2VUMI

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI02
2NVTI 3GCFA 1USPB 2F4OA 3LUSA 3GTQI 1RO4A 4XX2A 1NUIA 1L1OC 3VMGA 1DL6A 3GTJI 3GTPI 2E2JI 2JNYA 4A3FI 4QTUA 1USPA 3PO3S 4NB8A 3Q87A 4A3KI 4A93I 1X3ZA 3I07A 5C4JI 5C4XI 4A3JI 3S14I 3S1RI 1Y1WI 4BBRI 3I4MI 4NBEA 1X3WA 2YU9I 2R7ZI 2JA8I 2HF1A 2JR6A 4NBFA 4A3EI 4NBHA 5CM2M 1Y1VI 1R9TI 3HOVI 3VB9A 2PK7A 1TWAI 4NOZA 3HOYI 1TWGI 3ESWA 4NBAA 3HOXI 4NBDA 2R92I 1YUAA 2NVYI 3H3VJ 3GTKI 1ML8A 3GTGI 1TFIA 1SFOI 3HOUI 3RZOI 1TWFI 1Y1VS 2DE7A 5C3EI 2DE5A 2JA6I 2E2HI 5FLMI 3GTOI 4MH4A 2KPIA 2B63I 3S1NI 2RBLA 2JA5I 3EERA 2K5RA 3U50C 1ZB8A 3S15I 3K7AI 4Y52I 1VLAA 3M4OI 3S17I 1PFTA 3H0GI 3GTLI 3GTMS 4A3BI 3FKII 4A3GI 1TWCI 3HOWI 4QTTA 4A3CI 1TWHI 1QYPA 3VMIA 1I50I 1RLYA 3HOZI 1LQLA 3S2DI 3I4NI 3S2HI 2AKLA 2DE6A 3GTMI 3S1QI 4BY1I 3CQZI 3RZDI 2NVXI 3GKQA 2JA7I 3M3YI 4NB9A 4A3LI 1N2FA 2NVQI 1WCMI 4BXXI 3PO2I 5IP9I 3S16I 4BY7I 5IP7I 2F4MA 4X6AI 2P3YA 4NBBA 1WW9A 4Y7NI 2R93I 3D6WA 5C44I 2E2II 4A3II 2J6AA 2JS4A 2VUMI 4A3DI 1ZB9A 4NBCA 3S1MI 4A3MI 1K83I 2BJOA 1I6HI 3VMHA 4BBSI 4NBGA 3PO3I 1I3QI
chains in the Genus database with same CATH superfamily
3GCFA 2F4OA 2VPZA 1YJWZ 5D1OA 1NUIA 1L1OC 3CMA1 1DL6A 1AA6A 2JMOA 2E2JI 1QVGZ 1X3ZA 3I07A 3NH8A 5C4XI 3F3PC 3S1RI 2QA4Z 3CCEZ 4BBRI 1Z01A 3CMEZ 1M901 1X0TA 1X3WA 2YU9I 2R7ZI 2G2KA 5CM2M 3CMAZ 1JWHC 1TWAI 3ESWA 1YJN1 2PM9A 3G711 1N8R2 2OTL1 2NVYI 1KRLA 3CC41 1KQSZ 2LEXA 2W03A 1VQM1 3GTGI 1SFOI 1NJI2 3RZOI 1TWFI 2Q51A 3MZKB 1Q812 3FQMA 3OW2Z 5T67A 3T4NB 5FLXb 4RV9A 1QVFZ 4E2ZA 1YJNZ 3EERA 2K5RA 3G71Z 2OTLZ 3J80f 1RO0A 1VQ41 1Q16A 3CC4Z 3H0GI 2O4HA 2WB1A 3FKII 3D9XA 3VMIA 1N8R1 1M1K2 1VQN1 1YJ91 3I4NI 3S2HI 2RIQA 1NJI1 3S1QI 1W2BY 4BY1I 1VQ4Z 1Q811 1FDIA 1Q862 1N2FA 2Y0SA 4BXXI 1KD11 3J81f 2P3YA 1VQNZ 1YJ9Z 1VQK1 2VUMI 4A3DI 4MD9A 3NDJA 4BBSI 4AYBA 3IF8A 3GTQI 3VMGA 4E30A 3GTJI 3CCV1 1VQKZ 1VQ61 1Q861 1QF8A 3Q87A 2QRCB 3S14I 3TDHB 2VF1A 3I4MI 2HF1A 2JR6A 3NH4A 4NBHA 5AN9F 1Y1VI 1R9TI 2JIOA 2V45A 3CCVZ 4NBDA 2IZ3A 1VQ6Z 1Q822 2P28A 2AYDA 2R92I 2NAPA 3G6E1 2V8JA 1ML8A 5D1PA 1Y1VS 2DE7A 2JA6I 1VQP1 3CD61 2M6NA 5FLMI 2GTIA 4MH4A 4DGLA 2KPIA 3S1NI 3G4S1 2RBLA 2JA5I 3U50C 3S15I 3G6EZ 1YI21 3TE5B 3K7AI 1PFTA 1VQO1 1YIT1 3CD6Z 2QEX1 1VQPZ 2Q4ZA 4QTTA 1SIWA 1TWHI 1I50I 1RLYA 3HOZI 3J80b 2JUBA 3G4SZ 1JJ2Y 2AKLA 2DE6A 2QKDA 1VQ91 2OTJ1 3M3YI 2LFUA 3BG1B 4E31A 1YITZ 3IR7A 1K8A2 1VQMZ 3PO2I 2JIQA 2F4MA 2RT9A 4X6AI 1Q7Y2 4MRIA 3CCM1 3CCJ1 3VTNA 2IV2X 3FQQA 4RVGA 1VQ9Z 4NH1C 1WIIA 1KC82 2OTJZ 3CXCY 3VMHA 3CCR1 3CPWY 2IZ4A 3PO3I 1P9NA 3J81b 2GTHA 1S7MA 2NVTI 1Z02A 4XX2A 3CCU1 4EWCA 3GTPI 2JNYA 3CCMZ 4QTUA 3CCJZ 3JAMb 2LIYA 3PO3S 2K3RA 3NFZA 4A93I 4NFRA 5C4JI 1NP6A 2RHBA 1K8A1 4HH4A 1Y1WI 3I561 1Q7Y1 2R6MA 3MONA 2JA8I 4TNUA 3JAMf 3CCUZ 1M1K1 4MD7A 3VB9A 2VPYA 3HOYI 1TWGI 4NBAA 4MONA 2QR1B 3HOXI 1KC81 3CC21 2M48A 5T6BA 2GU2A 2QRDB 1YUAA 3GTKI 2O53A 4MXUA 1JJ2Z 1Z03A 1YUKA 4E32A 3HOUI 3IFUA 3I56Z 3NH5A 2DE5A 2E2HI 1KQSY 3GTOI 1QXFA 1YIJ1 3F3FC 3NDIA 2V8KA 5IT9b 3CC2Z 1K9M2 3OW2Y 2E9HA 4DQYB 1VQ81 4MD8A 3I551 1QVFY 4Y52I 1VLAA 3S17I 3GTLI 3KIHA 2I3CA 1M902 3GTMS 1TWCI 1VQL1 5IT9f 1FDOA 1W2BZ 5D1OB 2EGTA 1YIJZ 1VQ71 4RVFA 2E7ZA 2JIRA 2VPWA 2NVXI 1VQ8Z 2VUGA 1Y8CA 3I55Z 2VPXA 2JA7I 2W04A 4NB9A 2PMZA 2NVQI 1WZNA 2KI7B 1VQLZ 4BY7I 5IP7I 1K9M1 4NBBA 1S721 1WW9A 3D6WA 5C44I 1VQ7Z 3CCL1 1Q821 4A3II 2J6AA 2JS4A 3KIFA 1K83I 1I6HI 3P5JB 4NBGA 2V8IA 1I3QI 5LL6f 1YI2Z 1USPB 3LUSA 1RO4A 1RO2A 1VQOZ 3IX0A 1S72Z 2OOXB 2QEXZ 4A3FI 1USPA 3CCQ1 3CCLZ 4NB8A 3CC71 4A3KI 4A3JI 2ZAEB 4RVDA 2YADA 3MZLB 4NBEA 1VQ51 4NBFA 4A3EI 1KD12 3HOVI 2QREB 2PK7A 4NOZA 3D2LA 1WJ2A 1YHQ1 3CCQZ 3CC7Z 4E2YA 5FLXf 3H3VJ 5A2Qb 1RQFA 1TFIA 3HKZA 5C3EI 4S1TA 1VQ5Z 1QVGY 3EEDA 3CCRZ 4DK1A 2B63I 5A2Qf 3CCS1 1ZB8A 4CL1A 1YHQZ 1K732 4HGZA 3M4OI 4A3BI 4HGYA 4A3GI 4E33A 3HOWI 5T64A 4A3CI 1RNIA 1QYPA 2H85A 1LQLA 3S2DI 3CCSZ 2JIMA 4E2XA 3GTMI 3QWUA 2OZKA 3BG0B 3CQZI 3RZDI 2V3VA 3GKQA 2JIPA 4A3LI 2WAQA 2QLVB 1YJW1 1WCMI 5IP9I 3S16I 4RS4A 2RPRA 1ZH1A 1K731 4Y7NI 2R93I 3CXCZ 3J7A4 3CPWZ 2E2II 4RVHA 1ZB9A 4NBCA 3S1MI 2QA41 3CCE1 2BJOA 4A3MI 4E2WA 2HU9A 3CME1 2OOYB
chains in the Genus database with same CATH topology
3GCFA 2F4OA 1YJWZ 5D1OA 1NUIA 1L1OC 3CMA1 1DL6A 2JMOA 2E2JI 1QVGZ 1X3ZA 3I07A 3NH8A 5C4XI 3F3PC 3S1RI 2QA4Z 3CCEZ 4BBRI 1Z01A 3CMEZ 1M901 1X0TA 1X3WA 2YU9I 2R7ZI 2G2KA 5CM2M 3CMAZ 1JWHC 1TWAI 3ESWA 1YJN1 2PM9A 3G711 1N8R2 2OTL1 2NVYI 1KRLA 3CC41 1KQSZ 2W03A 1VQM1 3GTGI 1SFOI 1NJI2 3RZOI 1TWFI 2Q51A 3MZKB 1Q812 3FQMA 3OW2Z 5T67A 3T4NB 5FLXb 4RV9A 1QVFZ 4E2ZA 1YJNZ 3EERA 2K5RA 3G71Z 2OTLZ 3J80f 1RO0A 1VQ41 3CC4Z 3H0GI 2O4HA 2WB1A 3FKII 3D9XA 3VMIA 1N8R1 1M1K2 1VQN1 1YJ91 3I4NI 3S2HI 2RIQA 1NJI1 3S1QI 1W2BY 4BY1I 1VQ4Z 1Q811 1Q862 1N2FA 2Y0SA 4BXXI 1KD11 3J81f 2P3YA 1VQNZ 1YJ9Z 1VQK1 2VUMI 4A3DI 4MD9A 3NDJA 4BBSI 4AYBA 3IF8A 3GTQI 3VMGA 4E30A 3GTJI 3CCV1 1VQKZ 1VQ61 1Q861 1QF8A 3Q87A 2QRCB 3S14I 3TDHB 2VF1A 3I4MI 2HF1A 2JR6A 3NH4A 4NBHA 5AN9F 1Y1VI 1R9TI 3CCVZ 4NBDA 2IZ3A 1VQ6Z 1Q822 2P28A 2R92I 3G6E1 2V8JA 1ML8A 5D1PA 1Y1VS 2DE7A 2JA6I 1VQP1 3CD61 2M6NA 5FLMI 2GTIA 4MH4A 4DGLA 2KPIA 3S1NI 3G4S1 2RBLA 2JA5I 3U50C 3S15I 3G6EZ 1YI21 3TE5B 3K7AI 1PFTA 1VQO1 1YIT1 3CD6Z 2QEX1 1VQPZ 2Q4ZA 4QTTA 1TWHI 1I50I 1RLYA 3HOZI 3J80b 2JUBA 3G4SZ 1JJ2Y 2AKLA 2DE6A 2QKDA 1VQ91 2OTJ1 3M3YI 2LFUA 3BG1B 4E31A 1YITZ 1K8A2 1VQMZ 3PO2I 2RT9A 2F4MA 4X6AI 1Q7Y2 4MRIA 3CCM1 3CCJ1 3VTNA 3FQQA 4RVGA 1VQ9Z 4NH1C 1WIIA 1KC82 2OTJZ 3CXCY 3VMHA 3CCR1 3CPWY 2IZ4A 3PO3I 1P9NA 3J81b 2GTHA 1S7MA 2NVTI 1Z02A 4XX2A 3CCU1 4EWCA 3GTPI 2JNYA 3CCMZ 4QTUA 3CCJZ 3JAMb 2LIYA 3PO3S 2K3RA 3NFZA 4A93I 4NFRA 5C4JI 1NP6A 2RHBA 1K8A1 4HH4A 1Y1WI 3I561 1Q7Y1 2R6MA 3MONA 2JA8I 4TNUA 3JAMf 3CCUZ 1M1K1 4MD7A 3VB9A 3HOYI 1TWGI 4NBAA 4MONA 2QR1B 3HOXI 1KC81 3CC21 2M48A 5T6BA 2GU2A 2QRDB 1YUAA 3GTKI 2O53A 4MXUA 1JJ2Z 1Z03A 1YUKA 4E32A 3HOUI 3IFUA 3I56Z 3NH5A 2DE5A 2E2HI 1KQSY 3GTOI 1YIJ1 3F3FC 3NDIA 2V8KA 5IT9b 3CC2Z 1K9M2 3OW2Y 2E9HA 4DQYB 1VQ81 4MD8A 3I551 1QVFY 4Y52I 1VLAA 3S17I 3GTLI 3KIHA 2I3CA 1M902 3GTMS 1TWCI 1VQL1 5IT9f 1W2BZ 5D1OB 2EGTA 1YIJZ 1VQ71 4RVFA 2NVXI 1VQ8Z 2VUGA 3I55Z 2JA7I 2W04A 4NB9A 2PMZA 2NVQI 2KI7B 1VQLZ 4BY7I 5IP7I 1K9M1 4NBBA 1S721 1WW9A 3D6WA 5C44I 1VQ7Z 3CCL1 1Q821 4A3II 2J6AA 2JS4A 3KIFA 1K83I 1I6HI 3P5JB 4NBGA 2V8IA 1I3QI 5LL6f 1YI2Z 1USPB 3LUSA 1RO4A 1RO2A 1VQOZ 3IX0A 1S72Z 2OOXB 2QEXZ 4A3FI 1USPA 3CCQ1 3CCLZ 4NB8A 3CC71 4A3KI 4A3JI 2ZAEB 4RVDA 2YADA 3MZLB 4NBEA 1VQ51 4NBFA 4A3EI 1KD12 3HOVI 2QREB 2PK7A 4NOZA 1YHQ1 3CCQZ 3CC7Z 4E2YA 5FLXf 3H3VJ 5A2Qb 1RQFA 1TFIA 3HKZA 5C3EI 4S1TA 1VQ5Z 1QVGY 3EEDA 3CCRZ 4DK1A 2B63I 5A2Qf 3CCS1 1ZB8A 4CL1A 1YHQZ 1K732 4HGZA 3M4OI 4A3BI 4HGYA 4A3GI 4E33A 3HOWI 5T64A 4A3CI 1RNIA 1QYPA 2H85A 1LQLA 3S2DI 3CCSZ 4E2XA 3GTMI 3QWUA 2OZKA 3BG0B 3CQZI 3RZDI 3GKQA 4A3LI 2WAQA 2QLVB 1YJW1 1WCMI 5IP9I 3S16I 4RS4A 2RPRA 1ZH1A 1K731 4Y7NI 2R93I 3CXCZ 3J7A4 3CPWZ 2E2II 4RVHA 1ZB9A 4NBCA 3S1MI 2QA41 4A3MI 3CCE1 2BJOA 4E2WA 2HU9A 3CME1 2OOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT I;  3GCF A;  1USP B;  2F4O A;  3LUS A;  3GTQ I;  1RO4 A;  4XX2 A;  1NUI A;  1L1O C;  3VMG A;  1DL6 A;  3GTJ I;  3GTP I;  2E2J I;  2JNY A;  4A3F I;  4QTU A;  1USP A;  3PO3 S;  4NB8 A;  3Q87 A;  4A3K I;  4A93 I;  1X3Z A;  3I07 A;  5C4J I;  5C4X I;  4A3J I;  3S14 I;  3S1R I;  1Y1W I;  4BBR I;  3I4M I;  4NBE A;  1X3W A;  2YU9 I;  2R7Z I;  2JA8 I;  2HF1 A;  2JR6 A;  4NBF A;  4A3E I;  4NBH A;  5CM2 M;  1Y1V I;  1R9T I;  3HOV I;  3VB9 A;  2PK7 A;  1TWA I;  4NOZ A;  3HOY I;  1TWG I;  3ESW A;  4NBA A;  3HOX I;  4NBD A;  2R92 I;  1YUA A;  2NVY I;  3H3V J;  3GTK I;  1ML8 A;  3GTG I;  1TFI A;  1SFO I;  3HOU I;  3RZO I;  1TWF I;  1Y1V S;  2DE7 A;  5C3E I;  2DE5 A;  2JA6 I;  2E2H I;  5FLM I;  3GTO I;  4MH4 A;  2KPI A;  2B63 I;  3S1N I;  2RBL A;  2JA5 I;  3EER A;  2K5R A;  3U50 C;  1ZB8 A;  3S15 I;  3K7A I;  4Y52 I;  1VLA A;  3M4O I;  3S17 I;  1PFT A;  3H0G I;  3GTL I;  3GTM S;  4A3B I;  3FKI I;  4A3G I;  1TWC I;  3HOW I;  4QTT A;  4A3C I;  1TWH I;  1QYP A;  3VMI A;  1I50 I;  1RLY A;  3HOZ I;  1LQL A;  3S2D I;  3I4N I;  3S2H I;  2AKL A;  2DE6 A;  3GTM I;  3S1Q I;  4BY1 I;  3CQZ I;  3RZD I;  2NVX I;  3GKQ A;  2JA7 I;  3M3Y I;  4NB9 A;  4A3L I;  1N2F A;  2NVQ I;  1WCM I;  4BXX I;  3PO2 I;  5IP9 I;  3S16 I;  4BY7 I;  5IP7 I;  2F4M A;  4X6A I;  2P3Y A;  4NBB A;  1WW9 A;  4Y7N I;  2R93 I;  3D6W A;  5C44 I;  2E2I I;  4A3I I;  2J6A A;  2JS4 A;  2VUM I;  4A3D I;  1ZB9 A;  4NBC A;  3S1M I;  4A3M I;  1K83 I;  2BJO A;  1I6H I;  3VMH A;  4BBS I;  4NBG A;  3PO3 I;  1I3Q I; 
#chains in the Genus database with same CATH topology
 3GCF A;  2F4O A;  2VPZ A;  1YJW Z;  5D1O A;  1NUI A;  1L1O C;  3CMA 1;  1DL6 A;  1AA6 A;  2JMO A;  2E2J I;  1QVG Z;  1X3Z A;  3I07 A;  3NH8 A;  5C4X I;  3F3P C;  3S1R I;  2QA4 Z;  3CCE Z;  4BBR I;  1Z01 A;  3CME Z;  1M90 1;  1X0T A;  1X3W A;  2YU9 I;  2R7Z I;  2G2K A;  5CM2 M;  3CMA Z;  1JWH C;  1TWA I;  3ESW A;  1YJN 1;  2PM9 A;  3G71 1;  1N8R 2;  2OTL 1;  2NVY I;  1KRL A;  3CC4 1;  1KQS Z;  2LEX A;  2W03 A;  1VQM 1;  3GTG I;  1SFO I;  1NJI 2;  3RZO I;  1TWF I;  2Q51 A;  3MZK B;  1Q81 2;  3FQM A;  3OW2 Z;  5T67 A;  3T4N B;  5FLX b;  4RV9 A;  1QVF Z;  4E2Z A;  1YJN Z;  3EER A;  2K5R A;  3G71 Z;  2OTL Z;  3J80 f;  1RO0 A;  1VQ4 1;  1Q16 A;  3CC4 Z;  3H0G I;  2O4H A;  2WB1 A;  3FKI I;  3D9X A;  3VMI A;  1N8R 1;  1M1K 2;  1VQN 1;  1YJ9 1;  3I4N I;  3S2H I;  2RIQ A;  1NJI 1;  3S1Q I;  1W2B Y;  4BY1 I;  1VQ4 Z;  1Q81 1;  1FDI A;  1Q86 2;  1N2F A;  2Y0S A;  4BXX I;  1KD1 1;  3J81 f;  2P3Y A;  1VQN Z;  1YJ9 Z;  1VQK 1;  2VUM I;  4A3D I;  4MD9 A;  3NDJ A;  4BBS I;  4AYB A;  3IF8 A;  3GTQ I;  3VMG A;  4E30 A;  3GTJ I;  3CCV 1;  1VQK Z;  1VQ6 1;  1Q86 1;  1QF8 A;  3Q87 A;  2QRC B;  3S14 I;  3TDH B;  2VF1 A;  3I4M I;  2HF1 A;  2JR6 A;  3NH4 A;  4NBH A;  5AN9 F;  1Y1V I;  1R9T I;  2JIO A;  2V45 A;  3CCV Z;  4NBD A;  2IZ3 A;  1VQ6 Z;  1Q82 2;  2P28 A;  2AYD A;  2R92 I;  2NAP A;  3G6E 1;  2V8J A;  1ML8 A;  5D1P A;  1Y1V S;  2DE7 A;  2JA6 I;  1VQP 1;  3CD6 1;  2M6N A;  5FLM I;  2GTI A;  4MH4 A;  4DGL A;  2KPI A;  3S1N I;  3G4S 1;  2RBL A;  2JA5 I;  3U50 C;  3S15 I;  3G6E Z;  1YI2 1;  3TE5 B;  3K7A I;  1PFT A;  1VQO 1;  1YIT 1;  3CD6 Z;  2QEX 1;  1VQP Z;  2Q4Z A;  4QTT A;  1SIW A;  1TWH I;  1I50 I;  1RLY A;  3HOZ I;  3J80 b;  2JUB A;  3G4S Z;  1JJ2 Y;  2AKL A;  2DE6 A;  2QKD A;  1VQ9 1;  2OTJ 1;  3M3Y I;  2LFU A;  3BG1 B;  4E31 A;  1YIT Z;  3IR7 A;  1K8A 2;  1VQM Z;  3PO2 I;  2JIQ A;  2F4M A;  2RT9 A;  4X6A I;  1Q7Y 2;  4MRI A;  3CCM 1;  3CCJ 1;  3VTN A;  2IV2 X;  3FQQ A;  4RVG A;  1VQ9 Z;  4NH1 C;  1WII A;  1KC8 2;  2OTJ Z;  3CXC Y;  3VMH A;  3CCR 1;  3CPW Y;  2IZ4 A;  3PO3 I;  1P9N A;  3J81 b;  2GTH A;  1S7M A;  2NVT I;  1Z02 A;  4XX2 A;  3CCU 1;  4EWC A;  3GTP I;  2JNY A;  3CCM Z;  4QTU A;  3CCJ Z;  3JAM b;  2LIY A;  3PO3 S;  2K3R A;  3NFZ A;  4A93 I;  4NFR A;  5C4J I;  1NP6 A;  2RHB A;  1K8A 1;  4HH4 A;  1Y1W I;  3I56 1;  1Q7Y 1;  2R6M A;  3MON A;  2JA8 I;  4TNU A;  3JAM f;  3CCU Z;  1M1K 1;  4MD7 A;  3VB9 A;  2VPY A;  3HOY I;  1TWG I;  4NBA A;  4MON A;  2QR1 B;  3HOX I;  1KC8 1;  3CC2 1;  2M48 A;  5T6B A;  2GU2 A;  2QRD B;  1YUA A;  3GTK I;  2O53 A;  4MXU A;  1JJ2 Z;  1Z03 A;  1YUK A;  4E32 A;  3HOU I;  3IFU A;  3I56 Z;  3NH5 A;  2DE5 A;  2E2H I;  1KQS Y;  3GTO I;  1QXF A;  1YIJ 1;  3F3F C;  3NDI A;  2V8K A;  5IT9 b;  3CC2 Z;  1K9M 2;  3OW2 Y;  2E9H A;  4DQY B;  1VQ8 1;  4MD8 A;  3I55 1;  1QVF Y;  4Y52 I;  1VLA A;  3S17 I;  3GTL I;  3KIH A;  2I3C A;  1M90 2;  3GTM S;  1TWC I;  1VQL 1;  5IT9 f;  1FDO A;  1W2B Z;  5D1O B;  2EGT A;  1YIJ Z;  1VQ7 1;  4RVF A;  2E7Z A;  2JIR A;  2VPW A;  2NVX I;  1VQ8 Z;  2VUG A;  1Y8C A;  3I55 Z;  2VPX A;  2JA7 I;  2W04 A;  4NB9 A;  2PMZ A;  2NVQ I;  1WZN A;  2KI7 B;  1VQL Z;  4BY7 I;  5IP7 I;  1K9M 1;  4NBB A;  1S72 1;  1WW9 A;  3D6W A;  5C44 I;  1VQ7 Z;  3CCL 1;  1Q82 1;  4A3I I;  2J6A A;  2JS4 A;  3KIF A;  1K83 I;  1I6H I;  3P5J B;  4NBG A;  2V8I A;  1I3Q I;  5LL6 f;  1YI2 Z;  1USP B;  3LUS A;  1RO4 A;  1RO2 A;  1VQO Z;  3IX0 A;  1S72 Z;  2OOX B;  2QEX Z;  4A3F I;  1USP A;  3CCQ 1;  3CCL Z;  4NB8 A;  3CC7 1;  4A3K I;  4A3J I;  2ZAE B;  4RVD A;  2YAD A;  3MZL B;  4NBE A;  1VQ5 1;  4NBF A;  4A3E I;  1KD1 2;  3HOV I;  2QRE B;  2PK7 A;  4NOZ A;  3D2L A;  1WJ2 A;  1YHQ 1;  3CCQ Z;  3CC7 Z;  4E2Y A;  5FLX f;  3H3V J;  5A2Q b;  1RQF A;  1TFI A;  3HKZ A;  5C3E I;  4S1T A;  1VQ5 Z;  1QVG Y;  3EED A;  3CCR Z;  4DK1 A;  2B63 I;  5A2Q f;  3CCS 1;  1ZB8 A;  4CL1 A;  1YHQ Z;  1K73 2;  4HGZ A;  3M4O I;  4A3B I;  4HGY A;  4A3G I;  4E33 A;  3HOW I;  5T64 A;  4A3C I;  1RNI A;  1QYP A;  2H85 A;  1LQL A;  3S2D I;  3CCS Z;  2JIM A;  4E2X A;  3GTM I;  3QWU A;  2OZK A;  3BG0 B;  3CQZ I;  3RZD I;  2V3V A;  3GKQ A;  2JIP A;  4A3L I;  2WAQ A;  2QLV B;  1YJW 1;  1WCM I;  5IP9 I;  3S16 I;  4RS4 A;  2RPR A;  1ZH1 A;  1K73 1;  4Y7N I;  2R93 I;  3CXC Z;  3J7A 4;  3CPW Z;  2E2I I;  4RVH A;  1ZB9 A;  4NBC A;  3S1M I;  2QA4 1;  3CCE 1;  2BJO A;  4A3M I;  4E2W A;  2HU9 A;  3CME 1;  2OOY B; 
#chains in the Genus database with same CATH homology
 3GCF A;  2F4O A;  1YJW Z;  5D1O A;  1NUI A;  1L1O C;  3CMA 1;  1DL6 A;  2JMO A;  2E2J I;  1QVG Z;  1X3Z A;  3I07 A;  3NH8 A;  5C4X I;  3F3P C;  3S1R I;  2QA4 Z;  3CCE Z;  4BBR I;  1Z01 A;  3CME Z;  1M90 1;  1X0T A;  1X3W A;  2YU9 I;  2R7Z I;  2G2K A;  5CM2 M;  3CMA Z;  1JWH C;  1TWA I;  3ESW A;  1YJN 1;  2PM9 A;  3G71 1;  1N8R 2;  2OTL 1;  2NVY I;  1KRL A;  3CC4 1;  1KQS Z;  2W03 A;  1VQM 1;  3GTG I;  1SFO I;  1NJI 2;  3RZO I;  1TWF I;  2Q51 A;  3MZK B;  1Q81 2;  3FQM A;  3OW2 Z;  5T67 A;  3T4N B;  5FLX b;  4RV9 A;  1QVF Z;  4E2Z A;  1YJN Z;  3EER A;  2K5R A;  3G71 Z;  2OTL Z;  3J80 f;  1RO0 A;  1VQ4 1;  3CC4 Z;  3H0G I;  2O4H A;  2WB1 A;  3FKI I;  3D9X A;  3VMI A;  1N8R 1;  1M1K 2;  1VQN 1;  1YJ9 1;  3I4N I;  3S2H I;  2RIQ A;  1NJI 1;  3S1Q I;  1W2B Y;  4BY1 I;  1VQ4 Z;  1Q81 1;  1Q86 2;  1N2F A;  2Y0S A;  4BXX I;  1KD1 1;  3J81 f;  2P3Y A;  1VQN Z;  1YJ9 Z;  1VQK 1;  2VUM I;  4A3D I;  4MD9 A;  3NDJ A;  4BBS I;  4AYB A;  3IF8 A;  3GTQ I;  3VMG A;  4E30 A;  3GTJ I;  3CCV 1;  1VQK Z;  1VQ6 1;  1Q86 1;  1QF8 A;  3Q87 A;  2QRC B;  3S14 I;  3TDH B;  2VF1 A;  3I4M I;  2HF1 A;  2JR6 A;  3NH4 A;  4NBH A;  5AN9 F;  1Y1V I;  1R9T I;  3CCV Z;  4NBD A;  2IZ3 A;  1VQ6 Z;  1Q82 2;  2P28 A;  2R92 I;  3G6E 1;  2V8J A;  1ML8 A;  5D1P A;  1Y1V S;  2DE7 A;  2JA6 I;  1VQP 1;  3CD6 1;  2M6N A;  5FLM I;  2GTI A;  4MH4 A;  4DGL A;  2KPI A;  3S1N I;  3G4S 1;  2RBL A;  2JA5 I;  3U50 C;  3S15 I;  3G6E Z;  1YI2 1;  3TE5 B;  3K7A I;  1PFT A;  1VQO 1;  1YIT 1;  3CD6 Z;  2QEX 1;  1VQP Z;  2Q4Z A;  4QTT A;  1TWH I;  1I50 I;  1RLY A;  3HOZ I;  3J80 b;  2JUB A;  3G4S Z;  1JJ2 Y;  2AKL A;  2DE6 A;  2QKD A;  1VQ9 1;  2OTJ 1;  3M3Y I;  2LFU A;  3BG1 B;  4E31 A;  1YIT Z;  1K8A 2;  1VQM Z;  3PO2 I;  2RT9 A;  2F4M A;  4X6A I;  1Q7Y 2;  4MRI A;  3CCM 1;  3CCJ 1;  3VTN A;  3FQQ A;  4RVG A;  1VQ9 Z;  4NH1 C;  1WII A;  1KC8 2;  2OTJ Z;  3CXC Y;  3VMH A;  3CCR 1;  3CPW Y;  2IZ4 A;  3PO3 I;  1P9N A;  3J81 b;  2GTH A;  1S7M A;  2NVT I;  1Z02 A;  4XX2 A;  3CCU 1;  4EWC A;  3GTP I;  2JNY A;  3CCM Z;  4QTU A;  3CCJ Z;  3JAM b;  2LIY A;  3PO3 S;  2K3R A;  3NFZ A;  4A93 I;  4NFR A;  5C4J I;  1NP6 A;  2RHB A;  1K8A 1;  4HH4 A;  1Y1W I;  3I56 1;  1Q7Y 1;  2R6M A;  3MON A;  2JA8 I;  4TNU A;  3JAM f;  3CCU Z;  1M1K 1;  4MD7 A;  3VB9 A;  3HOY I;  1TWG I;  4NBA A;  4MON A;  2QR1 B;  3HOX I;  1KC8 1;  3CC2 1;  2M48 A;  5T6B A;  2GU2 A;  2QRD B;  1YUA A;  3GTK I;  2O53 A;  4MXU A;  1JJ2 Z;  1Z03 A;  1YUK A;  4E32 A;  3HOU I;  3IFU A;  3I56 Z;  3NH5 A;  2DE5 A;  2E2H I;  1KQS Y;  3GTO I;  1YIJ 1;  3F3F C;  3NDI A;  2V8K A;  5IT9 b;  3CC2 Z;  1K9M 2;  3OW2 Y;  2E9H A;  4DQY B;  1VQ8 1;  4MD8 A;  3I55 1;  1QVF Y;  4Y52 I;  1VLA A;  3S17 I;  3GTL I;  3KIH A;  2I3C A;  1M90 2;  3GTM S;  1TWC I;  1VQL 1;  5IT9 f;  1W2B Z;  5D1O B;  2EGT A;  1YIJ Z;  1VQ7 1;  4RVF A;  2NVX I;  1VQ8 Z;  2VUG A;  3I55 Z;  2JA7 I;  2W04 A;  4NB9 A;  2PMZ A;  2NVQ I;  2KI7 B;  1VQL Z;  4BY7 I;  5IP7 I;  1K9M 1;  4NBB A;  1S72 1;  1WW9 A;  3D6W A;  5C44 I;  1VQ7 Z;  3CCL 1;  1Q82 1;  4A3I I;  2J6A A;  2JS4 A;  3KIF A;  1K83 I;  1I6H I;  3P5J B;  4NBG A;  2V8I A;  1I3Q I;  5LL6 f;  1YI2 Z;  1USP B;  3LUS A;  1RO4 A;  1RO2 A;  1VQO Z;  3IX0 A;  1S72 Z;  2OOX B;  2QEX Z;  4A3F I;  1USP A;  3CCQ 1;  3CCL Z;  4NB8 A;  3CC7 1;  4A3K I;  4A3J I;  2ZAE B;  4RVD A;  2YAD A;  3MZL B;  4NBE A;  1VQ5 1;  4NBF A;  4A3E I;  1KD1 2;  3HOV I;  2QRE B;  2PK7 A;  4NOZ A;  1YHQ 1;  3CCQ Z;  3CC7 Z;  4E2Y A;  5FLX f;  3H3V J;  5A2Q b;  1RQF A;  1TFI A;  3HKZ A;  5C3E I;  4S1T A;  1VQ5 Z;  1QVG Y;  3EED A;  3CCR Z;  4DK1 A;  2B63 I;  5A2Q f;  3CCS 1;  1ZB8 A;  4CL1 A;  1YHQ Z;  1K73 2;  4HGZ A;  3M4O I;  4A3B I;  4HGY A;  4A3G I;  4E33 A;  3HOW I;  5T64 A;  4A3C I;  1RNI A;  1QYP A;  2H85 A;  1LQL A;  3S2D I;  3CCS Z;  4E2X A;  3GTM I;  3QWU A;  2OZK A;  3BG0 B;  3CQZ I;  3RZD I;  3GKQ A;  4A3L I;  2WAQ A;  2QLV B;  1YJW 1;  1WCM I;  5IP9 I;  3S16 I;  4RS4 A;  2RPR A;  1ZH1 A;  1K73 1;  4Y7N I;  2R93 I;  3CXC Z;  3J7A 4;  3CPW Z;  2E2I I;  4RVH A;  1ZB9 A;  4NBC A;  3S1M I;  2QA4 1;  4A3M I;  3CCE 1;  2BJO A;  4E2W A;  2HU9 A;  3CME 1;  2OOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...