2P28A

Structure of the phe2 and phe3 fragments of the integrin beta2 subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
96
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin beta-2
publication title A structural hypothesis for the transition between bent and extended conformations of the leukocyte beta2 integrins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 16
structure length 96
sequence length 100
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2p28A02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2p28A01
3NIFB 4WK0B 3ZE2B 2VDMB 4UM9D 4Z7QB 1YUKA 3NVQA 3OL2B 2UZYB 3AFCA 3AL8B 2VDQB 3NIDB 3NIGB 3ZE1B 2P26A 3FCUB 4WJKB 4WK4B 2VC2B 1SSLA 3OKWA 4Z7OB 4WK2B 3VI3B 5E6UB 2VDNB 3OKYB 4GZ8A 3AL9A 1SHYB 3T3PB 2VDOB 3ZDZB 3ZDYB 4Z7NB 2VDLB 2VDPB 4O3UB 5HDBB 1TYEB 2VDKB 5E6RB 1OLZA 4UM8B 3T3MB 3VI4B 1U8CB 3ZDXB 4UM9B 4O3TB 3ZE0B 4FWWA 2P28A 2VDRB 4K3JB 5E6SB 3OL2A 3AL8A
chains in the Genus database with same CATH superfamily
4Z7QB 1WZNA 3GTPI 3IX0A 3GTMI 1USPB 4NBFA 2I3CA 1NUIA 4NBBA 1YUAA 3CXCZ 1Q7Y1 3VMIA 1QF8A 2VPYA 2VDPB 3U50C 1TWHI 3CC2Z 4RVHA 1YIJ1 5C4XI 4XX2A 5LL6f 5A2Qf 1QYPA 3T3PB 3ZE2B 3VMHA 3JAMb 1YJNZ 3VTNA 1DL6A 4E30A 3I4NI 1Z01A 3G4SZ 1YHQZ 3NIDB 2DE6A 4E2ZA 4E2WA 1Q7Y2 3CCQ1 3S1QI 2OTLZ 2JA8I 2VDOB 1YJ91 2VDLB 3M4OI 1PFTA 2M48A 4FWWA 2QEXZ 3CCV1 1FDIA 1I3QI 2M6NA 3HOZI 3OW2Z 1QVGZ 1WW9A 2GU2A 3FCUB 2VPZA 5C3EI 1VQK1 2BJOA 5IT9b 5T67A 2W04A 5D1OB 1VQMZ 4O3TB 3I56Z 4BY7I 1VQ4Z 3CCR1 1X3WA 3HOUI 4WK0B 2V8KA 2V8IA 2UZYB 5T6BA 3VMGA 4NBCA 3D9XA 3FQQA 4MD9A 1VQO1 1K731 1RO4A 5FLMI 5IP9I 1Y1VS 4TNUA 2JIPA 3CCVZ 3VI4B 1OLZA 2YADA 4CL1A 1M901 4AYBA 3G71Z 1JJ2Z 2F4OA 2PK7A 1YITZ 4MRIA 1VQ81 5IT9f 1USPA 1I6HI 4A93I 3D6WA 3NIGB 1YJWZ 2P3YA 4BBRI 1K732 3OKWA 1YJN1 1KQSY 1Q861 2E2HI 1RLYA 1X0TA 3G4S1 2GTIA 2HF1A 3CD6Z 3EEDA 2J6AA 1VQ71 1M902 3BG1B 3GTJI 5E6RB 2H85A 3PO3S 4RVDA 3CCRZ 2OTL1 2QA41 4NBGA 3Q87A 2E2JI 4DK1A 5C4JI 3NIFB 2HU9A 4NB8A 2F4MA 3CPWY 2QEX1 4A3KI 3AFCA 3NH5A 3HOYI 3T4NB 1VQOZ 2RPRA 1Q862 3GTLI 3IFUA 2AYDA 4WK2B 3NH4A 2V8JA 2NVQI 3S2HI 4RVGA 2R93I 2OZKA 2JMOA 3MZLB 3PO3I 1VQP1 3CC7Z 4UM8B 3F3PC 1U8CB 1VQ6Z 4UM9B 4A3LI 3CMAZ 1N2FA 1SFOI 2O4HA 3S2DI 1VQ8Z 3S15I 3LUSA 3BG0B 3HOXI 2V45A 3S1NI 1VQM1 4NB9A 1L1OC 4DGLA 3H3VJ 3I561 3J81b 3RZOI 2Y0SA 3AL8B 1VQ41 4RS4A 4HGYA 3ZE1B 2VC2B 3CCLZ 1ZB9A 1VQ7Z 3GTQI 5D1OA 4BXXI 1TFIA 2JIOA 2E2II 3ZDYB 2QA4Z 1Q16A 3S16I 4QTUA 1AA6A 3IF8A 3RZDI 1KD11 3GTOI 2VDRB 3I55Z 4NFRA 3G711 1RO0A 1RNIA 1M1K1 1YIT1 2ZAEB 2YU9I 1K8A1 3GTGI 2VDNB 3CCSZ 4MH4A 1VQPZ 3CQZI 1YJW1 4NOZA 3GCFA 1K83I 1N8R1 3J81f 1RQFA 3JAMf 1KD12 3T3MB 2K5RA 3HKZA 3CD61 4Y52I 2VPXA 2JA6I 1ZH1A 1WCMI 3CCUZ 1M1K2 3NVQA 1W2BY 3OL2B 2RBLA 1K8A2 1TWFI 3J7A4 2JWGA 4WJKB 1YI2Z 2NVXI 2QKDA 3FQMA 2G2KA 1N8R2 3J80b 4BBSI 3FKII 1TYEB 3IR7A 2R92I 1P9NA 2AKLA 3CCEZ 3CC71 2IZ3A 1WIIA 3MONA 1VQ61 3CXCY 3CMA1 2QREB 2JA7I 3NH8A 3VI3B 1Y8CA 4NBDA 3S17I 3ESWA 2RT9A 4E33A 4A3DI 1Y1VI 3CCL1 3ZDZB 2OTJZ 1FDOA 2KPIA 2GTHA 4E2XA 1TWGI 2QRDB 3ZE0B 2P28A 2NVYI 1VQNZ 4K3JB 2JIRA 4E32A 3AL8A 3CMEZ 2Q51A 3J80f 1R9TI 3I551 5A2Qb 3M3YI 3QWUA 2JR6A 2Q4ZA 3GTMS 2KI7B 4GZ8A 4A3FI 4A3JI 4E31A 1SHYB 4MD7A 3OW2Y 1ZB8A 1K9M1 2NVTI 1QXFA 3G6E1 3CCS1 3CCMZ 1NJI1 1I50I 4O3UB 5HDBB 2WB1A 4HH4A 3MZKB 4A3II 3GTKI 5E6SB 3TE5B 2JIQA 4HGZA 4RVFA 4E2YA 1VQ51 1YUKA 5AN9F 3VB9A 1Q811 3CCU1 3I4MI 1S7MA 3CC4Z 1K9M2 1LQLA 2DE5A 1KRLA 4A3BI 1YI21 1NJI2 5C44I 3CCJ1 2VUGA 1SIWA 1KC81 1X3ZA 1KQSZ 4RV9A 2JNYA 3NDIA 1VLAA 2EGTA 3OL2A 1Q812 4BY1I 1Z02A 5IP7I 4QTTA 4A3EI 3CCE1 2P26A 4DQYB 1VQ9Z 2K3RA 1JJ2Y 3AL9A 3G6EZ 2QR1B 3NFZA 5FLXb 5D1PA 1RO2A 3KIFA 3CPWZ 4A3GI 1KC82 3EERA 2B63I 5CM2M 4NBHA 1Q821 3ZDXB 2VDKB 3S14I 1S721 1VQ5Z 2OTJ1 3K7AI 3HOVI 1ML8A 2LFUA 1VQL1 2JUBA 2JA5I 1QVFY 2OOXB 1VQN1 2RIQA 2VDQB 3TDHB 4Y7NI 2IV2X 3CME1 4MONA 4WK4B 1SSLA 4MXUA 5E6UB 1NP6A 2QLVB 3CCJZ 2RHBA 1YIJZ 1Q822 4A3CI 2JIMA 1Z03A 2E7ZA 2W03A 4S1TA 1Y1WI 3NDJA 1JWHC 2DE7A 2PM9A 3CCM1 2JS4A 3P5JB 2VPWA 1TWAI 2VDMB 4UM9D 4EWCA 2NAPA 5FLXf 4NBAA 2OOYB 3CCQZ 2VF1A 2WAQA 3H0GI 2LIYA 1YJ9Z 3OKYB 2V3VA 4A3MI 3CC41 2VUMI 4MD8A 2R7ZI 3KIHA 5T64A 1S72Z 4Z7NB 3HOWI 1VQLZ 2PMZA 2O53A 2QRCB 2IZ4A 2JWHA 3CC21 3I07A 3F3FC 3D2LA 4X6AI 1VQKZ 2LEXA 4Z7OB 4NBEA 1YHQ1 3GKQA 1QVFZ 1WJ2A 4NH1C 3S1RI 1VQ91 1W2BZ 1QVGY 2E9HA 3S1MI 3PO2I 1TWCI 2R6MA
chains in the Genus database with same CATH topology
4Z7QB 3GTPI 3IX0A 3GTMI 1USPB 4NBFA 2I3CA 1NUIA 4NBBA 1YUAA 3CXCZ 1Q7Y1 3VMIA 1QF8A 2VDPB 3U50C 1TWHI 3CC2Z 4RVHA 1YIJ1 5C4XI 4XX2A 5LL6f 5A2Qf 1QYPA 3T3PB 3ZE2B 3VMHA 3JAMb 1YJNZ 3VTNA 1DL6A 4E30A 3I4NI 1Z01A 3G4SZ 1YHQZ 3NIDB 2DE6A 4E2ZA 4E2WA 1Q7Y2 3CCQ1 3S1QI 2OTLZ 2JA8I 2VDOB 1YJ91 2VDLB 3M4OI 1PFTA 2M48A 4FWWA 2QEXZ 3CCV1 1I3QI 2M6NA 3HOZI 3OW2Z 1QVGZ 1WW9A 2GU2A 3FCUB 5C3EI 1VQK1 2BJOA 5IT9b 5T67A 2W04A 5D1OB 1VQMZ 4O3TB 3I56Z 4BY7I 1VQ4Z 3CCR1 1X3WA 3HOUI 4WK0B 2V8KA 2V8IA 2UZYB 5T6BA 3VMGA 4NBCA 3D9XA 3FQQA 4MD9A 1VQO1 1K731 1RO4A 5FLMI 5IP9I 1Y1VS 4TNUA 3CCVZ 3VI4B 1OLZA 2YADA 4CL1A 1M901 4AYBA 3G71Z 1JJ2Z 2F4OA 2PK7A 1YITZ 4MRIA 1VQ81 5IT9f 1USPA 1I6HI 4A93I 3D6WA 3NIGB 1YJWZ 2P3YA 4BBRI 1K732 3OKWA 1YJN1 1KQSY 1Q861 2E2HI 1RLYA 1X0TA 3G4S1 2GTIA 2HF1A 3CD6Z 3EEDA 2J6AA 1VQ71 1M902 3BG1B 3GTJI 5E6RB 2H85A 3PO3S 4RVDA 3CCRZ 2OTL1 2QA41 4NBGA 3Q87A 2E2JI 4DK1A 5C4JI 3NIFB 2HU9A 4NB8A 2F4MA 3CPWY 2QEX1 4A3KI 3AFCA 3NH5A 3HOYI 3T4NB 1VQOZ 2RPRA 1Q862 3GTLI 3IFUA 4WK2B 3NH4A 2V8JA 2NVQI 3S2HI 4RVGA 2R93I 2OZKA 2JMOA 3MZLB 3PO3I 1VQP1 3CC7Z 4UM8B 3F3PC 1U8CB 1VQ6Z 4UM9B 4A3LI 3CMAZ 1N2FA 1SFOI 2O4HA 3S2DI 1VQ8Z 3S15I 3LUSA 3BG0B 3HOXI 3S1NI 1VQM1 4NB9A 1L1OC 4DGLA 3H3VJ 3I561 3J81b 3RZOI 2Y0SA 3AL8B 1VQ41 4RS4A 4HGYA 3ZE1B 2VC2B 3CCLZ 1ZB9A 1VQ7Z 3GTQI 5D1OA 4BXXI 1TFIA 2E2II 3ZDYB 2QA4Z 3S16I 4QTUA 3IF8A 3RZDI 1KD11 3GTOI 2VDRB 3I55Z 4NFRA 3G711 1RO0A 1RNIA 1M1K1 1YIT1 2ZAEB 2YU9I 1K8A1 3GTGI 2VDNB 3CCSZ 4MH4A 1VQPZ 3CQZI 1YJW1 4NOZA 3GCFA 1K83I 1N8R1 3J81f 1RQFA 3JAMf 1KD12 3T3MB 2K5RA 3HKZA 3CD61 4Y52I 2JA6I 1ZH1A 1WCMI 3CCUZ 1M1K2 3NVQA 1W2BY 3OL2B 2RBLA 1K8A2 1TWFI 3J7A4 2JWGA 4WJKB 1YI2Z 2NVXI 2QKDA 3FQMA 2G2KA 1N8R2 3J80b 4BBSI 3FKII 1TYEB 2R92I 1P9NA 2AKLA 3CCEZ 3CC71 2IZ3A 1WIIA 3MONA 1VQ61 3CXCY 3CMA1 2QREB 2JA7I 3NH8A 3VI3B 4NBDA 3S17I 3ESWA 2RT9A 4E33A 4A3DI 1Y1VI 3CCL1 3ZDZB 2OTJZ 2KPIA 2GTHA 4E2XA 1TWGI 2QRDB 3ZE0B 2P28A 2NVYI 1VQNZ 4K3JB 4E32A 3AL8A 3CMEZ 2Q51A 3J80f 1R9TI 3I551 5A2Qb 3M3YI 3QWUA 2JR6A 2Q4ZA 3GTMS 2KI7B 4GZ8A 4A3FI 4A3JI 4E31A 1SHYB 4MD7A 3OW2Y 1ZB8A 1K9M1 2NVTI 3G6E1 3CCS1 3CCMZ 1NJI1 1I50I 4O3UB 5HDBB 2WB1A 4HH4A 3MZKB 4A3II 3GTKI 5E6SB 3TE5B 4HGZA 4RVFA 4E2YA 1VQ51 1YUKA 5AN9F 3VB9A 1Q811 3CCU1 3I4MI 1S7MA 3CC4Z 1K9M2 1LQLA 2DE5A 1KRLA 4A3BI 1YI21 1NJI2 5C44I 3CCJ1 2VUGA 1KC81 1X3ZA 1KQSZ 4RV9A 2JNYA 3NDIA 1VLAA 2EGTA 3OL2A 1Q812 4BY1I 1Z02A 5IP7I 4QTTA 4A3EI 3CCE1 2P26A 4DQYB 1VQ9Z 2K3RA 1JJ2Y 3AL9A 3G6EZ 2QR1B 3NFZA 5FLXb 5D1PA 1RO2A 3KIFA 3CPWZ 4A3GI 1KC82 3EERA 2B63I 5CM2M 4NBHA 1Q821 3ZDXB 2VDKB 3S14I 1S721 1VQ5Z 2OTJ1 3K7AI 3HOVI 1ML8A 2LFUA 1VQL1 2JUBA 2JA5I 1QVFY 2OOXB 1VQN1 2RIQA 2VDQB 3TDHB 4Y7NI 3CME1 4MONA 4WK4B 1SSLA 4MXUA 5E6UB 1NP6A 2QLVB 3CCJZ 2RHBA 1YIJZ 1Q822 4A3CI 1Z03A 2W03A 4S1TA 1Y1WI 3NDJA 1JWHC 2DE7A 2PM9A 3CCM1 2JS4A 3P5JB 2VDMB 1TWAI 4UM9D 4EWCA 5FLXf 4NBAA 2OOYB 3CCQZ 2VF1A 2WAQA 3H0GI 2LIYA 1YJ9Z 3OKYB 4A3MI 3CC41 2VUMI 4MD8A 2R7ZI 3KIHA 5T64A 1S72Z 4Z7NB 3HOWI 1VQLZ 2PMZA 2O53A 2QRCB 2IZ4A 2JWHA 3CC21 3I07A 3F3FC 4X6AI 1VQKZ 4Z7OB 4NBEA 1YHQ1 3GKQA 1QVFZ 4NH1C 3S1RI 1VQ91 1W2BZ 1QVGY 2E9HA 3S1MI 3PO2I 1TWCI 2R6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIF B;  4WK0 B;  3ZE2 B;  2VDM B;  4UM9 D;  4Z7Q B;  1YUK A;  3NVQ A;  3OL2 B;  2UZY B;  3AFC A;  3AL8 B;  2VDQ B;  3NID B;  3NIG B;  3ZE1 B;  2P26 A;  3FCU B;  4WJK B;  4WK4 B;  2VC2 B;  1SSL A;  3OKW A;  4Z7O B;  4WK2 B;  3VI3 B;  5E6U B;  2VDN B;  3OKY B;  4GZ8 A;  3AL9 A;  1SHY B;  3T3P B;  2VDO B;  3ZDZ B;  3ZDY B;  4Z7N B;  2VDL B;  2VDP B;  4O3U B;  5HDB B;  1TYE B;  2VDK B;  5E6R B;  1OLZ A;  4UM8 B;  3T3M B;  3VI4 B;  1U8C B;  3ZDX B;  4UM9 B;  4O3T B;  3ZE0 B;  4FWW A;  2P28 A;  2VDR B;  4K3J B;  5E6S B;  3OL2 A;  3AL8 A; 
#chains in the Genus database with same CATH topology
 4Z7Q B;  1WZN A;  3GTP I;  3IX0 A;  3GTM I;  1USP B;  4NBF A;  2I3C A;  1NUI A;  4NBB A;  1YUA A;  3CXC Z;  1Q7Y 1;  3VMI A;  1QF8 A;  2VPY A;  2VDP B;  3U50 C;  1TWH I;  3CC2 Z;  4RVH A;  1YIJ 1;  5C4X I;  4XX2 A;  5LL6 f;  5A2Q f;  1QYP A;  3T3P B;  3ZE2 B;  3VMH A;  3JAM b;  1YJN Z;  3VTN A;  1DL6 A;  4E30 A;  3I4N I;  1Z01 A;  3G4S Z;  1YHQ Z;  3NID B;  2DE6 A;  4E2Z A;  4E2W A;  1Q7Y 2;  3CCQ 1;  3S1Q I;  2OTL Z;  2JA8 I;  2VDO B;  1YJ9 1;  2VDL B;  3M4O I;  1PFT A;  2M48 A;  4FWW A;  2QEX Z;  3CCV 1;  1FDI A;  1I3Q I;  2M6N A;  3HOZ I;  3OW2 Z;  1QVG Z;  1WW9 A;  2GU2 A;  3FCU B;  2VPZ A;  5C3E I;  1VQK 1;  2BJO A;  5IT9 b;  5T67 A;  2W04 A;  5D1O B;  1VQM Z;  4O3T B;  3I56 Z;  4BY7 I;  1VQ4 Z;  3CCR 1;  1X3W A;  3HOU I;  4WK0 B;  2V8K A;  2V8I A;  2UZY B;  5T6B A;  3VMG A;  4NBC A;  3D9X A;  3FQQ A;  4MD9 A;  1VQO 1;  1K73 1;  1RO4 A;  5FLM I;  5IP9 I;  1Y1V S;  4TNU A;  2JIP A;  3CCV Z;  3VI4 B;  1OLZ A;  2YAD A;  4CL1 A;  1M90 1;  4AYB A;  3G71 Z;  1JJ2 Z;  2F4O A;  2PK7 A;  1YIT Z;  4MRI A;  1VQ8 1;  5IT9 f;  1USP A;  1I6H I;  4A93 I;  3D6W A;  3NIG B;  1YJW Z;  2P3Y A;  4BBR I;  1K73 2;  3OKW A;  1YJN 1;  1KQS Y;  1Q86 1;  2E2H I;  1RLY A;  1X0T A;  3G4S 1;  2GTI A;  2HF1 A;  3CD6 Z;  3EED A;  2J6A A;  1VQ7 1;  1M90 2;  3BG1 B;  3GTJ I;  5E6R B;  2H85 A;  3PO3 S;  4RVD A;  3CCR Z;  2OTL 1;  2QA4 1;  4NBG A;  3Q87 A;  2E2J I;  4DK1 A;  5C4J I;  3NIF B;  2HU9 A;  4NB8 A;  2F4M A;  3CPW Y;  2QEX 1;  4A3K I;  3AFC A;  3NH5 A;  3HOY I;  3T4N B;  1VQO Z;  2RPR A;  1Q86 2;  3GTL I;  3IFU A;  2AYD A;  4WK2 B;  3NH4 A;  2V8J A;  2NVQ I;  3S2H I;  4RVG A;  2R93 I;  2OZK A;  2JMO A;  3MZL B;  3PO3 I;  1VQP 1;  3CC7 Z;  4UM8 B;  3F3P C;  1U8C B;  1VQ6 Z;  4UM9 B;  4A3L I;  3CMA Z;  1N2F A;  1SFO I;  2O4H A;  3S2D I;  1VQ8 Z;  3S15 I;  3LUS A;  3BG0 B;  3HOX I;  2V45 A;  3S1N I;  1VQM 1;  4NB9 A;  1L1O C;  4DGL A;  3H3V J;  3I56 1;  3J81 b;  3RZO I;  2Y0S A;  3AL8 B;  1VQ4 1;  4RS4 A;  4HGY A;  3ZE1 B;  2VC2 B;  3CCL Z;  1ZB9 A;  1VQ7 Z;  3GTQ I;  5D1O A;  4BXX I;  1TFI A;  2JIO A;  2E2I I;  3ZDY B;  2QA4 Z;  1Q16 A;  3S16 I;  4QTU A;  1AA6 A;  3IF8 A;  3RZD I;  1KD1 1;  3GTO I;  2VDR B;  3I55 Z;  4NFR A;  3G71 1;  1RO0 A;  1RNI A;  1M1K 1;  1YIT 1;  2ZAE B;  2YU9 I;  1K8A 1;  3GTG I;  2VDN B;  3CCS Z;  4MH4 A;  1VQP Z;  3CQZ I;  1YJW 1;  4NOZ A;  3GCF A;  1K83 I;  1N8R 1;  3J81 f;  1RQF A;  3JAM f;  1KD1 2;  3T3M B;  2K5R A;  3HKZ A;  3CD6 1;  4Y52 I;  2VPX A;  2JA6 I;  1ZH1 A;  1WCM I;  3CCU Z;  1M1K 2;  3NVQ A;  1W2B Y;  3OL2 B;  2RBL A;  1K8A 2;  1TWF I;  3J7A 4;  2JWG A;  4WJK B;  1YI2 Z;  2NVX I;  2QKD A;  3FQM A;  2G2K A;  1N8R 2;  3J80 b;  4BBS I;  3FKI I;  1TYE B;  3IR7 A;  2R92 I;  1P9N A;  2AKL A;  3CCE Z;  3CC7 1;  2IZ3 A;  1WII A;  3MON A;  1VQ6 1;  3CXC Y;  3CMA 1;  2QRE B;  2JA7 I;  3NH8 A;  3VI3 B;  1Y8C A;  4NBD A;  3S17 I;  3ESW A;  2RT9 A;  4E33 A;  4A3D I;  1Y1V I;  3CCL 1;  3ZDZ B;  2OTJ Z;  1FDO A;  2KPI A;  2GTH A;  4E2X A;  1TWG I;  2QRD B;  3ZE0 B;  2P28 A;  2NVY I;  1VQN Z;  4K3J B;  2JIR A;  4E32 A;  3AL8 A;  3CME Z;  2Q51 A;  3J80 f;  1R9T I;  3I55 1;  5A2Q b;  3M3Y I;  3QWU A;  2JR6 A;  2Q4Z A;  3GTM S;  2KI7 B;  4GZ8 A;  4A3F I;  4A3J I;  4E31 A;  1SHY B;  4MD7 A;  3OW2 Y;  1ZB8 A;  1K9M 1;  2NVT I;  1QXF A;  3G6E 1;  3CCS 1;  3CCM Z;  1NJI 1;  1I50 I;  4O3U B;  5HDB B;  2WB1 A;  4HH4 A;  3MZK B;  4A3I I;  3GTK I;  5E6S B;  3TE5 B;  2JIQ A;  4HGZ A;  4RVF A;  4E2Y A;  1VQ5 1;  1YUK A;  5AN9 F;  3VB9 A;  1Q81 1;  3CCU 1;  3I4M I;  1S7M A;  3CC4 Z;  1K9M 2;  1LQL A;  2DE5 A;  1KRL A;  4A3B I;  1YI2 1;  1NJI 2;  5C44 I;  3CCJ 1;  2VUG A;  1SIW A;  1KC8 1;  1X3Z A;  1KQS Z;  4RV9 A;  2JNY A;  3NDI A;  1VLA A;  2EGT A;  3OL2 A;  1Q81 2;  4BY1 I;  1Z02 A;  5IP7 I;  4QTT A;  4A3E I;  3CCE 1;  2P26 A;  4DQY B;  1VQ9 Z;  2K3R A;  1JJ2 Y;  3AL9 A;  3G6E Z;  2QR1 B;  3NFZ A;  5FLX b;  5D1P A;  1RO2 A;  3KIF A;  3CPW Z;  4A3G I;  1KC8 2;  3EER A;  2B63 I;  5CM2 M;  4NBH A;  1Q82 1;  3ZDX B;  2VDK B;  3S14 I;  1S72 1;  1VQ5 Z;  2OTJ 1;  3K7A I;  3HOV I;  1ML8 A;  2LFU A;  1VQL 1;  2JUB A;  2JA5 I;  1QVF Y;  2OOX B;  1VQN 1;  2RIQ A;  2VDQ B;  3TDH B;  4Y7N I;  2IV2 X;  3CME 1;  4MON A;  4WK4 B;  1SSL A;  4MXU A;  5E6U B;  1NP6 A;  2QLV B;  3CCJ Z;  2RHB A;  1YIJ Z;  1Q82 2;  4A3C I;  2JIM A;  1Z03 A;  2E7Z A;  2W03 A;  4S1T A;  1Y1W I;  3NDJ A;  1JWH C;  2DE7 A;  2PM9 A;  3CCM 1;  2JS4 A;  3P5J B;  2VPW A;  1TWA I;  2VDM B;  4UM9 D;  4EWC A;  2NAP A;  5FLX f;  4NBA A;  2OOY B;  3CCQ Z;  2VF1 A;  2WAQ A;  3H0G I;  2LIY A;  1YJ9 Z;  3OKY B;  2V3V A;  4A3M I;  3CC4 1;  2VUM I;  4MD8 A;  2R7Z I;  3KIH A;  5T64 A;  1S72 Z;  4Z7N B;  3HOW I;  1VQL Z;  2PMZ A;  2O53 A;  2QRC B;  2IZ4 A;  2JWH A;  3CC2 1;  3I07 A;  3F3F C;  3D2L A;  4X6A I;  1VQK Z;  2LEX A;  4Z7O B;  4NBE A;  1YHQ 1;  3GKQ A;  1QVF Z;  1WJ2 A;  4NH1 C;  3S1R I;  1VQ9 1;  1W2B Z;  1QVG Y;  2E9H A;  3S1M I;  3PO2 I;  1TWC I;  2R6M A; 
#chains in the Genus database with same CATH homology
 4Z7Q B;  3GTP I;  3IX0 A;  3GTM I;  1USP B;  4NBF A;  2I3C A;  1NUI A;  4NBB A;  1YUA A;  3CXC Z;  1Q7Y 1;  3VMI A;  1QF8 A;  2VDP B;  3U50 C;  1TWH I;  3CC2 Z;  4RVH A;  1YIJ 1;  5C4X I;  4XX2 A;  5LL6 f;  5A2Q f;  1QYP A;  3T3P B;  3ZE2 B;  3VMH A;  3JAM b;  1YJN Z;  3VTN A;  1DL6 A;  4E30 A;  3I4N I;  1Z01 A;  3G4S Z;  1YHQ Z;  3NID B;  2DE6 A;  4E2Z A;  4E2W A;  1Q7Y 2;  3CCQ 1;  3S1Q I;  2OTL Z;  2JA8 I;  2VDO B;  1YJ9 1;  2VDL B;  3M4O I;  1PFT A;  2M48 A;  4FWW A;  2QEX Z;  3CCV 1;  1I3Q I;  2M6N A;  3HOZ I;  3OW2 Z;  1QVG Z;  1WW9 A;  2GU2 A;  3FCU B;  5C3E I;  1VQK 1;  2BJO A;  5IT9 b;  5T67 A;  2W04 A;  5D1O B;  1VQM Z;  4O3T B;  3I56 Z;  4BY7 I;  1VQ4 Z;  3CCR 1;  1X3W A;  3HOU I;  4WK0 B;  2V8K A;  2V8I A;  2UZY B;  5T6B A;  3VMG A;  4NBC A;  3D9X A;  3FQQ A;  4MD9 A;  1VQO 1;  1K73 1;  1RO4 A;  5FLM I;  5IP9 I;  1Y1V S;  4TNU A;  3CCV Z;  3VI4 B;  1OLZ A;  2YAD A;  4CL1 A;  1M90 1;  4AYB A;  3G71 Z;  1JJ2 Z;  2F4O A;  2PK7 A;  1YIT Z;  4MRI A;  1VQ8 1;  5IT9 f;  1USP A;  1I6H I;  4A93 I;  3D6W A;  3NIG B;  1YJW Z;  2P3Y A;  4BBR I;  1K73 2;  3OKW A;  1YJN 1;  1KQS Y;  1Q86 1;  2E2H I;  1RLY A;  1X0T A;  3G4S 1;  2GTI A;  2HF1 A;  3CD6 Z;  3EED A;  2J6A A;  1VQ7 1;  1M90 2;  3BG1 B;  3GTJ I;  5E6R B;  2H85 A;  3PO3 S;  4RVD A;  3CCR Z;  2OTL 1;  2QA4 1;  4NBG A;  3Q87 A;  2E2J I;  4DK1 A;  5C4J I;  3NIF B;  2HU9 A;  4NB8 A;  2F4M A;  3CPW Y;  2QEX 1;  4A3K I;  3AFC A;  3NH5 A;  3HOY I;  3T4N B;  1VQO Z;  2RPR A;  1Q86 2;  3GTL I;  3IFU A;  4WK2 B;  3NH4 A;  2V8J A;  2NVQ I;  3S2H I;  4RVG A;  2R93 I;  2OZK A;  2JMO A;  3MZL B;  3PO3 I;  1VQP 1;  3CC7 Z;  4UM8 B;  3F3P C;  1U8C B;  1VQ6 Z;  4UM9 B;  4A3L I;  3CMA Z;  1N2F A;  1SFO I;  2O4H A;  3S2D I;  1VQ8 Z;  3S15 I;  3LUS A;  3BG0 B;  3HOX I;  3S1N I;  1VQM 1;  4NB9 A;  1L1O C;  4DGL A;  3H3V J;  3I56 1;  3J81 b;  3RZO I;  2Y0S A;  3AL8 B;  1VQ4 1;  4RS4 A;  4HGY A;  3ZE1 B;  2VC2 B;  3CCL Z;  1ZB9 A;  1VQ7 Z;  3GTQ I;  5D1O A;  4BXX I;  1TFI A;  2E2I I;  3ZDY B;  2QA4 Z;  3S16 I;  4QTU A;  3IF8 A;  3RZD I;  1KD1 1;  3GTO I;  2VDR B;  3I55 Z;  4NFR A;  3G71 1;  1RO0 A;  1RNI A;  1M1K 1;  1YIT 1;  2ZAE B;  2YU9 I;  1K8A 1;  3GTG I;  2VDN B;  3CCS Z;  4MH4 A;  1VQP Z;  3CQZ I;  1YJW 1;  4NOZ A;  3GCF A;  1K83 I;  1N8R 1;  3J81 f;  1RQF A;  3JAM f;  1KD1 2;  3T3M B;  2K5R A;  3HKZ A;  3CD6 1;  4Y52 I;  2JA6 I;  1ZH1 A;  1WCM I;  3CCU Z;  1M1K 2;  3NVQ A;  1W2B Y;  3OL2 B;  2RBL A;  1K8A 2;  1TWF I;  3J7A 4;  2JWG A;  4WJK B;  1YI2 Z;  2NVX I;  2QKD A;  3FQM A;  2G2K A;  1N8R 2;  3J80 b;  4BBS I;  3FKI I;  1TYE B;  2R92 I;  1P9N A;  2AKL A;  3CCE Z;  3CC7 1;  2IZ3 A;  1WII A;  3MON A;  1VQ6 1;  3CXC Y;  3CMA 1;  2QRE B;  2JA7 I;  3NH8 A;  3VI3 B;  4NBD A;  3S17 I;  3ESW A;  2RT9 A;  4E33 A;  4A3D I;  1Y1V I;  3CCL 1;  3ZDZ B;  2OTJ Z;  2KPI A;  2GTH A;  4E2X A;  1TWG I;  2QRD B;  3ZE0 B;  2P28 A;  2NVY I;  1VQN Z;  4K3J B;  4E32 A;  3AL8 A;  3CME Z;  2Q51 A;  3J80 f;  1R9T I;  3I55 1;  5A2Q b;  3M3Y I;  3QWU A;  2JR6 A;  2Q4Z A;  3GTM S;  2KI7 B;  4GZ8 A;  4A3F I;  4A3J I;  4E31 A;  1SHY B;  4MD7 A;  3OW2 Y;  1ZB8 A;  1K9M 1;  2NVT I;  3G6E 1;  3CCS 1;  3CCM Z;  1NJI 1;  1I50 I;  4O3U B;  5HDB B;  2WB1 A;  4HH4 A;  3MZK B;  4A3I I;  3GTK I;  5E6S B;  3TE5 B;  4HGZ A;  4RVF A;  4E2Y A;  1VQ5 1;  1YUK A;  5AN9 F;  3VB9 A;  1Q81 1;  3CCU 1;  3I4M I;  1S7M A;  3CC4 Z;  1K9M 2;  1LQL A;  2DE5 A;  1KRL A;  4A3B I;  1YI2 1;  1NJI 2;  5C44 I;  3CCJ 1;  2VUG A;  1KC8 1;  1X3Z A;  1KQS Z;  4RV9 A;  2JNY A;  3NDI A;  1VLA A;  2EGT A;  3OL2 A;  1Q81 2;  4BY1 I;  1Z02 A;  5IP7 I;  4QTT A;  4A3E I;  3CCE 1;  2P26 A;  4DQY B;  1VQ9 Z;  2K3R A;  1JJ2 Y;  3AL9 A;  3G6E Z;  2QR1 B;  3NFZ A;  5FLX b;  5D1P A;  1RO2 A;  3KIF A;  3CPW Z;  4A3G I;  1KC8 2;  3EER A;  2B63 I;  5CM2 M;  4NBH A;  1Q82 1;  3ZDX B;  2VDK B;  3S14 I;  1S72 1;  1VQ5 Z;  2OTJ 1;  3K7A I;  3HOV I;  1ML8 A;  2LFU A;  1VQL 1;  2JUB A;  2JA5 I;  1QVF Y;  2OOX B;  1VQN 1;  2RIQ A;  2VDQ B;  3TDH B;  4Y7N I;  3CME 1;  4MON A;  4WK4 B;  1SSL A;  4MXU A;  5E6U B;  1NP6 A;  2QLV B;  3CCJ Z;  2RHB A;  1YIJ Z;  1Q82 2;  4A3C I;  1Z03 A;  2W03 A;  4S1T A;  1Y1W I;  3NDJ A;  1JWH C;  2DE7 A;  2PM9 A;  3CCM 1;  2JS4 A;  3P5J B;  2VDM B;  1TWA I;  4UM9 D;  4EWC A;  5FLX f;  4NBA A;  2OOY B;  3CCQ Z;  2VF1 A;  2WAQ A;  3H0G I;  2LIY A;  1YJ9 Z;  3OKY B;  4A3M I;  3CC4 1;  2VUM I;  4MD8 A;  2R7Z I;  3KIH A;  5T64 A;  1S72 Z;  4Z7N B;  3HOW I;  1VQL Z;  2PMZ A;  2O53 A;  2QRC B;  2IZ4 A;  2JWH A;  3CC2 1;  3I07 A;  3F3F C;  4X6A I;  1VQK Z;  4Z7O B;  4NBE A;  1YHQ 1;  3GKQ A;  1QVF Z;  4NH1 C;  3S1R I;  1VQ9 1;  1W2B Z;  1QVG Y;  2E9H A;  3S1M I;  3PO2 I;  1TWC I;  2R6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...