1A 3QWUA 3MZLB 3BG0B 1Z03A 1K8A2 2OTJ1 2OZKA 4NBHA 2ZAEB 4BY7I 4E2YA 4A3GI 1K8A1 2QEX1 4AYBA 3CD6Z 4CL1A 3G4SZ 5FLMI 1QVFY 3CC21 2KPIA 3VB9A 5D1OA 1KC82 4HH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYP A;  1Y1W I;  3S2D I;  2JA8 I;  5C3E I;  1Y1V I;  3Q87 A;  3GTP I;  1PFT A;  1K83 I;  1VLA A;  4NBA A;  5C44 I;  4A3F I;  2R93 I;  4NBD A;  3FKI I;  4A3I I;  3EER A;  3S17 I;  3M4O I;  4Y52 I;  5C4X I;  3RZD I;  1TWA I;  2PK7 A;  3VMG A;  2E2J I;  3S1R I;  3GCF A;  5IP7 I;  5CM2 M;  1RLY A;  4MH4 A;  1ZB8 A;  4NBG A;  4NB8 A;  1TWF I;  2VUM I;  1N2F A;  2NVQ I;  2JR6 A;  2F4M A;  3HOV I;  1WCM I;  2E2H I;  4X6A I;  1X3Z A;  1TWG I;  2DE7 A;  4QTT A;  2AKL A;  3I4M I;  3GTL I;  4A3M I;  1I6H I;  2J6A A;  3S15 I;  1DL6 A;  4NB9 A;  1ML8 A;  1ZB9 A;  2YU9 I;  4NBE A;  3GTO I;  4A93 I;  2DE6 A;  5IP9 I;  1RO4 A;  4A3B I;  4NBF A;  1I50 I;  3GTQ I;  2BJO A;  5C4J I;  2JS4 A;  2E2I I;  1TFI A;  2JA5 I;  2JA7 I;  3HOW I;  3GTM S;  3HOY I;  3PO3 I;  3D6W A;  2F4O A;  3S1N I;  3GKQ A;  4NOZ A;  1USP A;  3VMI A;  4A3E I;  3S16 I;  3RZO I;  2P3Y A;  1USP B;  2NVY I;  1TWC I;  4Y7N I;  3CQZ I;  3I4N I;  3S2H I;  3GTK I;  3HOZ I;  2HF1 A;  1TWH I;  4NBB A;  3S1Q I;  2R7Z I;  3HOX I;  1X3W A;  2NVX I;  4NBC A;  4A3D I;  3H0G I;  4BBR I;  2NVT I;  3S14 I;  3I07 A;  2K5R A;  2B63 I;  3M3Y I;  4A3C I;  1YUA A;  2JA6 I;  3ESW A;  1LQL A;  3K7A I;  3GTG I;  4A3L I;  2DE5 A;  3LUS A;  4BXX I;  4A3K I;  4NBH A;  4BY1 I;  4BY7 I;  4QTU A;  4A3G I;  3VMH A;  3GTM I;  1NUI A;  3U50 C;  1Y1V S;  1R9T I;  1I3Q I;  5FLM I;  3S1M I;  2JNY A;  2KPI A;  3PO2 I;  3VB9 A;  1L1O C;  2RBL A;  4BBS I;  1SFO I;  4A3J I;  1WW9 A;  4XX2 A;  3GTJ I;  2R92 I;  3H3V J;  3PO3 S;  3HOU I; 
#chains in the Genus database with same CATH topology
 1KC8 1;  2JA8 I;  1Y1V I;  3J7A 4;  3HKZ A;  1VLA A;  3CME 1;  1Q86 2;  4E31 A;  1K9M 2;  1VQL 1;  2YAD A;  5IP7 I;  1Q86 1;  1YJN 1;  2QRE B;  2GU2 A;  1K9M 1;  2VUM I;  2NVQ I;  1NJI 2;  5D1O B;  1YIT 1;  2I3C A;  3NH8 A;  3HOV I;  4MON A;  3I55 Z;  1Z01 A;  2PMZ A;  1NJI 1;  1I6H I;  3S15 I;  1K73 2;  3CCV 1;  1ML8 A;  3CCS 1;  4NBE A;  3F3F C;  1W2B Z;  4NBF A;  1K73 1;  5D1P A;  2JS4 A;  1YIJ Z;  3CCR Z;  2K3R A;  2JIM A;  3CC4 Z;  4NOZ A;  1VQ8 Z;  4A3E I;  1VQM 1;  1KQS Y;  3I56 Z;  4MXU A;  3MON A;  1TWH I;  4NBB A;  2W03 A;  2H85 A;  4RS4 A;  1VQ5 Z;  4A3D I;  4BBR I;  2K5R A;  3EED A;  5A2Q f;  3CCM Z;  4A3C I;  1YUA A;  3ESW A;  3BG1 B;  1S7M A;  1JJ2 Z;  1KD1 2;  4BXX I;  3CCJ Z;  3CMA 1;  1YJ9 Z;  2E7Z A;  3G4S 1;  2JUB A;  4QTU A;  4RVH A;  1KD1 1;  1QVG Y;  3VMH A;  1Q7Y 2;  3U50 C;  1Y1V S;  4EWC A;  1VQN Z;  1R9T I;  1I3Q I;  2O53 A;  2R6M A;  3S1M I;  1Q7Y 1;  2HU9 A;  3TDH B;  1SFO I;  4A3J I;  4MRI A;  2R92 I;  4HGY A;  1VQO Z;  3NH5 A;  2VPZ A;  3S2D I;  1YHQ Z;  2OOX B;  2OTL Z;  1VQ6 1;  3CCQ 1;  3Q87 A;  5FLX f;  4NBA A;  5C44 I;  2R93 I;  3VTN A;  3S17 I;  5C4X I;  3RZD I;  3IFU A;  4E30 A;  2E2J I;  3S1R I;  5IT9 f;  4NBG A;  1ZB8 A;  3I55 1;  3CCL Z;  1FDI A;  2W04 A;  3CCU Z;  2QA4 Z;  1N2F A;  2JIO A;  3KIF A;  5A2Q b;  2WAQ A;  1VQ9 1;  4X6A I;  1TWG I;  2PM9 A;  1YIJ 1;  3CCR 1;  3D2L A;  2QKD A;  2J6A A;  3CC4 1;  2GTI A;  1VQ8 1;  2YU9 I;  3CC7 Z;  2VPW A;  3I56 1;  2DE6 A;  5IP9 I;  3NDI A;  1I50 I;  3GTQ I;  2Y0S A;  2BJO A;  5C4J I;  2E2I I;  1VQ4 1;  1VQK 1;  1YUK A;  2JA5 I;  3HOY I;  3D6W A;  3CCE Z;  3IR7 A;  3S1N I;  3GKQ A;  1SIW A;  3S16 I;  2JIP A;  3RZO I;  2NVY I;  3I4N I;  3CQZ I;  3CXC Y;  1WJ2 A;  4HGZ A;  3S2H I;  3GTK I;  1Q81 2;  1RO0 A;  3G71 Z;  3CCM 1;  4E32 A;  2NVX I;  2IV2 X;  2IZ4 A;  4NBC A;  1Q81 1;  3H0G I;  4S1T A;  2AYD A;  1WII A;  2M48 A;  3JAM f;  3CCJ 1;  1YJ9 1;  2E9H A;  5FLX b;  5T67 A;  1RQF A;  3CPW Z;  3GTG I;  4NFR A;  4A3L I;  2JIQ A;  3OW2 Y;  5IT9 b;  3MZK B;  3G6E Z;  1QVG Z;  4BY1 I;  4E33 A;  1P9N A;  2EGT A;  1NUI A;  1VQO 1;  2JNY A;  1YHQ 1;  3J80 f;  2V8K A;  1L1O C;  1VQP Z;  4BBS I;  2Q4Z A;  2OOY B;  1WW9 A;  4XX2 A;  3IX0 A;  1YI2 Z;  3H3V J;  2P28 A;  4TNU A;  3HOU I;  2VPX A;  1Y1W I;  3CD6 1;  1S72 Z;  2VUG A;  4NBD A;  4A3I I;  4DGL A;  3CCU 1;  2QA4 1;  2QRD B;  4Y52 I;  1QVF Z;  3GCF A;  4E2Z A;  1RNI A;  2QRC B;  1RO2 A;  2KI7 B;  3CC7 1;  5T6B A;  2JR6 A;  3T4N B;  2F4M A;  1WCM I;  3JAM b;  1X3Z A;  2DE7 A;  4QTT A;  2AKL A;  2LIY A;  3P5J B;  3CCE 1;  1ZB9 A;  2QLV B;  1RO4 A;  1NP6 A;  4RVD A;  2JA7 I;  1TFI A;  4E2X A;  3HOW I;  3GTM S;  2JIR A;  3IF8 A;  2V45 A;  1Q82 2;  3F3P C;  2GTH A;  3G71 1;  3CXC Z;  2VPY A;  2G2K A;  1USP B;  1TWC I;  4Y7N I;  3J81 f;  1Q82 1;  1M1K 2;  4RVF A;  1JJ2 Y;  3J80 b;  3S1Q I;  2R7Z I;  1M1K 1;  1JWH C;  3HOX I;  1X3W A;  4MD7 A;  3CMA Z;  2NVT I;  4NH1 C;  1YJW Z;  2RHB A;  2B63 I;  1WZN A;  2V3V A;  3M3Y I;  3FQM A;  3G6E 1;  2V8J A;  1KQS Z;  4RV9 A;  3K7A I;  3OW2 Z;  2DE5 A;  1VQ5 1;  3LUS A;  4A3K I;  1VQ7 Z;  4DQY B;  5AN9 F;  1VQP 1;  3GTM I;  2RT9 A;  1YI2 1;  2OTJ Z;  1VQ6 Z;  3NH4 A;  3CCQ Z;  1KRL A;  3D9X A;  1X0T A;  1S72 1;  1Y8C A;  2QEX Z;  3PO2 I;  2RBL A;  1FDO A;  3NDJ A;  1QF8 A;  3NFZ A;  4MD9 A;  3GTJ I;  3PO3 S;  3KIH A;  1QYP A;  3CC2 Z;  1VQN 1;  2RIQ A;  5C3E I;  3GTP I;  1PFT A;  2V8I A;  1K83 I;  2M6N A;  4A3F I;  3FKI I;  3J81 b;  3EER A;  1VQ9 Z;  3M4O I;  4MD8 A;  1AA6 A;  1TWA I;  2PK7 A;  3VMG A;  5CM2 M;  3CME Z;  1RLY A;  4MH4 A;  1N8R 2;  2OTL 1;  4NB8 A;  1TWF I;  4E2W A;  1QXF A;  1N8R 1;  1VQ4 Z;  1VQK Z;  5LL6 f;  2O4H A;  2Q51 A;  4RVG A;  1VQL Z;  2E2H I;  1YJN Z;  3I4M I;  3GTL I;  2RPR A;  4A3M I;  2JMO A;  1DL6 A;  4NB9 A;  1ZH1 A;  5T64 A;  3GTO I;  3CCL 1;  4A93 I;  1YIT Z;  4A3B I;  3FQQ A;  3PO3 I;  1W2B Y;  2F4O A;  2IZ3 A;  3CCV Z;  1USP A;  3VMI A;  1Z02 A;  3CCS Z;  3TE5 B;  2P3Y A;  3CPW Y;  2NAP A;  3HOZ I;  2HF1 A;  1YJW 1;  1VQM Z;  2WB1 A;  1M90 2;  3S14 I;  2QR1 B;  3I07 A;  4DK1 A;  1M90 1;  2LFU A;  2JA6 I;  1VQ7 1;  1LQL A;  2LEX A;  2VF1 A;  3QWU A;  3MZL B;  3BG0 B;  1Z03 A;  1K8A 2;  2OTJ 1;  1Q16 A;  2OZK A;  4NBH A;  2ZAE B;  4BY7 I;  4E2Y A;  4A3G I;  1K8A 1;  2QEX 1;  4AYB A;  3CD6 Z;  4CL1 A;  3G4S Z;  5FLM I;  1QVF Y;  3CC2 1;  2KPI A;  3VB9 A;  5D1O A;  1KC8 2;  4HH4 A; 
#chains in the Genus database with same CATH homology
 1KC8 1;  2JA8 I;  1Y1V I;  3J7A 4;  3HKZ A;  1VLA A;  3CME 1;  1Q86 2;  4E31 A;  1K9M 2;  1VQL 1;  2YAD A;  5IP7 I;  1Q86 1;  1YJN 1;  2QRE B;  2GU2 A;  1K9M 1;  2VUM I;  2NVQ I;  1NJI 2;  5D1O B;  1YIT 1;  2I3C A;  3NH8 A;  3HOV I;  4MON A;  3I55 Z;  1Z01 A;  2PMZ A;  1NJI 1;  1I6H I;  3S15 I;  1K73 2;  3CCV 1;  1ML8 A;  3CCS 1;  4NBE A;  3F3F C;  1W2B Z;  4NBF A;  1K73 1;  5D1P A;  2JS4 A;  1YIJ Z;  3CCR Z;  2K3R A;  3CC4 Z;  4NOZ A;  1VQ8 Z;  4A3E I;  1VQM 1;  1KQS Y;  3I56 Z;  4MXU A;  3MON A;  1TWH I;  4NBB A;  2W03 A;  2H85 A;  4RS4 A;  1VQ5 Z;  4A3D I;  4BBR I;  2K5R A;  3EED A;  5A2Q f;  3CCM Z;  4A3C I;  1YUA A;  3ESW A;  3BG1 B;  1S7M A;  1JJ2 Z;  1KD1 2;  4BXX I;  3CCJ Z;  3CMA 1;  1YJ9 Z;  3G4S 1;  2JUB A;  4QTU A;  4RVH A;  1KD1 1;  1QVG Y;  3VMH A;  1Q7Y 2;  3U50 C;  1Y1V S;  4EWC A;  1VQN Z;  1R9T I;  1I3Q I;  2O53 A;  2R6M A;  3S1M I;  1Q7Y 1;  2HU9 A;  3TDH B;  1SFO I;  4A3J I;  4MRI A;  2R92 I;  4HGY A;  1VQO Z;  3NH5 A;  3S2D I;  1YHQ Z;  2OOX B;  2OTL Z;  1VQ6 1;  3CCQ 1;  3Q87 A;  5FLX f;  4NBA A;  5C44 I;  2R93 I;  3VTN A;  3S17 I;  5C4X I;  3RZD I;  3IFU A;  4E30 A;  2E2J I;  3S1R I;  5IT9 f;  4NBG A;  1ZB8 A;  3I55 1;  3CCL Z;  2W04 A;  3CCU Z;  2QA4 Z;  1N2F A;  3KIF A;  5A2Q b;  2WAQ A;  1VQ9 1;  4X6A I;  1TWG I;  2PM9 A;  1YIJ 1;  3CCR 1;  2QKD A;  2J6A A;  3CC4 1;  2GTI A;  1VQ8 1;  2YU9 I;  3CC7 Z;  3I56 1;  2DE6 A;  5IP9 I;  3NDI A;  1I50 I;  3GTQ I;  2Y0S A;  2BJO A;  5C4J I;  2E2I I;  1VQ4 1;  1VQK 1;  1YUK A;  2JA5 I;  3HOY I;  3D6W A;  3CCE Z;  3S1N I;  3GKQ A;  3S16 I;  3RZO I;  2NVY I;  3I4N I;  3CQZ I;  3CXC Y;  4HGZ A;  3S2H I;  3GTK I;  1Q81 2;  1RO0 A;  3G71 Z;  3CCM 1;  4E32 A;  2NVX I;  2IZ4 A;  4NBC A;  1Q81 1;  3H0G I;  4S1T A;  1WII A;  2M48 A;  3JAM f;  3CCJ 1;  1YJ9 1;  2E9H A;  5FLX b;  5T67 A;  1RQF A;  3CPW Z;  3GTG I;  4NFR A;  4A3L I;  3OW2 Y;  5IT9 b;  3MZK B;  3G6E Z;  1QVG Z;  4BY1 I;  4E33 A;  1P9N A;  2EGT A;  1NUI A;  1VQO 1;  2JNY A;  1YHQ 1;  3J80 f;  2V8K A;  1L1O C;  1VQP Z;  4BBS I;  2Q4Z A;  2OOY B;  1WW9 A;  4XX2 A;  3IX0 A;  1YI2 Z;  3H3V J;  2P28 A;  4TNU A;  3HOU I;  1Y1W I;  3CD6 1;  1S72 Z;  2VUG A;  4NBD A;  4A3I I;  4DGL A;  3CCU 1;  2QA4 1;  2QRD B;  4Y52 I;  1QVF Z;  3GCF A;  4E2Z A;  1RNI A;  2QRC B;  2KI7 B;  1RO2 A;  3CC7 1;  5T6B A;  2JR6 A;  3T4N B;  2F4M A;  1WCM I;  3JAM b;  1X3Z A;  2DE7 A;  4QTT A;  2AKL A;  2LIY A;  3P5J B;  3CCE 1;  1ZB9 A;  2QLV B;  1RO4 A;  1NP6 A;  4RVD A;  2JA7 I;  1TFI A;  4E2X A;  3HOW I;  3GTM S;  3IF8 A;  1Q82 2;  3F3P C;  2GTH A;  3G71 1;  3CXC Z;  2G2K A;  1USP B;  1TWC I;  4Y7N I;  3J81 f;  1Q82 1;  1M1K 2;  4RVF A;  1JJ2 Y;  3J80 b;  3S1Q I;  2R7Z I;  1M1K 1;  1JWH C;  3HOX I;  1X3W A;  4MD7 A;  3CMA Z;  2NVT I;  4NH1 C;  1YJW Z;  2RHB A;  2B63 I;  3M3Y I;  3FQM A;  3G6E 1;  2V8J A;  1KQS Z;  4RV9 A;  3K7A I;  3OW2 Z;  2DE5 A;  1VQ5 1;  3LUS A;  4A3K I;  1VQ7 Z;  4DQY B;  5AN9 F;  1VQP 1;  3GTM I;  2RT9 A;  1YI2 1;  2OTJ Z;  1VQ6 Z;  3NH4 A;  3CCQ Z;  1KRL A;  3D9X A;  1X0T A;  1S72 1;  2QEX Z;  3PO2 I;  2RBL A;  3NFZ A;  3NDJ A;  1QF8 A;  4MD9 A;  3GTJ I;  3PO3 S;  3KIH A;  1QYP A;  3CC2 Z;  1VQN 1;  2RIQ A;  5C3E I;  3GTP I;  1PFT A;  2V8I A;  1K83 I;  2M6N A;  4A3F I;  3FKI I;  3J81 b;  3EER A;  1VQ9 Z;  3M4O I;  4MD8 A;  1TWA I;  2PK7 A;  3VMG A;  5CM2 M;  3CME Z;  1RLY A;  4MH4 A;  1N8R 2;  2OTL 1;  4NB8 A;  1TWF I;  4E2W A;  1N8R 1;  1VQ4 Z;  1VQK Z;  5LL6 f;  2O4H A;  2Q51 A;  4RVG A;  1VQL Z;  2E2H I;  1YJN Z;  3I4M I;  3GTL I;  2RPR A;  4A3M I;  2JMO A;  1DL6 A;  4NB9 A;  1ZH1 A;  5T64 A;  3GTO I;  3CCL 1;  4A93 I;  1YIT Z;  4A3B I;  3FQQ A;  3PO3 I;  1W2B Y;  2F4O A;  2IZ3 A;  3CCV Z;  1USP A;  3VMI A;  1Z02 A;  3CCS Z;  3TE5 B;  2P3Y A;  3CPW Y;  3HOZ I;  2HF1 A;  1YJW 1;  1VQM Z;  2WB1 A;  1M90 2;  3S14 I;  2QR1 B;  3I07 A;  4DK1 A;  1M90 1;  2LFU A;  2JA6 I;  1VQ7 1;  1LQL A;  2VF1 A;  3QWU A;  3MZL B;  3BG0 B;  1Z03 A;  1K8A 2;  2OTJ 1;  2OZK A;  4NBH A;  2ZAE B;  4BY7 I;  4E2Y A;  4A3G I;  1K8A 1;  2QEX 1;  4AYB A;  3CD6 Z;  4CL1 A;  3G4S Z;  5FLM I;  1QVF Y;  3CC2 1;  2KPI A;  3VB9 A;  5D1O A;  1KC8 2;  4HH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...