2VUMI

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 6
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2vumI02
1TFIA 4QTUA 3S14I 1TWCI 3HOZI 1R9TI 3RZOI 2P3YA 4A3MI 2NVXI 3GTMS 3GTGI 3I4MI 2F4OA 4BY7I 2R93I 4A3KI 3H0GI 2DE6A 3GTOI 2VUMI 5FLMI 2B63I 3S2DI 4BXXI 5IP7I 3GTLI 4X6AI 1Y1VI 1TWAI 4A3GI 4MH4A 2NVTI 4NB9A 5CM2M 2E2HI 3ESWA 4A3EI 3HOXI 5C44I 2HF1A 3PO3S 3I4NI 4NBDA 3GTQI 3HOWI 1Y1WI 5C4JI 1WCMI 1PFTA 2JA8I 2JA7I 2YU9I 4NBBA 2E2JI 2R92I 2DE5A 3GTJI 3S17I 4A93I 5IP9I 4NBFA 4NBGA 1TWFI 1K83I 3S16I 1N2FA 2JA6I 1WW9A 1I3QI 2JS4A 2F4MA 3LUSA 4BBRI 3PO2I 3S1QI 4Y52I 4NBCA 3GTPI 1RLYA 1L1OC 2J6AA 1X3WA 3RZDI 4BY1I 1LQLA 3Q87A 2AKLA 1SFOI 3U50C 3S2HI 1ZB8A 4NB8A 4A3JI 4NBAA 3D6WA 1Y1VS 3I07A 1QYPA 3S1NI 1RO4A 1X3ZA 4BBSI 1I50I 3S1RI 1USPB 4NBEA 3VB9A 3S1MI 3M3YI 4A3BI 4A3DI 4XX2A 1I6HI 3GTMI 4A3FI 2JR6A 3VMGA 2BJOA 2PK7A 3HOVI 3HOUI 5C4XI 2NVQI 2KPIA 3GKQA 2E2II 3K7AI 2RBLA 4A3CI 1VLAA 2R7ZI 1YUAA 1TWHI 2JA5I 4Y7NI 2NVYI 3H3VJ 4NBHA 1USPA 3GTKI 3PO3I 4NOZA 3HOYI 3VMHA 3CQZI 3EERA 4A3II 1ZB9A 3VMIA 1ML8A 4A3LI 2K5RA 5C3EI 2DE7A 1DL6A 4QTTA 1NUIA 3M4OI 3FKII 3GCFA 3S15I 2JNYA 1TWGI
chains in the Genus database with same CATH superfamily
2EGTA 1TWCI 1YHQ1 3HOZI 2NVXI 2LIYA 1QVFY 1QVFZ 4E2WA 4BY7I 1QF8A 3CPWZ 2DE6A 3JAMf 4NH1C 3CD6Z 3GTLI 1Q821 3T4NB 1TWAI 4MH4A 4MXUA 3G711 1M901 5C44I 4RVFA 1Q822 3JAMb 1Q7Y1 2YU9I 4NBBA 2E2JI 3NH8A 2DE5A 1VQ9Z 1M902 3S17I 2VPXA 3IFUA 2Y0SA 1VQLZ 1KQSY 1VQ6Z 3VTNA 1KQSZ 3IR7A 3CCMZ 1N2FA 1I3QI 2JS4A 4BBRI 3CCS1 3S1QI 5FLXf 1VQPZ 1L1OC 2J6AA 1KD11 2E9HA 2V8KA 2JIQA 1YHQZ 3I07A 2OOYB 3CC71 3P5JB 1FDIA 1RO4A 5FLXb 1KD12 4E31A 3S1RI 4RS4A 1M1K1 4A3DI 4XX2A 5T64A 3GTMI 3G6E1 2YADA 1Z03A 3IX0A 2PK7A 3CXCZ 3HOUI 5A2Qf 2QA41 3GKQA 1Q811 2VPWA 3CCU1 3G71Z 1M1K2 1YJ91 1RO2A 1VLAA 2R7ZI 4MRIA 1TWHI 2QLVB 1AA6A 2VPYA 1FDOA 2NVYI 3NDIA 1JWHC 2AYDA 1Q812 3EERA 4A3II 1ZB9A 1ML8A 2K5RA 5A2Qb 1DL6A 5T67A 2PMZA 2WB1A 1TFIA 3S14I 2VUGA 3CCSZ 3TDHB 3GTMS 4RVDA 4HGYA 3CCQ1 1KC81 3I4MI 4RVHA 3NH4A 3J80f 3J81f 4A3KI 4NFRA 1K8A1 2Q4ZA 3S2DI 3CC7Z 1KC82 1S7MA 2GTIA 5CM2M 3MZLB 4A3EI 1W2BY 3HOXI 1W2BZ 1K8A2 3I4NI 4NBDA 3G6EZ 3HOWI 3J80b 3J81b 1SIWA 1YJN1 1WCMI 1PFTA 1VQ71 3MZKB 2QA4Z 1RQFA 2R92I 3GTJI 3CCUZ 2VF1A 1YJ9Z 2R6MA 4NBGA 5D1OA 2I3CA 2JA6I 3CCL1 1WW9A 3I561 3LUSA 3CCE1 2M6NA 4TNUA 2GTHA 4S1TA 2OTL1 3BG0B 4RV9A 5T6BA 3Q87A 4E2XA 1SFOI 3U50C 4NBAA 3CC41 4E2ZA 2QEX1 1VQN1 3S1NI 4E33A 2PM9A 1I50I 2RIQA 3CCQZ 3VB9A 3S1MI 3M3YI 1I6HI 5IT9f 3CMA1 4A3FI 2JR6A 4HGZA 3HOVI 5C4XI 2HU9A 2JIOA 2RBLA 1WZNA 1YUAA 4E30A 1VQ81 1RO0A 5IT9b 1YJW1 3D9XA 3H3VJ 4NBHA 1USPA 1YJNZ 3GTKI 3PO3I 4NOZA 1VQO1 3HOYI 1N8R1 1VQ7Z 3VMIA 5C3EI 2DE7A 2W04A 3QWUA 1JJ2Y 2JIRA 3FKII 3I551 1TWGI 4A93I 3CCLZ 2QREB 3I56Z 1N8R2 2P28A 3CCEZ 3KIFA 2OTLZ 4A3MI 2IZ3A 1YIJ1 3CCR1 1X0TA 2F4OA 3CC4Z 1ZH1A 2OTJ1 2QKDA 3GTOI 2VUMI 2QEXZ 1VQNZ 3D2LA 4EWCA 4X6AI 1Y1VI 4A3GI 1VQ51 2M48A 2NVTI 4NB9A 2E2HI 3PO3S 3ESWA 2HF1A 1Y1WI 3CD61 3J7A4 1KRLA 5IP9I 4NBFA 5AN9F 3NH5A 1K731 1VQ8Z 4E2YA 4Y52I 2F4MA 3CC21 1VQOZ 3PO2I 4MD8A 4NBCA 3GTPI 1K9M1 3RZDI 4BY1I 1LQLA 1S721 1K732 2OZKA 1VQ91 3I55Z 1YIT1 4A3JI 4DK1A 3D6WA 1WIIA 1Y1VS 1QYPA 2G2KA 1K9M2 1VQK1 1X3ZA 4CL1A 5D1PA 4BBSI 1YIJZ 2V3VA 3CCRZ 2OOXB 4E32A 4A3BI 2OTJZ 2NAPA 1YUKA 2O53A 2RPRA 2E7ZA 2KPIA 2NVQI 4DGLA 2ZAEB 1VQ5Z 3K7AI 2O4HA 3FQMA 2GU2A 4HH4A 2QRCB 3CPWY 1VQM1 4A3LI 4DQYB 2QRDB 1VQ41 4QTTA 1NUIA 1NP6A 3M4OI 3GCFA 2JNYA 4QTUA 5LL6f 3CC2Z 1R9TI 3RZOI 2P3YA 3IF8A 3G4S1 1S72Z 2IZ4A 3OW2Y 3GTGI 2V8JA 2JMOA 3OW2Z 3BG1B 1YI21 1YITZ 4MONA 2R93I 3F3PC 3H0GI 1QVGY 5FLMI 2B63I 3CCJ1 1Q7Y2 1QVGZ 1VQKZ 4BXXI 5IP7I 4RVGA 1Z01A 3CME1 3CCV1 5D1OB 1QXFA 1JJ2Z 4MD7A 2K3RA 2JIMA 3NFZA 3GTQI 2JUBA 1Y8CA 5C4JI 2JA8I 2JA7I 2RHBA 2RT9A 1Q861 1Z02A 2QR1B 1TWFI 2KI7B 1K83I 3S16I 3EEDA 2V45A 2VPZA 1VQMZ 3CXCY 1RLYA 1Q862 1X3WA 2WAQA 4MD9A 1VQ4Z 1WJ2A 3CMAZ 2AKLA 2JIPA 3S2HI 1ZB8A 4NB8A 1NJI1 2H85A 3KIHA 3G4SZ 1Q16A 1USPB 1YI2Z 4NBEA 1NJI2 3F3FC 1YJWZ 2LEXA 3NDJA 2V8IA 3CCJZ 3VMGA 2BJOA 3CMEZ 3CCVZ 3MONA 3FQQA 2W03A 2E2II 1VQ61 1VQL1 2Q51A 4A3CI 3HKZA 4AYBA 1RNIA 3CCM1 2JA5I 4Y7NI 2IV2X 2LFUA 3VMHA 3CQZI 1VQP1 1P9NA 3TE5B 3S15I
chains in the Genus database with same CATH topology
2EGTA 1TWCI 1YHQ1 3HOZI 2NVXI 2LIYA 1QVFY 1QVFZ 4E2WA 4BY7I 1QF8A 3CPWZ 2DE6A 3JAMf 4NH1C 3CD6Z 3GTLI 1Q821 3T4NB 1TWAI 4MH4A 4MXUA 3G711 1M901 5C44I 4RVFA 1Q822 3JAMb 1Q7Y1 2YU9I 4NBBA 2E2JI 3NH8A 2DE5A 1VQ9Z 1M902 3S17I 3IFUA 2Y0SA 1VQLZ 1KQSY 1VQ6Z 3VTNA 1KQSZ 3CCMZ 1N2FA 1I3QI 2JS4A 4BBRI 3CCS1 3S1QI 5FLXf 1VQPZ 1L1OC 2J6AA 1KD11 2E9HA 2V8KA 1YHQZ 3I07A 2OOYB 3CC71 3P5JB 1RO4A 5FLXb 1KD12 4E31A 3S1RI 4RS4A 1M1K1 4A3DI 4XX2A 5T64A 3GTMI 3G6E1 2YADA 1Z03A 3IX0A 2PK7A 3CXCZ 3HOUI 5A2Qf 2QA41 3GKQA 1Q811 3CCU1 3G71Z 1M1K2 1YJ91 1RO2A 1VLAA 2R7ZI 4MRIA 1TWHI 2QLVB 3NDIA 2NVYI 1JWHC 1Q812 3EERA 4A3II 1ZB9A 1ML8A 2K5RA 5A2Qb 1DL6A 5T67A 2PMZA 2WB1A 1TFIA 3S14I 2VUGA 3CCSZ 3TDHB 3GTMS 4RVDA 4HGYA 3CCQ1 1KC81 3I4MI 4RVHA 3NH4A 3J80f 3J81f 4A3KI 4NFRA 1K8A1 2Q4ZA 3S2DI 3CC7Z 1KC82 1S7MA 2GTIA 5CM2M 3MZLB 4A3EI 1W2BY 3HOXI 1W2BZ 1K8A2 3I4NI 4NBDA 3G6EZ 3HOWI 3J80b 3J81b 1YJN1 1WCMI 1PFTA 1VQ71 3MZKB 2QA4Z 1RQFA 2R92I 3GTJI 3CCUZ 2VF1A 1YJ9Z 2R6MA 4NBGA 5D1OA 2I3CA 2JA6I 3CCL1 1WW9A 3I561 3LUSA 3CCE1 2M6NA 4TNUA 2GTHA 4S1TA 2OTL1 3BG0B 4RV9A 5T6BA 3Q87A 4E2XA 1SFOI 3U50C 4NBAA 3CC41 4E2ZA 2QEX1 1VQN1 3S1NI 4E33A 2PM9A 1I50I 2RIQA 3CCQZ 3VB9A 3S1MI 3M3YI 1I6HI 5IT9f 3CMA1 4A3FI 2JR6A 4HGZA 3HOVI 5C4XI 2HU9A 2RBLA 1YUAA 4E30A 1VQ81 1RO0A 5IT9b 1YJW1 3D9XA 3H3VJ 4NBHA 1USPA 1YJNZ 3GTKI 3PO3I 4NOZA 1VQO1 3HOYI 1N8R1 1VQ7Z 3VMIA 5C3EI 2DE7A 2W04A 3QWUA 1JJ2Y 3FKII 3I551 1TWGI 4A93I 3CCLZ 2QREB 3I56Z 1N8R2 2P28A 3CCEZ 3KIFA 2OTLZ 4A3MI 2IZ3A 1YIJ1 3CCR1 1X0TA 2F4OA 3CC4Z 1ZH1A 2OTJ1 2QKDA 3GTOI 2VUMI 2QEXZ 1VQNZ 4EWCA 4X6AI 1Y1VI 4A3GI 1VQ51 2M48A 2NVTI 4NB9A 2E2HI 3PO3S 3ESWA 2HF1A 1Y1WI 3CD61 3J7A4 1KRLA 5IP9I 4NBFA 5AN9F 3NH5A 1K731 1VQ8Z 4E2YA 4Y52I 2F4MA 3CC21 1VQOZ 3PO2I 4MD8A 4NBCA 3GTPI 1K9M1 3RZDI 4BY1I 1LQLA 1S721 1K732 2OZKA 1VQ91 3I55Z 1YIT1 4A3JI 4DK1A 3D6WA 1WIIA 1Y1VS 1QYPA 2G2KA 1K9M2 1VQK1 1X3ZA 4CL1A 5D1PA 4BBSI 1YIJZ 3CCRZ 2OOXB 4E32A 4A3BI 2OTJZ 1YUKA 2O53A 2RPRA 2KPIA 2NVQI 4DGLA 2ZAEB 1VQ5Z 3K7AI 2O4HA 3FQMA 2GU2A 4HH4A 2QRCB 3CPWY 1VQM1 4A3LI 4DQYB 2QRDB 1VQ41 4QTTA 1NUIA 1NP6A 3M4OI 3GCFA 2JNYA 4QTUA 5LL6f 3CC2Z 1R9TI 3RZOI 2P3YA 3IF8A 3G4S1 1S72Z 2IZ4A 3OW2Y 3GTGI 2V8JA 2JMOA 3OW2Z 3BG1B 1YI21 1YITZ 4MONA 2R93I 3F3PC 3H0GI 1QVGY 5FLMI 2B63I 3CCJ1 1Q7Y2 1QVGZ 1VQKZ 4BXXI 5IP7I 4RVGA 1Z01A 3CME1 3CCV1 5D1OB 1JJ2Z 4MD7A 2K3RA 3NFZA 3GTQI 2JUBA 5C4JI 2JA8I 2JA7I 2RHBA 2RT9A 1Q861 1Z02A 2QR1B 1TWFI 2KI7B 1K83I 3S16I 3EEDA 1VQMZ 3CXCY 1RLYA 1Q862 1X3WA 2WAQA 4MD9A 1VQ4Z 3CMAZ 2AKLA 3S2HI 1ZB8A 4NB8A 1NJI1 2H85A 3KIHA 3G4SZ 1USPB 1YI2Z 4NBEA 1NJI2 3F3FC 1YJWZ 3NDJA 2V8IA 3CCJZ 3VMGA 2BJOA 3CMEZ 3CCVZ 3MONA 3FQQA 2W03A 2E2II 1VQ61 1VQL1 2Q51A 4A3CI 3HKZA 4AYBA 1RNIA 3CCM1 2JA5I 4Y7NI 2LFUA 3VMHA 3CQZI 1VQP1 1P9NA 3TE5B 3S15I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFI A;  4QTU A;  3S14 I;  1TWC I;  3HOZ I;  1R9T I;  3RZO I;  2P3Y A;  4A3M I;  2NVX I;  3GTM S;  3GTG I;  3I4M I;  2F4O A;  4BY7 I;  2R93 I;  4A3K I;  3H0G I;  2DE6 A;  3GTO I;  2VUM I;  5FLM I;  2B63 I;  3S2D I;  4BXX I;  5IP7 I;  3GTL I;  4X6A I;  1Y1V I;  1TWA I;  4A3G I;  4MH4 A;  2NVT I;  4NB9 A;  5CM2 M;  2E2H I;  3ESW A;  4A3E I;  3HOX I;  5C44 I;  2HF1 A;  3PO3 S;  3I4N I;  4NBD A;  3GTQ I;  3HOW I;  1Y1W I;  5C4J I;  1WCM I;  1PFT A;  2JA8 I;  2JA7 I;  2YU9 I;  4NBB A;  2E2J I;  2R92 I;  2DE5 A;  3GTJ I;  3S17 I;  4A93 I;  5IP9 I;  4NBF A;  4NBG A;  1TWF I;  1K83 I;  3S16 I;  1N2F A;  2JA6 I;  1WW9 A;  1I3Q I;  2JS4 A;  2F4M A;  3LUS A;  4BBR I;  3PO2 I;  3S1Q I;  4Y52 I;  4NBC A;  3GTP I;  1RLY A;  1L1O C;  2J6A A;  1X3W A;  3RZD I;  4BY1 I;  1LQL A;  3Q87 A;  2AKL A;  1SFO I;  3U50 C;  3S2H I;  1ZB8 A;  4NB8 A;  4A3J I;  4NBA A;  3D6W A;  1Y1V S;  3I07 A;  1QYP A;  3S1N I;  1RO4 A;  1X3Z A;  4BBS I;  1I50 I;  3S1R I;  1USP B;  4NBE A;  3VB9 A;  3S1M I;  3M3Y I;  4A3B I;  4A3D I;  4XX2 A;  1I6H I;  3GTM I;  4A3F I;  2JR6 A;  3VMG A;  2BJO A;  2PK7 A;  3HOV I;  3HOU I;  5C4X I;  2NVQ I;  2KPI A;  3GKQ A;  2E2I I;  3K7A I;  2RBL A;  4A3C I;  1VLA A;  2R7Z I;  1YUA A;  1TWH I;  2JA5 I;  4Y7N I;  2NVY I;  3H3V J;  4NBH A;  1USP A;  3GTK I;  3PO3 I;  4NOZ A;  3HOY I;  3VMH A;  3CQZ I;  3EER A;  4A3I I;  1ZB9 A;  3VMI A;  1ML8 A;  4A3L I;  2K5R A;  5C3E I;  2DE7 A;  1DL6 A;  4QTT A;  1NUI A;  3M4O I;  3FKI I;  3GCF A;  3S15 I;  2JNY A;  1TWG I; 
#chains in the Genus database with same CATH topology
 2EGT A;  1TWC I;  1YHQ 1;  3HOZ I;  2NVX I;  2LIY A;  1QVF Y;  1QVF Z;  4E2W A;  4BY7 I;  1QF8 A;  3CPW Z;  2DE6 A;  3JAM f;  4NH1 C;  3CD6 Z;  3GTL I;  1Q82 1;  3T4N B;  1TWA I;  4MH4 A;  4MXU A;  3G71 1;  1M90 1;  5C44 I;  4RVF A;  1Q82 2;  3JAM b;  1Q7Y 1;  2YU9 I;  4NBB A;  2E2J I;  3NH8 A;  2DE5 A;  1VQ9 Z;  1M90 2;  3S17 I;  2VPX A;  3IFU A;  2Y0S A;  1VQL Z;  1KQS Y;  1VQ6 Z;  3VTN A;  1KQS Z;  3IR7 A;  3CCM Z;  1N2F A;  1I3Q I;  2JS4 A;  4BBR I;  3CCS 1;  3S1Q I;  5FLX f;  1VQP Z;  1L1O C;  2J6A A;  1KD1 1;  2E9H A;  2V8K A;  2JIQ A;  1YHQ Z;  3I07 A;  2OOY B;  3CC7 1;  3P5J B;  1FDI A;  1RO4 A;  5FLX b;  1KD1 2;  4E31 A;  3S1R I;  4RS4 A;  1M1K 1;  4A3D I;  4XX2 A;  5T64 A;  3GTM I;  3G6E 1;  2YAD A;  1Z03 A;  3IX0 A;  2PK7 A;  3CXC Z;  3HOU I;  5A2Q f;  2QA4 1;  3GKQ A;  1Q81 1;  2VPW A;  3CCU 1;  3G71 Z;  1M1K 2;  1YJ9 1;  1RO2 A;  1VLA A;  2R7Z I;  4MRI A;  1TWH I;  2QLV B;  1AA6 A;  2VPY A;  1FDO A;  2NVY I;  3NDI A;  1JWH C;  2AYD A;  1Q81 2;  3EER A;  4A3I I;  1ZB9 A;  1ML8 A;  2K5R A;  5A2Q b;  1DL6 A;  5T67 A;  2PMZ A;  2WB1 A;  1TFI A;  3S14 I;  2VUG A;  3CCS Z;  3TDH B;  3GTM S;  4RVD A;  4HGY A;  3CCQ 1;  1KC8 1;  3I4M I;  4RVH A;  3NH4 A;  3J80 f;  3J81 f;  4A3K I;  4NFR A;  1K8A 1;  2Q4Z A;  3S2D I;  3CC7 Z;  1KC8 2;  1S7M A;  2GTI A;  5CM2 M;  3MZL B;  4A3E I;  1W2B Y;  3HOX I;  1W2B Z;  1K8A 2;  3I4N I;  4NBD A;  3G6E Z;  3HOW I;  3J80 b;  3J81 b;  1SIW A;  1YJN 1;  1WCM I;  1PFT A;  1VQ7 1;  3MZK B;  2QA4 Z;  1RQF A;  2R92 I;  3GTJ I;  3CCU Z;  2VF1 A;  1YJ9 Z;  2R6M A;  4NBG A;  5D1O A;  2I3C A;  2JA6 I;  3CCL 1;  1WW9 A;  3I56 1;  3LUS A;  3CCE 1;  2M6N A;  4TNU A;  2GTH A;  4S1T A;  2OTL 1;  3BG0 B;  4RV9 A;  5T6B A;  3Q87 A;  4E2X A;  1SFO I;  3U50 C;  4NBA A;  3CC4 1;  4E2Z A;  2QEX 1;  1VQN 1;  3S1N I;  4E33 A;  2PM9 A;  1I50 I;  2RIQ A;  3CCQ Z;  3VB9 A;  3S1M I;  3M3Y I;  1I6H I;  5IT9 f;  3CMA 1;  4A3F I;  2JR6 A;  4HGZ A;  3HOV I;  5C4X I;  2HU9 A;  2JIO A;  2RBL A;  1WZN A;  1YUA A;  4E30 A;  1VQ8 1;  1RO0 A;  5IT9 b;  1YJW 1;  3D9X A;  3H3V J;  4NBH A;  1USP A;  1YJN Z;  3GTK I;  3PO3 I;  4NOZ A;  1VQO 1;  3HOY I;  1N8R 1;  1VQ7 Z;  3VMI A;  5C3E I;  2DE7 A;  2W04 A;  3QWU A;  1JJ2 Y;  2JIR A;  3FKI I;  3I55 1;  1TWG I;  4A93 I;  3CCL Z;  2QRE B;  3I56 Z;  1N8R 2;  2P28 A;  3CCE Z;  3KIF A;  2OTL Z;  4A3M I;  2IZ3 A;  1YIJ 1;  3CCR 1;  1X0T A;  2F4O A;  3CC4 Z;  1ZH1 A;  2OTJ 1;  2QKD A;  3GTO I;  2VUM I;  2QEX Z;  1VQN Z;  3D2L A;  4EWC A;  4X6A I;  1Y1V I;  4A3G I;  1VQ5 1;  2M48 A;  2NVT I;  4NB9 A;  2E2H I;  3PO3 S;  3ESW A;  2HF1 A;  1Y1W I;  3CD6 1;  3J7A 4;  1KRL A;  5IP9 I;  4NBF A;  5AN9 F;  3NH5 A;  1K73 1;  1VQ8 Z;  4E2Y A;  4Y52 I;  2F4M A;  3CC2 1;  1VQO Z;  3PO2 I;  4MD8 A;  4NBC A;  3GTP I;  1K9M 1;  3RZD I;  4BY1 I;  1LQL A;  1S72 1;  1K73 2;  2OZK A;  1VQ9 1;  3I55 Z;  1YIT 1;  4A3J I;  4DK1 A;  3D6W A;  1WII A;  1Y1V S;  1QYP A;  2G2K A;  1K9M 2;  1VQK 1;  1X3Z A;  4CL1 A;  5D1P A;  4BBS I;  1YIJ Z;  2V3V A;  3CCR Z;  2OOX B;  4E32 A;  4A3B I;  2OTJ Z;  2NAP A;  1YUK A;  2O53 A;  2RPR A;  2E7Z A;  2KPI A;  2NVQ I;  4DGL A;  2ZAE B;  1VQ5 Z;  3K7A I;  2O4H A;  3FQM A;  2GU2 A;  4HH4 A;  2QRC B;  3CPW Y;  1VQM 1;  4A3L I;  4DQY B;  2QRD B;  1VQ4 1;  4QTT A;  1NUI A;  1NP6 A;  3M4O I;  3GCF A;  2JNY A;  4QTU A;  5LL6 f;  3CC2 Z;  1R9T I;  3RZO I;  2P3Y A;  3IF8 A;  3G4S 1;  1S72 Z;  2IZ4 A;  3OW2 Y;  3GTG I;  2V8J A;  2JMO A;  3OW2 Z;  3BG1 B;  1YI2 1;  1YIT Z;  4MON A;  2R93 I;  3F3P C;  3H0G I;  1QVG Y;  5FLM I;  2B63 I;  3CCJ 1;  1Q7Y 2;  1QVG Z;  1VQK Z;  4BXX I;  5IP7 I;  4RVG A;  1Z01 A;  3CME 1;  3CCV 1;  5D1O B;  1QXF A;  1JJ2 Z;  4MD7 A;  2K3R A;  2JIM A;  3NFZ A;  3GTQ I;  2JUB A;  1Y8C A;  5C4J I;  2JA8 I;  2JA7 I;  2RHB A;  2RT9 A;  1Q86 1;  1Z02 A;  2QR1 B;  1TWF I;  2KI7 B;  1K83 I;  3S16 I;  3EED A;  2V45 A;  2VPZ A;  1VQM Z;  3CXC Y;  1RLY A;  1Q86 2;  1X3W A;  2WAQ A;  4MD9 A;  1VQ4 Z;  1WJ2 A;  3CMA Z;  2AKL A;  2JIP A;  3S2H I;  1ZB8 A;  4NB8 A;  1NJI 1;  2H85 A;  3KIH A;  3G4S Z;  1Q16 A;  1USP B;  1YI2 Z;  4NBE A;  1NJI 2;  3F3F C;  1YJW Z;  2LEX A;  3NDJ A;  2V8I A;  3CCJ Z;  3VMG A;  2BJO A;  3CME Z;  3CCV Z;  3MON A;  3FQQ A;  2W03 A;  2E2I I;  1VQ6 1;  1VQL 1;  2Q51 A;  4A3C I;  3HKZ A;  4AYB A;  1RNI A;  3CCM 1;  2JA5 I;  4Y7N I;  2IV2 X;  2LFU A;  3VMH A;  3CQZ I;  1VQP 1;  1P9N A;  3TE5 B;  3S15 I; 
#chains in the Genus database with same CATH homology
 2EGT A;  1TWC I;  1YHQ 1;  3HOZ I;  2NVX I;  2LIY A;  1QVF Y;  1QVF Z;  4E2W A;  4BY7 I;  1QF8 A;  3CPW Z;  2DE6 A;  3JAM f;  4NH1 C;  3CD6 Z;  3GTL I;  1Q82 1;  3T4N B;  1TWA I;  4MH4 A;  4MXU A;  3G71 1;  1M90 1;  5C44 I;  4RVF A;  1Q82 2;  3JAM b;  1Q7Y 1;  2YU9 I;  4NBB A;  2E2J I;  3NH8 A;  2DE5 A;  1VQ9 Z;  1M90 2;  3S17 I;  3IFU A;  2Y0S A;  1VQL Z;  1KQS Y;  1VQ6 Z;  3VTN A;  1KQS Z;  3CCM Z;  1N2F A;  1I3Q I;  2JS4 A;  4BBR I;  3CCS 1;  3S1Q I;  5FLX f;  1VQP Z;  1L1O C;  2J6A A;  1KD1 1;  2E9H A;  2V8K A;  1YHQ Z;  3I07 A;  2OOY B;  3CC7 1;  3P5J B;  1RO4 A;  5FLX b;  1KD1 2;  4E31 A;  3S1R I;  4RS4 A;  1M1K 1;  4A3D I;  4XX2 A;  5T64 A;  3GTM I;  3G6E 1;  2YAD A;  1Z03 A;  3IX0 A;  2PK7 A;  3CXC Z;  3HOU I;  5A2Q f;  2QA4 1;  3GKQ A;  1Q81 1;  3CCU 1;  3G71 Z;  1M1K 2;  1YJ9 1;  1RO2 A;  1VLA A;  2R7Z I;  4MRI A;  1TWH I;  2QLV B;  3NDI A;  2NVY I;  1JWH C;  1Q81 2;  3EER A;  4A3I I;  1ZB9 A;  1ML8 A;  2K5R A;  5A2Q b;  1DL6 A;  5T67 A;  2PMZ A;  2WB1 A;  1TFI A;  3S14 I;  2VUG A;  3CCS Z;  3TDH B;  3GTM S;  4RVD A;  4HGY A;  3CCQ 1;  1KC8 1;  3I4M I;  4RVH A;  3NH4 A;  3J80 f;  3J81 f;  4A3K I;  4NFR A;  1K8A 1;  2Q4Z A;  3S2D I;  3CC7 Z;  1KC8 2;  1S7M A;  2GTI A;  5CM2 M;  3MZL B;  4A3E I;  1W2B Y;  3HOX I;  1W2B Z;  1K8A 2;  3I4N I;  4NBD A;  3G6E Z;  3HOW I;  3J80 b;  3J81 b;  1YJN 1;  1WCM I;  1PFT A;  1VQ7 1;  3MZK B;  2QA4 Z;  1RQF A;  2R92 I;  3GTJ I;  3CCU Z;  2VF1 A;  1YJ9 Z;  2R6M A;  4NBG A;  5D1O A;  2I3C A;  2JA6 I;  3CCL 1;  1WW9 A;  3I56 1;  3LUS A;  3CCE 1;  2M6N A;  4TNU A;  2GTH A;  4S1T A;  2OTL 1;  3BG0 B;  4RV9 A;  5T6B A;  3Q87 A;  4E2X A;  1SFO I;  3U50 C;  4NBA A;  3CC4 1;  4E2Z A;  2QEX 1;  1VQN 1;  3S1N I;  4E33 A;  2PM9 A;  1I50 I;  2RIQ A;  3CCQ Z;  3VB9 A;  3S1M I;  3M3Y I;  1I6H I;  5IT9 f;  3CMA 1;  4A3F I;  2JR6 A;  4HGZ A;  3HOV I;  5C4X I;  2HU9 A;  2RBL A;  1YUA A;  4E30 A;  1VQ8 1;  1RO0 A;  5IT9 b;  1YJW 1;  3D9X A;  3H3V J;  4NBH A;  1USP A;  1YJN Z;  3GTK I;  3PO3 I;  4NOZ A;  1VQO 1;  3HOY I;  1N8R 1;  1VQ7 Z;  3VMI A;  5C3E I;  2DE7 A;  2W04 A;  3QWU A;  1JJ2 Y;  3FKI I;  3I55 1;  1TWG I;  4A93 I;  3CCL Z;  2QRE B;  3I56 Z;  1N8R 2;  2P28 A;  3CCE Z;  3KIF A;  2OTL Z;  4A3M I;  2IZ3 A;  1YIJ 1;  3CCR 1;  1X0T A;  2F4O A;  3CC4 Z;  1ZH1 A;  2OTJ 1;  2QKD A;  3GTO I;  2VUM I;  2QEX Z;  1VQN Z;  4EWC A;  4X6A I;  1Y1V I;  4A3G I;  1VQ5 1;  2M48 A;  2NVT I;  4NB9 A;  2E2H I;  3PO3 S;  3ESW A;  2HF1 A;  1Y1W I;  3CD6 1;  3J7A 4;  1KRL A;  5IP9 I;  4NBF A;  5AN9 F;  3NH5 A;  1K73 1;  1VQ8 Z;  4E2Y A;  4Y52 I;  2F4M A;  3CC2 1;  1VQO Z;  3PO2 I;  4MD8 A;  4NBC A;  3GTP I;  1K9M 1;  3RZD I;  4BY1 I;  1LQL A;  1S72 1;  1K73 2;  2OZK A;  1VQ9 1;  3I55 Z;  1YIT 1;  4A3J I;  4DK1 A;  3D6W A;  1WII A;  1Y1V S;  1QYP A;  2G2K A;  1K9M 2;  1VQK 1;  1X3Z A;  4CL1 A;  5D1P A;  4BBS I;  1YIJ Z;  3CCR Z;  2OOX B;  4E32 A;  4A3B I;  2OTJ Z;  1YUK A;  2O53 A;  2RPR A;  2KPI A;  2NVQ I;  4DGL A;  2ZAE B;  1VQ5 Z;  3K7A I;  2O4H A;  3FQM A;  2GU2 A;  4HH4 A;  2QRC B;  3CPW Y;  1VQM 1;  4A3L I;  4DQY B;  2QRD B;  1VQ4 1;  4QTT A;  1NUI A;  1NP6 A;  3M4O I;  3GCF A;  2JNY A;  4QTU A;  5LL6 f;  3CC2 Z;  1R9T I;  3RZO I;  2P3Y A;  3IF8 A;  3G4S 1;  1S72 Z;  2IZ4 A;  3OW2 Y;  3GTG I;  2V8J A;  2JMO A;  3OW2 Z;  3BG1 B;  1YI2 1;  1YIT Z;  4MON A;  2R93 I;  3F3P C;  3H0G I;  1QVG Y;  5FLM I;  2B63 I;  3CCJ 1;  1Q7Y 2;  1QVG Z;  1VQK Z;  4BXX I;  5IP7 I;  4RVG A;  1Z01 A;  3CME 1;  3CCV 1;  5D1O B;  1JJ2 Z;  4MD7 A;  2K3R A;  3NFZ A;  3GTQ I;  2JUB A;  5C4J I;  2JA8 I;  2JA7 I;  2RHB A;  2RT9 A;  1Q86 1;  1Z02 A;  2QR1 B;  1TWF I;  2KI7 B;  1K83 I;  3S16 I;  3EED A;  1VQM Z;  3CXC Y;  1RLY A;  1Q86 2;  1X3W A;  2WAQ A;  4MD9 A;  1VQ4 Z;  3CMA Z;  2AKL A;  3S2H I;  1ZB8 A;  4NB8 A;  1NJI 1;  2H85 A;  3KIH A;  3G4S Z;  1USP B;  1YI2 Z;  4NBE A;  1NJI 2;  3F3F C;  1YJW Z;  3NDJ A;  2V8I A;  3CCJ Z;  3VMG A;  2BJO A;  3CME Z;  3CCV Z;  3MON A;  3FQQ A;  2W03 A;  2E2I I;  1VQ6 1;  1VQL 1;  2Q51 A;  4A3C I;  3HKZ A;  4AYB A;  1RNI A;  3CCM 1;  2JA5 I;  4Y7N I;  2LFU A;  3VMH A;  3CQZ I;  1VQP 1;  1P9N A;  3TE5 B;  3S15 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...