2VUMI

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI02
3HOYI 4BBRI 3VMHA 4BXXI 2JNYA 3GKQA 3U50C 4A3FI 4A3II 3H0GI 2R92I 3GTQI 1WCMI 1Y1VS 2JA7I 3GTPI 3S2HI 4A93I 4A3LI 3HOUI 1TWFI 2R7ZI 3VMIA 2R93I 4X6AI 2DE6A 1ML8A 4NBHA 1Y1WI 2KPIA 1PFTA 4BY1I 1L1OC 1USPA 2AKLA 2HF1A 3S15I 4NBGA 4NBBA 2NVYI 3VB9A 4A3EI 1TWGI 1I6HI 1NUIA 3M3YI 3PO3S 1TWAI 3D6WA 1Y1VI 1RLYA 5C44I 2BJOA 2RBLA 4NB8A 2DE7A 2JR6A 3GTMS 4BBSI 1VLAA 1I3QI 1LQLA 5C3EI 3S14I 1SFOI 1RO4A 2P3YA 4A3BI 1ZB9A 2NVTI 1TWHI 1X3ZA 2JA6I 1K83I 5C4XI 4NBDA 4NOZA 2F4MA 1DL6A 4NBCA 3S1NI 5CM2M 3S2DI 1TWCI 3VMGA 3PO3I 3EERA 4A3CI 3S1MI 1QYPA 3S1RI 3RZDI 1ZB8A 3GTOI 1TFIA 3S1QI 3GTMI 2PK7A 3GTJI 1N2FA 1USPB 1R9TI 3HOXI 3ESWA 2E2HI 4NBFA 4NBEA 4A3MI 3I07A 5FLMI 3LUSA 4A3KI 3H3VJ 4A3GI 2DE5A 3CQZI 3K7AI 2J6AA 4XX2A 4Y52I 2K5RA 4QTUA 2NVQI 4A3JI 4A3DI 3GTGI 4BY7I 3GTKI 4Y7NI 2E2JI 4MH4A 1X3WA 3Q87A 4NBAA 2JA5I 2JS4A 2NVXI 3FKII 4QTTA 1YUAA 3I4NI 2F4OA 3S16I 4NB9A 2VUMI 1WW9A 2YU9I 3I4MI 3HOZI 2E2II 5IP9I 3HOVI 3GCFA 2B63I 3S17I 2JA8I 5C4JI 3HOWI 3PO2I 3M4OI 5IP7I 1I50I 3RZOI 3GTLI
chains in the Genus database with same CATH superfamily
5A2Qb 3HOYI 3FQMA 3CCJZ 4MONA 4BBRI 4BXXI 4A3FI 3H0GI 2R92I 1VQP1 1QF8A 3GTQI 3HOUI 1TWFI 2QKDA 2OTJ1 1Q7Y1 1SIWA 3CMAZ 1Q7Y2 3J81b 1L1OC 1ZH1A 3IF8A 2RPRA 2ZAEB 4RVFA 3D9XA 3IR7A 1Q861 1Q862 3CCUZ 1YIJZ 1RLYA 3CME1 1NP6A 2BJOA 5C44I 1VQPZ 3GTMS 4RVGA 1KC81 5T64A 3G4S1 1KC82 2LFUA 3J80b 2OTJZ 2P3YA 4A3BI 2P28A 1TWHI 1K83I 4NBDA 4NBCA 3S2DI 3CXCZ 3PO3I 1X0TA 1FDIA 4DGLA 4E2ZA 2JIOA 3T4NB 3GTJI 4AYBA 2O4HA 2QREB 4A3MI 2E7ZA 5FLMI 3CD6Z 5D1OA 3CCLZ 3I55Z 1QVGZ 1VQOZ 1QVFY 1VQ4Z 4QTUA 2JUBA 2OTL1 3GTGI 1JJ2Y 2W04A 1VQ61 2KI7B 3FKII 4QTTA 3S16I 4E30A 3BG1B 3CPWZ 4EWCA 5IP9I 1YJN1 2B63I 1N8R1 1VQ81 1VQ5Z 2VPWA 2JA8I 2LEXA 3CCMZ 3M4OI 1FDOA 1I50I 1WIIA 3CCV1 3JAMf 1VQL1 3CCJ1 1KQSZ 4RS4A 2OTLZ 2AYDA 1Z01A 3CC2Z 2JNYA 2I3CA 3GKQA 2GTIA 2GU2A 1VQ6Z 3G6E1 2JA7I 4A93I 3NH4A 3NFZA 2QRDB 2K3RA 1VQ8Z 3CMA1 4MXUA 2DE6A 4HH4A 1ML8A 5FLXb 4E2WA 2KPIA 2PM9A 3CCSZ 1VQNZ 1USPA 3CCVZ 1RQFA 1YJ91 1W2BY 2AKLA 1K731 3TDHB 2NVYI 3VB9A 5LL6f 1K732 1I6HI 4RV9A 3CCEZ 3PO3S 2O53A 1VQ7Z 3I561 1TWAI 3CCU1 1YIJ1 3G6EZ 4NB8A 4BBSI 4E32A 4NH1C 3J7A4 1YI21 1I3QI 1VQMZ 5C3EI 2JMOA 1YJWZ 1SFOI 1ZB9A 2NVTI 2JA6I 2H85A 2F4MA 4MRIA 3S1NI 1AA6A 1YJ9Z 1Z03A 2V45A 3S1MI 1TFIA 2PK7A 2WAQA 1USPB 2V8KA 3I56Z 2JIMA 4NBFA 2RIQA 2Y0SA 1S72Z 1YI2Z 3CD61 2DE5A 3CCL1 3I551 2VPZA 3CQZI 1VQO1 3K7AI 4XX2A 4DK1A 1VQ41 4A3DI 2QEXZ 4BY7I 4E2XA 4MH4A 3Q87A 4NBAA 1QXFA 1M901 4NB9A 1M902 3HOVI 2QA41 3GCFA 3CXCY 1VQ51 1K8A1 5C4JI 2OZKA 3CCM1 1K8A2 3HOWI 3P5JB 1NJI1 3RZOI 1NJI2 1WJ2A 3CC21 5IT9f 4A3II 1KD11 1QVFZ 1KD12 1YHQ1 1JJ2Z 3GTPI 2RHBA 3VMIA 2QA4Z 3MONA 2R93I 3OW2Y 2VUGA 1N8R2 2NAPA 2R6MA 3CCS1 2HU9A 1PFTA 1Y8CA 3CC71 3IFUA 1VQN1 4MD9A 1TWGI 2PMZA 3JAMb 3CCE1 1VQ71 3M3YI 4E2YA 1Y1VI 3NH8A 2RBLA 2DE7A 2JR6A 2M48A 1YHQZ 1K9M1 4E31A 2V8JA 1VQM1 1K9M2 1YJW1 1RO4A 1X3ZA 2M6NA 1VQ9Z 4MD7A 3CC7Z 1JWHC 2WB1A 2JIRA 1TWCI 3KIFA 1Z02A 1QYPA 3CC4Z 1ZB8A 3GTOI 3S1QI 4HGYA 1W2BZ 1S721 4RVDA 3LUSA 3H3VJ 5T67A 5A2Qf 2JIQA 3IX0A 3QWUA 2QLVB 2NVQI 4CL1A 2QEX1 4TNUA 3GTKI 4Y7NI 2RT9A 2JA5I 2JS4A 5T6BA 2NVXI 2Q51A 1YUAA 2F4OA 2VUMI 3CCRZ 1RNIA 1WW9A 2YU9I 3J81f 2IZ4A 2E2II 3F3FC 5D1PA 3BG0B 2VPYA 3KIHA 3S17I 2VF1A 3TE5B 2IZ3A 5IP7I 4S1TA 1S7MA 2E9HA 2VPXA 1Q821 1Q16A 1Q822 2G2KA 2LIYA 3VMHA 3U50C 2OOYB 2GTHA 1P9NA 3J80f 1WCMI 1Y1VS 1YIT1 2Q4ZA 3D2LA 4HGZA 3S2HI 4A3LI 2R7ZI 5AN9F 1Q811 4X6AI 1Q812 4NBHA 1Y1WI 4BY1I 1M1K1 3FQQA 3CCQ1 1M1K2 2JIPA 2HF1A 3S15I 4NBGA 4NBBA 4A3EI 1NUIA 3D6WA 1QVGY 3CMEZ 1VQLZ 5IT9b 1VQK1 1VLAA 1YITZ 3G4SZ 2EGTA 3NDJA 1LQLA 4MD8A 3S14I 2YADA 1VQ91 3NH5A 5C4XI 3MZLB 4NOZA 3EEDA 1DL6A 5CM2M 3CPWY 3CCQZ 3VMGA 3G711 3EERA 3OW2Z 4A3CI 1KRLA 3CC41 3S1RI 3RZDI 3GTMI 1N2FA 1R9TI 3HOXI 3ESWA 2E2HI 3NDIA 1RO2A 4NBEA 2IV2X 2QRCB 3VTNA 1KQSY 3I07A 1VQKZ 4A3KI 4A3GI 4DQYB 2V8IA 2V3VA 2J6AA 4Y52I 2K5RA 4A3JI 1WZNA 2W03A 5D1OB 2E2JI 1X3WA 1RO0A 1YUKA 3G71Z 3I4NI 3F3PC 3CCR1 3I4MI 3HOZI 5FLXf 2OOXB 1YJNZ 4RVHA 4NFRA 3HKZA 3MZKB 3PO2I 2QR1B 3GTLI 4E33A
chains in the Genus database with same CATH topology
5A2Qb 3HOYI 3FQMA 3CCJZ 4MONA 4BBRI 4BXXI 4A3FI 3H0GI 2R92I 1VQP1 1QF8A 3GTQI 3HOUI 1TWFI 2QKDA 2OTJ1 1Q7Y1 3CMAZ 1Q7Y2 3J81b 1L1OC 1ZH1A 3IF8A 2RPRA 2ZAEB 4RVFA 3D9XA 1Q861 1Q862 3CCUZ 1YIJZ 1RLYA 3CME1 1NP6A 2BJOA 5C44I 1VQPZ 3GTMS 4RVGA 1KC81 5T64A 3G4S1 1KC82 2LFUA 3J80b 2OTJZ 2P3YA 4A3BI 2P28A 1TWHI 1K83I 4NBDA 4NBCA 3S2DI 3CXCZ 3PO3I 1X0TA 4DGLA 4E2ZA 3T4NB 3GTJI 4AYBA 2O4HA 2QREB 4A3MI 5FLMI 3CD6Z 5D1OA 3CCLZ 3I55Z 1QVGZ 1VQOZ 1QVFY 1VQ4Z 4QTUA 2JUBA 2OTL1 3GTGI 1JJ2Y 2W04A 1VQ61 2KI7B 3FKII 4QTTA 3S16I 4E30A 3BG1B 3CPWZ 4EWCA 5IP9I 1YJN1 2B63I 1N8R1 1VQ81 1VQ5Z 2JA8I 3CCMZ 3M4OI 1WIIA 1I50I 3CCV1 3JAMf 1VQL1 3CCJ1 1KQSZ 4RS4A 2OTLZ 1Z01A 3CC2Z 2JNYA 2I3CA 3GKQA 2GTIA 2GU2A 1VQ6Z 3G6E1 2JA7I 4A93I 3NH4A 3NFZA 2QRDB 2K3RA 1VQ8Z 3CMA1 4MXUA 2DE6A 4HH4A 1ML8A 5FLXb 4E2WA 2KPIA 2PM9A 3CCSZ 1VQNZ 1USPA 3CCVZ 1RQFA 1YJ91 1W2BY 2AKLA 1K731 3TDHB 2NVYI 3VB9A 5LL6f 1K732 1I6HI 4RV9A 3CCEZ 3PO3S 2O53A 1VQ7Z 3I561 1TWAI 3CCU1 1YIJ1 3G6EZ 4NB8A 4BBSI 4E32A 4NH1C 3J7A4 1YI21 1I3QI 1VQMZ 5C3EI 2JMOA 1YJWZ 1SFOI 1ZB9A 2NVTI 2JA6I 2H85A 2F4MA 4MRIA 3S1NI 1YJ9Z 1Z03A 3S1MI 1TFIA 2PK7A 2WAQA 1USPB 2V8KA 3I56Z 4NBFA 2RIQA 2Y0SA 1S72Z 1YI2Z 3CD61 2DE5A 3CCL1 3I551 3CQZI 1VQO1 3K7AI 4XX2A 4DK1A 1VQ41 4A3DI 2QEXZ 4BY7I 4E2XA 4MH4A 3Q87A 4NBAA 1M901 4NB9A 1M902 3HOVI 2QA41 3GCFA 3CXCY 1VQ51 1K8A1 5C4JI 2OZKA 3CCM1 1K8A2 3HOWI 3P5JB 1NJI1 3RZOI 1NJI2 3CC21 5IT9f 4A3II 1KD11 1QVFZ 1KD12 1YHQ1 1JJ2Z 3GTPI 2RHBA 3VMIA 2QA4Z 3MONA 2R93I 3OW2Y 2VUGA 1N8R2 2R6MA 3CCS1 2HU9A 1PFTA 3CC71 3IFUA 1VQN1 4MD9A 1TWGI 2PMZA 3JAMb 3CCE1 1VQ71 3M3YI 4E2YA 1Y1VI 3NH8A 2RBLA 2DE7A 2JR6A 2M48A 1YHQZ 1K9M1 4E31A 2V8JA 1VQM1 1K9M2 1YJW1 1RO4A 1X3ZA 2M6NA 1VQ9Z 4MD7A 3CC7Z 1JWHC 2WB1A 1TWCI 3KIFA 1Z02A 1QYPA 3CC4Z 1ZB8A 3GTOI 3S1QI 4HGYA 1W2BZ 1S721 4RVDA 3LUSA 3H3VJ 5T67A 5A2Qf 3IX0A 3QWUA 2QLVB 2NVQI 4CL1A 2QEX1 4TNUA 3GTKI 4Y7NI 2RT9A 2JA5I 2JS4A 5T6BA 2NVXI 2Q51A 1YUAA 2F4OA 2VUMI 3CCRZ 1RNIA 1WW9A 2YU9I 3J81f 2IZ4A 2E2II 3F3FC 5D1PA 3BG0B 3KIHA 3S17I 2VF1A 3TE5B 2IZ3A 5IP7I 4S1TA 1S7MA 2E9HA 1Q821 1Q822 2G2KA 2LIYA 3VMHA 3U50C 2OOYB 2GTHA 1P9NA 3J80f 1WCMI 1Y1VS 1YIT1 2Q4ZA 4HGZA 3S2HI 4A3LI 2R7ZI 5AN9F 1Q811 4X6AI 1Q812 4NBHA 1Y1WI 4BY1I 1M1K1 3FQQA 3CCQ1 1M1K2 2HF1A 3S15I 4NBGA 4NBBA 4A3EI 1NUIA 3D6WA 1QVGY 3CMEZ 1VQLZ 5IT9b 1VQK1 1VLAA 1YITZ 3G4SZ 2EGTA 3NDJA 1LQLA 4MD8A 3S14I 2YADA 1VQ91 3NH5A 5C4XI 3MZLB 4NOZA 3EEDA 1DL6A 5CM2M 3CPWY 3CCQZ 3VMGA 3G711 3EERA 3OW2Z 4A3CI 1KRLA 3CC41 3S1RI 3RZDI 3GTMI 1N2FA 1R9TI 3HOXI 3ESWA 2E2HI 3NDIA 1RO2A 4NBEA 1KQSY 2QRCB 3VTNA 3I07A 1VQKZ 4A3KI 4A3GI 4DQYB 2V8IA 2J6AA 4Y52I 2K5RA 4A3JI 2W03A 5D1OB 2E2JI 1X3WA 1RO0A 1YUKA 3G71Z 3I4NI 3F3PC 3CCR1 3I4MI 3HOZI 5FLXf 2OOXB 1YJNZ 4RVHA 4NFRA 3HKZA 3MZKB 3PO2I 2QR1B 3GTLI 4E33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY I;  4BBR I;  3VMH A;  4BXX I;  2JNY A;  3GKQ A;  3U50 C;  4A3F I;  4A3I I;  3H0G I;  2R92 I;  3GTQ I;  1WCM I;  1Y1V S;  2JA7 I;  3GTP I;  3S2H I;  4A93 I;  4A3L I;  3HOU I;  1TWF I;  2R7Z I;  3VMI A;  2R93 I;  4X6A I;  2DE6 A;  1ML8 A;  4NBH A;  1Y1W I;  2KPI A;  1PFT A;  4BY1 I;  1L1O C;  1USP A;  2AKL A;  2HF1 A;  3S15 I;  4NBG A;  4NBB A;  2NVY I;  3VB9 A;  4A3E I;  1TWG I;  1I6H I;  1NUI A;  3M3Y I;  3PO3 S;  1TWA I;  3D6W A;  1Y1V I;  1RLY A;  5C44 I;  2BJO A;  2RBL A;  4NB8 A;  2DE7 A;  2JR6 A;  3GTM S;  4BBS I;  1VLA A;  1I3Q I;  1LQL A;  5C3E I;  3S14 I;  1SFO I;  1RO4 A;  2P3Y A;  4A3B I;  1ZB9 A;  2NVT I;  1TWH I;  1X3Z A;  2JA6 I;  1K83 I;  5C4X I;  4NBD A;  4NOZ A;  2F4M A;  1DL6 A;  4NBC A;  3S1N I;  5CM2 M;  3S2D I;  1TWC I;  3VMG A;  3PO3 I;  3EER A;  4A3C I;  3S1M I;  1QYP A;  3S1R I;  3RZD I;  1ZB8 A;  3GTO I;  1TFI A;  3S1Q I;  3GTM I;  2PK7 A;  3GTJ I;  1N2F A;  1USP B;  1R9T I;  3HOX I;  3ESW A;  2E2H I;  4NBF A;  4NBE A;  4A3M I;  3I07 A;  5FLM I;  3LUS A;  4A3K I;  3H3V J;  4A3G I;  2DE5 A;  3CQZ I;  3K7A I;  2J6A A;  4XX2 A;  4Y52 I;  2K5R A;  4QTU A;  2NVQ I;  4A3J I;  4A3D I;  3GTG I;  4BY7 I;  3GTK I;  4Y7N I;  2E2J I;  4MH4 A;  1X3W A;  3Q87 A;  4NBA A;  2JA5 I;  2JS4 A;  2NVX I;  3FKI I;  4QTT A;  1YUA A;  3I4N I;  2F4O A;  3S16 I;  4NB9 A;  2VUM I;  1WW9 A;  2YU9 I;  3I4M I;  3HOZ I;  2E2I I;  5IP9 I;  3HOV I;  3GCF A;  2B63 I;  3S17 I;  2JA8 I;  5C4J I;  3HOW I;  3PO2 I;  3M4O I;  5IP7 I;  1I50 I;  3RZO I;  3GTL I; 
#chains in the Genus database with same CATH topology
 5A2Q b;  3HOY I;  3FQM A;  3CCJ Z;  4MON A;  4BBR I;  4BXX I;  4A3F I;  3H0G I;  2R92 I;  1VQP 1;  1QF8 A;  3GTQ I;  3HOU I;  1TWF I;  2QKD A;  2OTJ 1;  1Q7Y 1;  1SIW A;  3CMA Z;  1Q7Y 2;  3J81 b;  1L1O C;  1ZH1 A;  3IF8 A;  2RPR A;  2ZAE B;  4RVF A;  3D9X A;  3IR7 A;  1Q86 1;  1Q86 2;  3CCU Z;  1YIJ Z;  1RLY A;  3CME 1;  1NP6 A;  2BJO A;  5C44 I;  1VQP Z;  3GTM S;  4RVG A;  1KC8 1;  5T64 A;  3G4S 1;  1KC8 2;  2LFU A;  3J80 b;  2OTJ Z;  2P3Y A;  4A3B I;  2P28 A;  1TWH I;  1K83 I;  4NBD A;  4NBC A;  3S2D I;  3CXC Z;  3PO3 I;  1X0T A;  1FDI A;  4DGL A;  4E2Z A;  2JIO A;  3T4N B;  3GTJ I;  4AYB A;  2O4H A;  2QRE B;  4A3M I;  2E7Z A;  5FLM I;  3CD6 Z;  5D1O A;  3CCL Z;  3I55 Z;  1QVG Z;  1VQO Z;  1QVF Y;  1VQ4 Z;  4QTU A;  2JUB A;  2OTL 1;  3GTG I;  1JJ2 Y;  2W04 A;  1VQ6 1;  2KI7 B;  3FKI I;  4QTT A;  3S16 I;  4E30 A;  3BG1 B;  3CPW Z;  4EWC A;  5IP9 I;  1YJN 1;  2B63 I;  1N8R 1;  1VQ8 1;  1VQ5 Z;  2VPW A;  2JA8 I;  2LEX A;  3CCM Z;  3M4O I;  1FDO A;  1I50 I;  1WII A;  3CCV 1;  3JAM f;  1VQL 1;  3CCJ 1;  1KQS Z;  4RS4 A;  2OTL Z;  2AYD A;  1Z01 A;  3CC2 Z;  2JNY A;  2I3C A;  3GKQ A;  2GTI A;  2GU2 A;  1VQ6 Z;  3G6E 1;  2JA7 I;  4A93 I;  3NH4 A;  3NFZ A;  2QRD B;  2K3R A;  1VQ8 Z;  3CMA 1;  4MXU A;  2DE6 A;  4HH4 A;  1ML8 A;  5FLX b;  4E2W A;  2KPI A;  2PM9 A;  3CCS Z;  1VQN Z;  1USP A;  3CCV Z;  1RQF A;  1YJ9 1;  1W2B Y;  2AKL A;  1K73 1;  3TDH B;  2NVY I;  3VB9 A;  5LL6 f;  1K73 2;  1I6H I;  4RV9 A;  3CCE Z;  3PO3 S;  2O53 A;  1VQ7 Z;  3I56 1;  1TWA I;  3CCU 1;  1YIJ 1;  3G6E Z;  4NB8 A;  4BBS I;  4E32 A;  4NH1 C;  3J7A 4;  1YI2 1;  1I3Q I;  1VQM Z;  5C3E I;  2JMO A;  1YJW Z;  1SFO I;  1ZB9 A;  2NVT I;  2JA6 I;  2H85 A;  2F4M A;  4MRI A;  3S1N I;  1AA6 A;  1YJ9 Z;  1Z03 A;  2V45 A;  3S1M I;  1TFI A;  2PK7 A;  2WAQ A;  1USP B;  2V8K A;  3I56 Z;  2JIM A;  4NBF A;  2RIQ A;  2Y0S A;  1S72 Z;  1YI2 Z;  3CD6 1;  2DE5 A;  3CCL 1;  3I55 1;  2VPZ A;  3CQZ I;  1VQO 1;  3K7A I;  4XX2 A;  4DK1 A;  1VQ4 1;  4A3D I;  2QEX Z;  4BY7 I;  4E2X A;  4MH4 A;  3Q87 A;  4NBA A;  1QXF A;  1M90 1;  4NB9 A;  1M90 2;  3HOV I;  2QA4 1;  3GCF A;  3CXC Y;  1VQ5 1;  1K8A 1;  5C4J I;  2OZK A;  3CCM 1;  1K8A 2;  3HOW I;  3P5J B;  1NJI 1;  3RZO I;  1NJI 2;  1WJ2 A;  3CC2 1;  5IT9 f;  4A3I I;  1KD1 1;  1QVF Z;  1KD1 2;  1YHQ 1;  1JJ2 Z;  3GTP I;  2RHB A;  3VMI A;  2QA4 Z;  3MON A;  2R93 I;  3OW2 Y;  2VUG A;  1N8R 2;  2NAP A;  2R6M A;  3CCS 1;  2HU9 A;  1PFT A;  1Y8C A;  3CC7 1;  3IFU A;  1VQN 1;  4MD9 A;  1TWG I;  2PMZ A;  3JAM b;  3CCE 1;  1VQ7 1;  3M3Y I;  4E2Y A;  1Y1V I;  3NH8 A;  2RBL A;  2DE7 A;  2JR6 A;  2M48 A;  1YHQ Z;  1K9M 1;  4E31 A;  2V8J A;  1VQM 1;  1K9M 2;  1YJW 1;  1RO4 A;  1X3Z A;  2M6N A;  1VQ9 Z;  4MD7 A;  3CC7 Z;  1JWH C;  2WB1 A;  2JIR A;  1TWC I;  3KIF A;  1Z02 A;  1QYP A;  3CC4 Z;  1ZB8 A;  3GTO I;  3S1Q I;  4HGY A;  1W2B Z;  1S72 1;  4RVD A;  3LUS A;  3H3V J;  5T67 A;  5A2Q f;  2JIQ A;  3IX0 A;  3QWU A;  2QLV B;  2NVQ I;  4CL1 A;  2QEX 1;  4TNU A;  3GTK I;  4Y7N I;  2RT9 A;  2JA5 I;  2JS4 A;  5T6B A;  2NVX I;  2Q51 A;  1YUA A;  2F4O A;  2VUM I;  3CCR Z;  1RNI A;  1WW9 A;  2YU9 I;  3J81 f;  2IZ4 A;  2E2I I;  3F3F C;  5D1P A;  3BG0 B;  2VPY A;  3KIH A;  3S17 I;  2VF1 A;  3TE5 B;  2IZ3 A;  5IP7 I;  4S1T A;  1S7M A;  2E9H A;  2VPX A;  1Q82 1;  1Q16 A;  1Q82 2;  2G2K A;  2LIY A;  3VMH A;  3U50 C;  2OOY B;  2GTH A;  1P9N A;  3J80 f;  1WCM I;  1Y1V S;  1YIT 1;  2Q4Z A;  3D2L A;  4HGZ A;  3S2H I;  4A3L I;  2R7Z I;  5AN9 F;  1Q81 1;  4X6A I;  1Q81 2;  4NBH A;  1Y1W I;  4BY1 I;  1M1K 1;  3FQQ A;  3CCQ 1;  1M1K 2;  2JIP A;  2HF1 A;  3S15 I;  4NBG A;  4NBB A;  4A3E I;  1NUI A;  3D6W A;  1QVG Y;  3CME Z;  1VQL Z;  5IT9 b;  1VQK 1;  1VLA A;  1YIT Z;  3G4S Z;  2EGT A;  3NDJ A;  1LQL A;  4MD8 A;  3S14 I;  2YAD A;  1VQ9 1;  3NH5 A;  5C4X I;  3MZL B;  4NOZ A;  3EED A;  1DL6 A;  5CM2 M;  3CPW Y;  3CCQ Z;  3VMG A;  3G71 1;  3EER A;  3OW2 Z;  4A3C I;  1KRL A;  3CC4 1;  3S1R I;  3RZD I;  3GTM I;  1N2F A;  1R9T I;  3HOX I;  3ESW A;  2E2H I;  3NDI A;  1RO2 A;  4NBE A;  2IV2 X;  2QRC B;  3VTN A;  1KQS Y;  3I07 A;  1VQK Z;  4A3K I;  4A3G I;  4DQY B;  2V8I A;  2V3V A;  2J6A A;  4Y52 I;  2K5R A;  4A3J I;  1WZN A;  2W03 A;  5D1O B;  2E2J I;  1X3W A;  1RO0 A;  1YUK A;  3G71 Z;  3I4N I;  3F3P C;  3CCR 1;  3I4M I;  3HOZ I;  5FLX f;  2OOX B;  1YJN Z;  4RVH A;  4NFR A;  3HKZ A;  3MZK B;  3PO2 I;  2QR1 B;  3GTL I;  4E33 A; 
#chains in the Genus database with same CATH homology
 5A2Q b;  3HOY I;  3FQM A;  3CCJ Z;  4MON A;  4BBR I;  4BXX I;  4A3F I;  3H0G I;  2R92 I;  1VQP 1;  1QF8 A;  3GTQ I;  3HOU I;  1TWF I;  2QKD A;  2OTJ 1;  1Q7Y 1;  3CMA Z;  1Q7Y 2;  3J81 b;  1L1O C;  1ZH1 A;  3IF8 A;  2RPR A;  2ZAE B;  4RVF A;  3D9X A;  1Q86 1;  1Q86 2;  3CCU Z;  1YIJ Z;  1RLY A;  3CME 1;  1NP6 A;  2BJO A;  5C44 I;  1VQP Z;  3GTM S;  4RVG A;  1KC8 1;  5T64 A;  3G4S 1;  1KC8 2;  2LFU A;  3J80 b;  2OTJ Z;  2P3Y A;  4A3B I;  2P28 A;  1TWH I;  1K83 I;  4NBD A;  4NBC A;  3S2D I;  3CXC Z;  3PO3 I;  1X0T A;  4DGL A;  4E2Z A;  3T4N B;  3GTJ I;  4AYB A;  2O4H A;  2QRE B;  4A3M I;  5FLM I;  3CD6 Z;  5D1O A;  3CCL Z;  3I55 Z;  1QVG Z;  1VQO Z;  1QVF Y;  1VQ4 Z;  4QTU A;  2JUB A;  2OTL 1;  3GTG I;  1JJ2 Y;  2W04 A;  1VQ6 1;  2KI7 B;  3FKI I;  4QTT A;  3S16 I;  4E30 A;  3BG1 B;  3CPW Z;  4EWC A;  5IP9 I;  1YJN 1;  2B63 I;  1N8R 1;  1VQ8 1;  1VQ5 Z;  2JA8 I;  3CCM Z;  3M4O I;  1WII A;  1I50 I;  3CCV 1;  3JAM f;  1VQL 1;  3CCJ 1;  1KQS Z;  4RS4 A;  2OTL Z;  1Z01 A;  3CC2 Z;  2JNY A;  2I3C A;  3GKQ A;  2GTI A;  2GU2 A;  1VQ6 Z;  3G6E 1;  2JA7 I;  4A93 I;  3NH4 A;  3NFZ A;  2QRD B;  2K3R A;  1VQ8 Z;  3CMA 1;  4MXU A;  2DE6 A;  4HH4 A;  1ML8 A;  5FLX b;  4E2W A;  2KPI A;  2PM9 A;  3CCS Z;  1VQN Z;  1USP A;  3CCV Z;  1RQF A;  1YJ9 1;  1W2B Y;  2AKL A;  1K73 1;  3TDH B;  2NVY I;  3VB9 A;  5LL6 f;  1K73 2;  1I6H I;  4RV9 A;  3CCE Z;  3PO3 S;  2O53 A;  1VQ7 Z;  3I56 1;  1TWA I;  3CCU 1;  1YIJ 1;  3G6E Z;  4NB8 A;  4BBS I;  4E32 A;  4NH1 C;  3J7A 4;  1YI2 1;  1I3Q I;  1VQM Z;  5C3E I;  2JMO A;  1YJW Z;  1SFO I;  1ZB9 A;  2NVT I;  2JA6 I;  2H85 A;  2F4M A;  4MRI A;  3S1N I;  1YJ9 Z;  1Z03 A;  3S1M I;  1TFI A;  2PK7 A;  2WAQ A;  1USP B;  2V8K A;  3I56 Z;  4NBF A;  2RIQ A;  2Y0S A;  1S72 Z;  1YI2 Z;  3CD6 1;  2DE5 A;  3CCL 1;  3I55 1;  3CQZ I;  1VQO 1;  3K7A I;  4XX2 A;  4DK1 A;  1VQ4 1;  4A3D I;  2QEX Z;  4BY7 I;  4E2X A;  4MH4 A;  3Q87 A;  4NBA A;  1M90 1;  4NB9 A;  1M90 2;  3HOV I;  2QA4 1;  3GCF A;  3CXC Y;  1VQ5 1;  1K8A 1;  5C4J I;  2OZK A;  3CCM 1;  1K8A 2;  3HOW I;  3P5J B;  1NJI 1;  3RZO I;  1NJI 2;  3CC2 1;  5IT9 f;  4A3I I;  1KD1 1;  1QVF Z;  1KD1 2;  1YHQ 1;  1JJ2 Z;  3GTP I;  2RHB A;  3VMI A;  2QA4 Z;  3MON A;  2R93 I;  3OW2 Y;  2VUG A;  1N8R 2;  2R6M A;  3CCS 1;  2HU9 A;  1PFT A;  3CC7 1;  3IFU A;  1VQN 1;  4MD9 A;  1TWG I;  2PMZ A;  3JAM b;  3CCE 1;  1VQ7 1;  3M3Y I;  4E2Y A;  1Y1V I;  3NH8 A;  2RBL A;  2DE7 A;  2JR6 A;  2M48 A;  1YHQ Z;  1K9M 1;  4E31 A;  2V8J A;  1VQM 1;  1K9M 2;  1YJW 1;  1RO4 A;  1X3Z A;  2M6N A;  1VQ9 Z;  4MD7 A;  3CC7 Z;  1JWH C;  2WB1 A;  1TWC I;  3KIF A;  1Z02 A;  1QYP A;  3CC4 Z;  1ZB8 A;  3GTO I;  3S1Q I;  4HGY A;  1W2B Z;  1S72 1;  4RVD A;  3LUS A;  3H3V J;  5T67 A;  5A2Q f;  3IX0 A;  3QWU A;  2QLV B;  2NVQ I;  4CL1 A;  2QEX 1;  4TNU A;  3GTK I;  4Y7N I;  2RT9 A;  2JA5 I;  2JS4 A;  5T6B A;  2NVX I;  2Q51 A;  1YUA A;  2F4O A;  2VUM I;  3CCR Z;  1RNI A;  1WW9 A;  2YU9 I;  3J81 f;  2IZ4 A;  2E2I I;  3F3F C;  5D1P A;  3BG0 B;  3KIH A;  3S17 I;  2VF1 A;  3TE5 B;  2IZ3 A;  5IP7 I;  4S1T A;  1S7M A;  2E9H A;  1Q82 1;  1Q82 2;  2G2K A;  2LIY A;  3VMH A;  3U50 C;  2OOY B;  2GTH A;  1P9N A;  3J80 f;  1WCM I;  1Y1V S;  1YIT 1;  2Q4Z A;  4HGZ A;  3S2H I;  4A3L I;  2R7Z I;  5AN9 F;  1Q81 1;  4X6A I;  1Q81 2;  4NBH A;  1Y1W I;  4BY1 I;  1M1K 1;  3FQQ A;  3CCQ 1;  1M1K 2;  2HF1 A;  3S15 I;  4NBG A;  4NBB A;  4A3E I;  1NUI A;  3D6W A;  1QVG Y;  3CME Z;  1VQL Z;  5IT9 b;  1VQK 1;  1VLA A;  1YIT Z;  3G4S Z;  2EGT A;  3NDJ A;  1LQL A;  4MD8 A;  3S14 I;  2YAD A;  1VQ9 1;  3NH5 A;  5C4X I;  3MZL B;  4NOZ A;  3EED A;  1DL6 A;  5CM2 M;  3CPW Y;  3CCQ Z;  3VMG A;  3G71 1;  3EER A;  3OW2 Z;  4A3C I;  1KRL A;  3CC4 1;  3S1R I;  3RZD I;  3GTM I;  1N2F A;  1R9T I;  3HOX I;  3ESW A;  2E2H I;  3NDI A;  1RO2 A;  4NBE A;  1KQS Y;  2QRC B;  3VTN A;  3I07 A;  1VQK Z;  4A3K I;  4A3G I;  4DQY B;  2V8I A;  2J6A A;  4Y52 I;  2K5R A;  4A3J I;  2W03 A;  5D1O B;  2E2J I;  1X3W A;  1RO0 A;  1YUK A;  3G71 Z;  3I4N I;  3F3P C;  3CCR 1;  3I4M I;  3HOZ I;  5FLX f;  2OOX B;  1YJN Z;  4RVH A;  4NFR A;  3HKZ A;  3MZK B;  3PO2 I;  2QR1 B;  3GTL I;  4E33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...