2P28A

Structure of the phe2 and phe3 fragments of the integrin beta2 subunit
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
96
Chain Sequence
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDQKQLSPQKVTLYLRPGQAAAFNVTFRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Integrin beta-2
publication title A structural hypothesis for the transition between bent and extended conformations of the leukocyte beta2 integrins
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 96
sequence length 100
ec nomenclature
pdb deposition date 2007-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.150 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2p28A02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 2p28A01
2VDMB 3ZE2B 3AL9A 2VDRB 5E6UB 4WJKB 3OL2B 5HDBB 5E6SB 4WK0B 1SSLA 3FCUB 4FWWA 1SHYB 4GZ8A 4O3UB 3ZDXB 3ZE1B 4UM9B 5E6RB 3T3PB 3OL2A 3NIGB 3T3MB 1TYEB 1YUKA 3AL8B 3NIDB 3OKYB 3NVQA 3OKWA 4K3JB 4UM8B 2UZYB 2VDKB 3ZDYB 1U8CB 2VDPB 3AFCA 2VC2B 3AL8A 2VDQB 4O3TB 3NIFB 4WK4B 3VI3B 2P26A 4Z7NB 2VDOB 3ZE0B 4Z7OB 2VDNB 2VDLB 4UM9D 4WK2B 4Z7QB 1OLZA 3ZDZB 2P28A 3VI4B
chains in the Genus database with same CATH superfamily
2W03A 3F3FC 2HU9A 1RNIA 5IP9I 2H85A 2IZ4A 2OTJ1 5E6SB 5IT9b 2PMZA 2K3RA 3HOZI 2JIQA 3CPWY 3NIGB 4MD8A 1VQ61 1VQK1 3CD61 3OKWA 1K731 3S2HI 4E33A 3I551 2JNYA 2F4OA 3ZE0B 3CMEZ 1VQ8Z 2LIYA 3CCE1 3CC2Z 2IZ3A 1VQMZ 2NVTI 3D9XA 1USPB 3J80f 1TFIA 3VTNA 2OZKA 2WAQA 5D1PA 3S1RI 4FWWA 3FKII 2JWGA 5E6RB 2BJOA 2YADA 1TYEB 4E32A 1YUKA 3CQZI 3GTMS 3J81b 4A3JI 1S72Z 3VB9A 4S1TA 1VQ51 3RZDI 1N2FA 2VUGA 4Y52I 4RVHA 1OLZA 3ZDZB 2VDMB 5C44I 1Q822 3CC21 4BXXI 3G4S1 1VQM1 1VQO1 2EGTA 4NFRA 4NBBA 1ZB8A 3HOYI 4A3MI 4NBAA 3CCVZ 3J7A4 5AN9F 2O53A 2E7ZA 1S721 4QTUA 5CM2M 3AFCA 3CXCZ 4WK4B 1S7MA 4Z7NB 3G71Z 2QRCB 2VDLB 1QVGZ 2YU9I 2VPWA 2K5RA 1TWGI 1N8R2 3ZE2B 3Q87A 2JIOA 2VDRB 2M48A 3OL2B 1RO2A 3CCJZ 4HGYA 1VQ41 2QR1B 3LUSA 1JJ2Z 4RVFA 5D1OA 2VPZA 1Q812 3FQMA 2I3CA 3S16I 2J6AA 3CCV1 1I3QI 4E30A 2VDPB 2VUMI 3VI3B 3CXCY 1M902 2O4HA 3G711 3IX0A 1QVGY 1YI2Z 3T4NB 3BG0B 3CCJ1 4A3BI 1JJ2Y 3CPWZ 1K8A2 1JWHC 3T3MB 3CCUZ 2DE5A 3G6E1 1TWAI 2UZYB 4DGLA 3ZDYB 5FLXf 3M3YI 3JAMf 2VC2B 4EWCA 2LEXA 4A3GI 2IV2X 3I55Z 3CC4Z 2OTL1 2P3YA 4MD7A 3M4OI 1N8R1 2OOYB 3MZLB 3NH8A 1YI21 3CCQ1 2R92I 3KIFA 4NB8A 4E31A 2GU2A 1Z03A 3PO3I 1TWFI 4UM9B 4NB9A 1Q811 3GTGI 4NBCA 1NJI1 3OKYB 2RPRA 3CCU1 1VQ7Z 1SFOI 1NUIA 1VQ5Z 1YIJZ 1M901 3VMIA 3GTOI 1VQLZ 3CC41 3TE5B 1SIWA 2JWHA 3G4SZ 1VQOZ 2VPYA 2R7ZI 1KRLA 3F3PC 1YUAA 1QVFZ 1Y1VS 3H3VJ 1P9NA 3VMGA 1K8A1 4E2ZA 1YITZ 1I50I 1VQ71 1YHQZ 1X0TA 4AYBA 2NAPA 1YIJ1 2JR6A 3GTQI 2VDOB 1TWCI 4WK2B 2JIMA 1VQL1 3HOUI 1R9TI 2W04A 3CCRZ 1AA6A 1VQ4Z 4A3LI 3I4MI 2QA41 2JA7I 1QVFY 4QTTA 2QLVB 1PFTA 1FDIA 1YIT1 2PK7A 4E2YA 4RVGA 1VQP1 1YHQ1 5C3EI 2JA5I 2VDQB 4A3CI 2P26A 3GKQA 3IFUA 5T67A 3CCR1 2NVYI 1VQ91 4TNUA 1YJW1 3I07A 1RO4A 4O3UB 3ZE1B 3FQQA 3ESWA 3T3PB 3IF8A 5IT9f 2V8IA 1KC82 3AL8B 3G6EZ 2NVQI 3S15I 4A3II 2Y0SA 3HOXI 3CCSZ 2OTLZ 3J80b 3TDHB 3I4NI 3P5JB 3GTMI 4DK1A 1Q821 3H0GI 4RVDA 1WZNA 2JIPA 3CCQZ 3CCMZ 2NVXI 5LL6f 3S2DI 1SSLA 5A2Qf 1QXFA 2Q4ZA 4NBGA 4DQYB 5T64A 1YJ91 2QRDB 2JMOA 4Y7NI 4UM8B 3J81f 1KD12 2V8KA 3GTLI 1Y8CA 3I561 2RHBA 3CCLZ 2VDNB 4Z7QB 3CCS1 1X3ZA 3K7AI 3VI4B 2E9HA 2OOXB 4MXUA 2RT9A 1QF8A 4BY1I 2QEXZ 3CCM1 1DL6A 3FCUB 3U50C 4CL1A 2RBLA 1KC81 2RIQA 3KIHA 2JIRA 2AKLA 1U8CB 2PM9A 1Q862 1Z01A 4BBRI 4MONA 3HKZA 2JA6I 4Z7OB 3S1NI 3CCL1 2Q51A 3GTPI 4MH4A 4NH1C 3D2LA 5E6UB 2B63I 2QEX1 2QA4Z 1Y1WI 4WK0B 2QREB 1WJ2A 3MONA 3NH4A 3NH5A 4A3KI 3NDJA 2V3VA 2GTHA 1WW9A 4RS4A 1KD11 3S14I 1VQPZ 3S17I 1FDOA 1WCMI 3HOWI 4E2XA 4O3TB 1RLYA 1TWHI 1KQSZ 2AYDA 4NBEA 4NBDA 4X6AI 2P28A 2R93I 1VLAA 2VPXA 3AL9A 1L1OC 5A2Qb 3RZOI 5HDBB 2KI7B 1VQ9Z 1ML8A 4E2WA 1YJWZ 2E2JI 2HF1A 3NFZA 4A3FI 1USPA 3S1MI 5FLXb 5T6BA 2F4MA 3JAMb 1I6HI 2GTIA 3CC7Z 1VQNZ 3NDIA 1Q861 1RQFA 1Q7Y2 1K9M2 1ZB9A 3NIFB 1ZH1A 3GTJI 3CME1 4UM9D 1VQ81 4HH4A 1KQSY 3HOVI 3D6WA 5D1OB 4A3DI 5C4XI 3BG1B 1X3WA 4A3EI 3VMHA 3GCFA 4BY7I 4GZ8A 5IP7I 5C4JI 2M6NA 1YJ9Z 1YJNZ 1LQLA 5FLMI 2E2II 1WIIA 3GTKI 1VQN1 3CC71 2DE6A 1M1K2 1Y1VI 4NOZA 3I56Z 4A93I 3PO3S 1W2BZ 2G2KA 3CMAZ 2ZAEB 2V45A 3QWUA 4RV9A 2VF1A 4WJKB 2QKDA 4XX2A 2LFUA 3S1QI 2WB1A 4HGZA 1SHYB 2DE7A 3ZDXB 3EEDA 3OL2A 1NJI2 3OW2Z 1YJN1 4MD9A 4K3JB 4BBSI 2KPIA 1K732 2V8JA 1Q7Y1 3AL8A 1K9M1 4NBHA 3EERA 2JS4A 1W2BY 3CMA1 2JUBA 3IR7A 2OTJZ 1NP6A 3PO2I 1RO0A 1Z02A 4NBFA 1VQ6Z 3MZKB 1VQKZ 3CD6Z 3NIDB 2E2HI 3NVQA 3OW2Y 2JA8I 2VDKB 2R6MA 1M1K1 4MRIA 1Q16A 1QYPA 1K83I 3CCEZ
chains in the Genus database with same CATH topology
2W03A 3F3FC 2HU9A 1RNIA 5IP9I 2H85A 2IZ4A 2OTJ1 5E6SB 5IT9b 2PMZA 2K3RA 3HOZI 3CPWY 3NIGB 4MD8A 1VQ61 1VQK1 3CD61 3OKWA 1K731 3S2HI 4E33A 3I551 2JNYA 2F4OA 3ZE0B 3CMEZ 1VQ8Z 2LIYA 3CCE1 3CC2Z 2IZ3A 1VQMZ 2NVTI 3D9XA 1USPB 3J80f 1TFIA 3VTNA 2OZKA 2WAQA 5D1PA 3S1RI 4FWWA 3FKII 2JWGA 5E6RB 2BJOA 2YADA 1TYEB 4E32A 1YUKA 3CQZI 3GTMS 3J81b 4A3JI 1S72Z 3VB9A 4S1TA 1VQ51 3RZDI 1N2FA 2VUGA 4Y52I 4RVHA 1OLZA 3ZDZB 2VDMB 5C44I 1Q822 3CC21 4BXXI 3G4S1 1VQM1 1VQO1 2EGTA 4NFRA 4NBBA 1ZB8A 3HOYI 4A3MI 4NBAA 3CCVZ 3J7A4 5AN9F 2O53A 1S721 4QTUA 5CM2M 3AFCA 3CXCZ 4WK4B 1S7MA 4Z7NB 3G71Z 2QRCB 2VDLB 1QVGZ 2YU9I 2K5RA 1TWGI 1N8R2 3ZE2B 3Q87A 2VDRB 2M48A 3OL2B 1RO2A 3CCJZ 4HGYA 1VQ41 2QR1B 3LUSA 1JJ2Z 4RVFA 5D1OA 1Q812 3FQMA 2I3CA 3S16I 2J6AA 3CCV1 1I3QI 4E30A 2VDPB 2VUMI 3VI3B 3CXCY 1M902 2O4HA 3G711 3IX0A 1QVGY 1YI2Z 3T4NB 3BG0B 3CCJ1 4A3BI 1JJ2Y 3CPWZ 1K8A2 1JWHC 3T3MB 3CCUZ 2DE5A 3G6E1 1TWAI 2UZYB 4DGLA 3ZDYB 5FLXf 3M3YI 3JAMf 2VC2B 4EWCA 4A3GI 3I55Z 3CC4Z 2OTL1 2P3YA 4MD7A 3M4OI 1N8R1 2OOYB 3MZLB 3NH8A 1YI21 3CCQ1 2R92I 3KIFA 4NB8A 4E31A 2GU2A 1Z03A 3PO3I 1TWFI 4UM9B 4NB9A 1Q811 3GTGI 4NBCA 1NJI1 3OKYB 2RPRA 3CCU1 1VQ7Z 1SFOI 1NUIA 1VQ5Z 1YIJZ 1M901 3VMIA 3GTOI 1VQLZ 3CC41 3TE5B 2JWHA 3G4SZ 1VQOZ 2R7ZI 1KRLA 3F3PC 1YUAA 1QVFZ 1Y1VS 3H3VJ 1P9NA 3VMGA 1K8A1 4E2ZA 1YITZ 1I50I 1VQ71 1YHQZ 1X0TA 4AYBA 1YIJ1 2JR6A 3GTQI 2VDOB 1TWCI 4WK2B 1VQL1 3HOUI 1R9TI 2W04A 3CCRZ 1VQ4Z 4A3LI 3I4MI 2QA41 2JA7I 1QVFY 4QTTA 2QLVB 1PFTA 1YIT1 2PK7A 4E2YA 4RVGA 1VQP1 1YHQ1 5C3EI 2JA5I 2VDQB 4A3CI 2P26A 3GKQA 3IFUA 5T67A 3CCR1 2NVYI 1VQ91 4TNUA 1YJW1 3I07A 1RO4A 4O3UB 3ZE1B 3FQQA 3ESWA 3T3PB 3IF8A 5IT9f 2V8IA 1KC82 3AL8B 3G6EZ 2NVQI 3S15I 4A3II 2Y0SA 3HOXI 3CCSZ 2OTLZ 3J80b 3TDHB 3I4NI 3P5JB 3GTMI 4DK1A 1Q821 3H0GI 4RVDA 3CCQZ 3CCMZ 2NVXI 5LL6f 3S2DI 1SSLA 5A2Qf 2Q4ZA 4DQYB 4NBGA 5T64A 1YJ91 2QRDB 2JMOA 4Y7NI 4UM8B 3J81f 1KD12 2V8KA 3GTLI 3I561 2RHBA 3CCLZ 2VDNB 4Z7QB 3CCS1 1X3ZA 3K7AI 3VI4B 2E9HA 2OOXB 4MXUA 2RT9A 1QF8A 4BY1I 2QEXZ 3CCM1 1DL6A 3FCUB 3U50C 4CL1A 2RBLA 1KC81 2RIQA 3KIHA 2AKLA 1U8CB 2PM9A 1Q862 1Z01A 4BBRI 4MONA 3HKZA 2JA6I 4Z7OB 3S1NI 3CCL1 2Q51A 3GTPI 4MH4A 4NH1C 5E6UB 2B63I 2QEX1 2QA4Z 1Y1WI 4WK0B 2QREB 3MONA 3NH4A 3NH5A 4A3KI 3NDJA 2GTHA 1WW9A 4RS4A 1KD11 3S14I 1VQPZ 3S17I 1WCMI 3HOWI 4E2XA 4O3TB 1RLYA 1TWHI 1KQSZ 4NBEA 4NBDA 4X6AI 2P28A 2R93I 1VLAA 3AL9A 1L1OC 5A2Qb 3RZOI 5HDBB 2KI7B 1VQ9Z 1ML8A 4E2WA 1YJWZ 2E2JI 2HF1A 3NFZA 4A3FI 1USPA 3S1MI 5FLXb 5T6BA 2F4MA 3JAMb 1I6HI 2GTIA 3CC7Z 1VQNZ 3NDIA 1Q861 1RQFA 1Q7Y2 1K9M2 1ZB9A 3NIFB 1ZH1A 3GTJI 3CME1 4UM9D 1VQ81 4HH4A 1KQSY 3HOVI 3D6WA 5D1OB 4A3DI 5C4XI 3BG1B 1X3WA 4A3EI 3VMHA 3GCFA 4BY7I 4GZ8A 5IP7I 5C4JI 2M6NA 1YJ9Z 1YJNZ 1LQLA 5FLMI 2E2II 1WIIA 3GTKI 1VQN1 3CC71 2DE6A 1M1K2 1Y1VI 4NOZA 3I56Z 4A93I 3PO3S 1W2BZ 2G2KA 3CMAZ 2ZAEB 3QWUA 4RV9A 2VF1A 4WJKB 2QKDA 4XX2A 2LFUA 3S1QI 2WB1A 4HGZA 1SHYB 2DE7A 3ZDXB 3EEDA 3OL2A 1NJI2 3OW2Z 1YJN1 4MD9A 4K3JB 4BBSI 2KPIA 1K732 2V8JA 1Q7Y1 3AL8A 1K9M1 4NBHA 3EERA 2JS4A 1W2BY 3CMA1 2JUBA 2OTJZ 1NP6A 3PO2I 1RO0A 1Z02A 4NBFA 1VQ6Z 3MZKB 1VQKZ 3CD6Z 3NIDB 2E2HI 3NVQA 3OW2Y 2JA8I 2VDKB 2R6MA 1M1K1 4MRIA 1QYPA 1K83I 3CCEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDM B;  3ZE2 B;  3AL9 A;  2VDR B;  5E6U B;  4WJK B;  3OL2 B;  5HDB B;  5E6S B;  4WK0 B;  1SSL A;  3FCU B;  4FWW A;  1SHY B;  4GZ8 A;  4O3U B;  3ZDX B;  3ZE1 B;  4UM9 B;  5E6R B;  3T3P B;  3OL2 A;  3NIG B;  3T3M B;  1TYE B;  1YUK A;  3AL8 B;  3NID B;  3OKY B;  3NVQ A;  3OKW A;  4K3J B;  4UM8 B;  2UZY B;  2VDK B;  3ZDY B;  1U8C B;  2VDP B;  3AFC A;  2VC2 B;  3AL8 A;  2VDQ B;  4O3T B;  3NIF B;  4WK4 B;  3VI3 B;  2P26 A;  4Z7N B;  2VDO B;  3ZE0 B;  4Z7O B;  2VDN B;  2VDL B;  4UM9 D;  4WK2 B;  4Z7Q B;  1OLZ A;  3ZDZ B;  2P28 A;  3VI4 B; 
#chains in the Genus database with same CATH topology
 2W03 A;  3F3F C;  2HU9 A;  1RNI A;  5IP9 I;  2H85 A;  2IZ4 A;  2OTJ 1;  5E6S B;  5IT9 b;  2PMZ A;  2K3R A;  3HOZ I;  2JIQ A;  3CPW Y;  3NIG B;  4MD8 A;  1VQ6 1;  1VQK 1;  3CD6 1;  3OKW A;  1K73 1;  3S2H I;  4E33 A;  3I55 1;  2JNY A;  2F4O A;  3ZE0 B;  3CME Z;  1VQ8 Z;  2LIY A;  3CCE 1;  3CC2 Z;  2IZ3 A;  1VQM Z;  2NVT I;  3D9X A;  1USP B;  3J80 f;  1TFI A;  3VTN A;  2OZK A;  2WAQ A;  5D1P A;  3S1R I;  4FWW A;  3FKI I;  2JWG A;  5E6R B;  2BJO A;  2YAD A;  1TYE B;  4E32 A;  1YUK A;  3CQZ I;  3GTM S;  3J81 b;  4A3J I;  1S72 Z;  3VB9 A;  4S1T A;  1VQ5 1;  3RZD I;  1N2F A;  2VUG A;  4Y52 I;  4RVH A;  1OLZ A;  3ZDZ B;  2VDM B;  5C44 I;  1Q82 2;  3CC2 1;  4BXX I;  3G4S 1;  1VQM 1;  1VQO 1;  2EGT A;  4NFR A;  4NBB A;  1ZB8 A;  3HOY I;  4A3M I;  4NBA A;  3CCV Z;  3J7A 4;  5AN9 F;  2O53 A;  2E7Z A;  1S72 1;  4QTU A;  5CM2 M;  3AFC A;  3CXC Z;  4WK4 B;  1S7M A;  4Z7N B;  3G71 Z;  2QRC B;  2VDL B;  1QVG Z;  2YU9 I;  2VPW A;  2K5R A;  1TWG I;  1N8R 2;  3ZE2 B;  3Q87 A;  2JIO A;  2VDR B;  2M48 A;  3OL2 B;  1RO2 A;  3CCJ Z;  4HGY A;  1VQ4 1;  2QR1 B;  3LUS A;  1JJ2 Z;  4RVF A;  5D1O A;  2VPZ A;  1Q81 2;  3FQM A;  2I3C A;  3S16 I;  2J6A A;  3CCV 1;  1I3Q I;  4E30 A;  2VDP B;  2VUM I;  3VI3 B;  3CXC Y;  1M90 2;  2O4H A;  3G71 1;  3IX0 A;  1QVG Y;  1YI2 Z;  3T4N B;  3BG0 B;  3CCJ 1;  4A3B I;  1JJ2 Y;  3CPW Z;  1K8A 2;  1JWH C;  3T3M B;  3CCU Z;  2DE5 A;  3G6E 1;  1TWA I;  2UZY B;  4DGL A;  3ZDY B;  5FLX f;  3M3Y I;  3JAM f;  2VC2 B;  4EWC A;  2LEX A;  4A3G I;  2IV2 X;  3I55 Z;  3CC4 Z;  2OTL 1;  2P3Y A;  4MD7 A;  3M4O I;  1N8R 1;  2OOY B;  3MZL B;  3NH8 A;  1YI2 1;  3CCQ 1;  2R92 I;  3KIF A;  4NB8 A;  4E31 A;  2GU2 A;  1Z03 A;  3PO3 I;  1TWF I;  4UM9 B;  4NB9 A;  1Q81 1;  3GTG I;  4NBC A;  1NJI 1;  3OKY B;  2RPR A;  3CCU 1;  1VQ7 Z;  1SFO I;  1NUI A;  1VQ5 Z;  1YIJ Z;  1M90 1;  3VMI A;  3GTO I;  1VQL Z;  3CC4 1;  3TE5 B;  1SIW A;  2JWH A;  3G4S Z;  1VQO Z;  2VPY A;  2R7Z I;  1KRL A;  3F3P C;  1YUA A;  1QVF Z;  1Y1V S;  3H3V J;  1P9N A;  3VMG A;  1K8A 1;  4E2Z A;  1YIT Z;  1I50 I;  1VQ7 1;  1YHQ Z;  1X0T A;  4AYB A;  2NAP A;  1YIJ 1;  2JR6 A;  3GTQ I;  2VDO B;  1TWC I;  4WK2 B;  2JIM A;  1VQL 1;  3HOU I;  1R9T I;  2W04 A;  3CCR Z;  1AA6 A;  1VQ4 Z;  4A3L I;  3I4M I;  2QA4 1;  2JA7 I;  1QVF Y;  4QTT A;  2QLV B;  1PFT A;  1FDI A;  1YIT 1;  2PK7 A;  4E2Y A;  4RVG A;  1VQP 1;  1YHQ 1;  5C3E I;  2JA5 I;  2VDQ B;  4A3C I;  2P26 A;  3GKQ A;  3IFU A;  5T67 A;  3CCR 1;  2NVY I;  1VQ9 1;  4TNU A;  1YJW 1;  3I07 A;  1RO4 A;  4O3U B;  3ZE1 B;  3FQQ A;  3ESW A;  3T3P B;  3IF8 A;  5IT9 f;  2V8I A;  1KC8 2;  3AL8 B;  3G6E Z;  2NVQ I;  3S15 I;  4A3I I;  2Y0S A;  3HOX I;  3CCS Z;  2OTL Z;  3J80 b;  3TDH B;  3I4N I;  3P5J B;  3GTM I;  4DK1 A;  1Q82 1;  3H0G I;  4RVD A;  1WZN A;  2JIP A;  3CCQ Z;  3CCM Z;  2NVX I;  5LL6 f;  3S2D I;  1SSL A;  5A2Q f;  1QXF A;  2Q4Z A;  4NBG A;  4DQY B;  5T64 A;  1YJ9 1;  2QRD B;  2JMO A;  4Y7N I;  4UM8 B;  3J81 f;  1KD1 2;  2V8K A;  3GTL I;  1Y8C A;  3I56 1;  2RHB A;  3CCL Z;  2VDN B;  4Z7Q B;  3CCS 1;  1X3Z A;  3K7A I;  3VI4 B;  2E9H A;  2OOX B;  4MXU A;  2RT9 A;  1QF8 A;  4BY1 I;  2QEX Z;  3CCM 1;  1DL6 A;  3FCU B;  3U50 C;  4CL1 A;  2RBL A;  1KC8 1;  2RIQ A;  3KIH A;  2JIR A;  2AKL A;  1U8C B;  2PM9 A;  1Q86 2;  1Z01 A;  4BBR I;  4MON A;  3HKZ A;  2JA6 I;  4Z7O B;  3S1N I;  3CCL 1;  2Q51 A;  3GTP I;  4MH4 A;  4NH1 C;  3D2L A;  5E6U B;  2B63 I;  2QEX 1;  2QA4 Z;  1Y1W I;  4WK0 B;  2QRE B;  1WJ2 A;  3MON A;  3NH4 A;  3NH5 A;  4A3K I;  3NDJ A;  2V3V A;  2GTH A;  1WW9 A;  4RS4 A;  1KD1 1;  3S14 I;  1VQP Z;  3S17 I;  1FDO A;  1WCM I;  3HOW I;  4E2X A;  4O3T B;  1RLY A;  1TWH I;  1KQS Z;  2AYD A;  4NBE A;  4NBD A;  4X6A I;  2P28 A;  2R93 I;  1VLA A;  2VPX A;  3AL9 A;  1L1O C;  5A2Q b;  3RZO I;  5HDB B;  2KI7 B;  1VQ9 Z;  1ML8 A;  4E2W A;  1YJW Z;  2E2J I;  2HF1 A;  3NFZ A;  4A3F I;  1USP A;  3S1M I;  5FLX b;  5T6B A;  2F4M A;  3JAM b;  1I6H I;  2GTI A;  3CC7 Z;  1VQN Z;  3NDI A;  1Q86 1;  1RQF A;  1Q7Y 2;  1K9M 2;  1ZB9 A;  3NIF B;  1ZH1 A;  3GTJ I;  3CME 1;  4UM9 D;  1VQ8 1;  4HH4 A;  1KQS Y;  3HOV I;  3D6W A;  5D1O B;  4A3D I;  5C4X I;  3BG1 B;  1X3W A;  4A3E I;  3VMH A;  3GCF A;  4BY7 I;  4GZ8 A;  5IP7 I;  5C4J I;  2M6N A;  1YJ9 Z;  1YJN Z;  1LQL A;  5FLM I;  2E2I I;  1WII A;  3GTK I;  1VQN 1;  3CC7 1;  2DE6 A;  1M1K 2;  1Y1V I;  4NOZ A;  3I56 Z;  4A93 I;  3PO3 S;  1W2B Z;  2G2K A;  3CMA Z;  2ZAE B;  2V45 A;  3QWU A;  4RV9 A;  2VF1 A;  4WJK B;  2QKD A;  4XX2 A;  2LFU A;  3S1Q I;  2WB1 A;  4HGZ A;  1SHY B;  2DE7 A;  3ZDX B;  3EED A;  3OL2 A;  1NJI 2;  3OW2 Z;  1YJN 1;  4MD9 A;  4K3J B;  4BBS I;  2KPI A;  1K73 2;  2V8J A;  1Q7Y 1;  3AL8 A;  1K9M 1;  4NBH A;  3EER A;  2JS4 A;  1W2B Y;  3CMA 1;  2JUB A;  3IR7 A;  2OTJ Z;  1NP6 A;  3PO2 I;  1RO0 A;  1Z02 A;  4NBF A;  1VQ6 Z;  3MZK B;  1VQK Z;  3CD6 Z;  3NID B;  2E2H I;  3NVQ A;  3OW2 Y;  2JA8 I;  2VDK B;  2R6M A;  1M1K 1;  4MRI A;  1Q16 A;  1QYP A;  1K83 I;  3CCE Z; 
#chains in the Genus database with same CATH homology
 2W03 A;  3F3F C;  2HU9 A;  1RNI A;  5IP9 I;  2H85 A;  2IZ4 A;  2OTJ 1;  5E6S B;  5IT9 b;  2PMZ A;  2K3R A;  3HOZ I;  3CPW Y;  3NIG B;  4MD8 A;  1VQ6 1;  1VQK 1;  3CD6 1;  3OKW A;  1K73 1;  3S2H I;  4E33 A;  3I55 1;  2JNY A;  2F4O A;  3ZE0 B;  3CME Z;  1VQ8 Z;  2LIY A;  3CCE 1;  3CC2 Z;  2IZ3 A;  1VQM Z;  2NVT I;  3D9X A;  1USP B;  3J80 f;  1TFI A;  3VTN A;  2OZK A;  2WAQ A;  5D1P A;  3S1R I;  4FWW A;  3FKI I;  2JWG A;  5E6R B;  2BJO A;  2YAD A;  1TYE B;  4E32 A;  1YUK A;  3CQZ I;  3GTM S;  3J81 b;  4A3J I;  1S72 Z;  3VB9 A;  4S1T A;  1VQ5 1;  3RZD I;  1N2F A;  2VUG A;  4Y52 I;  4RVH A;  1OLZ A;  3ZDZ B;  2VDM B;  5C44 I;  1Q82 2;  3CC2 1;  4BXX I;  3G4S 1;  1VQM 1;  1VQO 1;  2EGT A;  4NFR A;  4NBB A;  1ZB8 A;  3HOY I;  4A3M I;  4NBA A;  3CCV Z;  3J7A 4;  5AN9 F;  2O53 A;  1S72 1;  4QTU A;  5CM2 M;  3AFC A;  3CXC Z;  4WK4 B;  1S7M A;  4Z7N B;  3G71 Z;  2QRC B;  2VDL B;  1QVG Z;  2YU9 I;  2K5R A;  1TWG I;  1N8R 2;  3ZE2 B;  3Q87 A;  2VDR B;  2M48 A;  3OL2 B;  1RO2 A;  3CCJ Z;  4HGY A;  1VQ4 1;  2QR1 B;  3LUS A;  1JJ2 Z;  4RVF A;  5D1O A;  1Q81 2;  3FQM A;  2I3C A;  3S16 I;  2J6A A;  3CCV 1;  1I3Q I;  4E30 A;  2VDP B;  2VUM I;  3VI3 B;  3CXC Y;  1M90 2;  2O4H A;  3G71 1;  3IX0 A;  1QVG Y;  1YI2 Z;  3T4N B;  3BG0 B;  3CCJ 1;  4A3B I;  1JJ2 Y;  3CPW Z;  1K8A 2;  1JWH C;  3T3M B;  3CCU Z;  2DE5 A;  3G6E 1;  1TWA I;  2UZY B;  4DGL A;  3ZDY B;  5FLX f;  3M3Y I;  3JAM f;  2VC2 B;  4EWC A;  4A3G I;  3I55 Z;  3CC4 Z;  2OTL 1;  2P3Y A;  4MD7 A;  3M4O I;  1N8R 1;  2OOY B;  3MZL B;  3NH8 A;  1YI2 1;  3CCQ 1;  2R92 I;  3KIF A;  4NB8 A;  4E31 A;  2GU2 A;  1Z03 A;  3PO3 I;  1TWF I;  4UM9 B;  4NB9 A;  1Q81 1;  3GTG I;  4NBC A;  1NJI 1;  3OKY B;  2RPR A;  3CCU 1;  1VQ7 Z;  1SFO I;  1NUI A;  1VQ5 Z;  1YIJ Z;  1M90 1;  3VMI A;  3GTO I;  1VQL Z;  3CC4 1;  3TE5 B;  2JWH A;  3G4S Z;  1VQO Z;  2R7Z I;  1KRL A;  3F3P C;  1YUA A;  1QVF Z;  1Y1V S;  3H3V J;  1P9N A;  3VMG A;  1K8A 1;  4E2Z A;  1YIT Z;  1I50 I;  1VQ7 1;  1YHQ Z;  1X0T A;  4AYB A;  1YIJ 1;  2JR6 A;  3GTQ I;  2VDO B;  1TWC I;  4WK2 B;  1VQL 1;  3HOU I;  1R9T I;  2W04 A;  3CCR Z;  1VQ4 Z;  4A3L I;  3I4M I;  2QA4 1;  2JA7 I;  1QVF Y;  4QTT A;  2QLV B;  1PFT A;  1YIT 1;  2PK7 A;  4E2Y A;  4RVG A;  1VQP 1;  1YHQ 1;  5C3E I;  2JA5 I;  2VDQ B;  4A3C I;  2P26 A;  3GKQ A;  3IFU A;  5T67 A;  3CCR 1;  2NVY I;  1VQ9 1;  4TNU A;  1YJW 1;  3I07 A;  1RO4 A;  4O3U B;  3ZE1 B;  3FQQ A;  3ESW A;  3T3P B;  3IF8 A;  5IT9 f;  2V8I A;  1KC8 2;  3AL8 B;  3G6E Z;  2NVQ I;  3S15 I;  4A3I I;  2Y0S A;  3HOX I;  3CCS Z;  2OTL Z;  3J80 b;  3TDH B;  3I4N I;  3P5J B;  3GTM I;  4DK1 A;  1Q82 1;  3H0G I;  4RVD A;  3CCQ Z;  3CCM Z;  2NVX I;  5LL6 f;  3S2D I;  1SSL A;  5A2Q f;  2Q4Z A;  4DQY B;  4NBG A;  5T64 A;  1YJ9 1;  2QRD B;  2JMO A;  4Y7N I;  4UM8 B;  3J81 f;  1KD1 2;  2V8K A;  3GTL I;  3I56 1;  2RHB A;  3CCL Z;  2VDN B;  4Z7Q B;  3CCS 1;  1X3Z A;  3K7A I;  3VI4 B;  2E9H A;  2OOX B;  4MXU A;  2RT9 A;  1QF8 A;  4BY1 I;  2QEX Z;  3CCM 1;  1DL6 A;  3FCU B;  3U50 C;  4CL1 A;  2RBL A;  1KC8 1;  2RIQ A;  3KIH A;  2AKL A;  1U8C B;  2PM9 A;  1Q86 2;  1Z01 A;  4BBR I;  4MON A;  3HKZ A;  2JA6 I;  4Z7O B;  3S1N I;  3CCL 1;  2Q51 A;  3GTP I;  4MH4 A;  4NH1 C;  5E6U B;  2B63 I;  2QEX 1;  2QA4 Z;  1Y1W I;  4WK0 B;  2QRE B;  3MON A;  3NH4 A;  3NH5 A;  4A3K I;  3NDJ A;  2GTH A;  1WW9 A;  4RS4 A;  1KD1 1;  3S14 I;  1VQP Z;  3S17 I;  1WCM I;  3HOW I;  4E2X A;  4O3T B;  1RLY A;  1TWH I;  1KQS Z;  4NBE A;  4NBD A;  4X6A I;  2P28 A;  2R93 I;  1VLA A;  3AL9 A;  1L1O C;  5A2Q b;  3RZO I;  5HDB B;  2KI7 B;  1VQ9 Z;  1ML8 A;  4E2W A;  1YJW Z;  2E2J I;  2HF1 A;  3NFZ A;  4A3F I;  1USP A;  3S1M I;  5FLX b;  5T6B A;  2F4M A;  3JAM b;  1I6H I;  2GTI A;  3CC7 Z;  1VQN Z;  3NDI A;  1Q86 1;  1RQF A;  1Q7Y 2;  1K9M 2;  1ZB9 A;  3NIF B;  1ZH1 A;  3GTJ I;  3CME 1;  4UM9 D;  1VQ8 1;  4HH4 A;  1KQS Y;  3HOV I;  3D6W A;  5D1O B;  4A3D I;  5C4X I;  3BG1 B;  1X3W A;  4A3E I;  3VMH A;  3GCF A;  4BY7 I;  4GZ8 A;  5IP7 I;  5C4J I;  2M6N A;  1YJ9 Z;  1YJN Z;  1LQL A;  5FLM I;  2E2I I;  1WII A;  3GTK I;  1VQN 1;  3CC7 1;  2DE6 A;  1M1K 2;  1Y1V I;  4NOZ A;  3I56 Z;  4A93 I;  3PO3 S;  1W2B Z;  2G2K A;  3CMA Z;  2ZAE B;  3QWU A;  4RV9 A;  2VF1 A;  4WJK B;  2QKD A;  4XX2 A;  2LFU A;  3S1Q I;  2WB1 A;  4HGZ A;  1SHY B;  2DE7 A;  3ZDX B;  3EED A;  3OL2 A;  1NJI 2;  3OW2 Z;  1YJN 1;  4MD9 A;  4K3J B;  4BBS I;  2KPI A;  1K73 2;  2V8J A;  1Q7Y 1;  3AL8 A;  1K9M 1;  4NBH A;  3EER A;  2JS4 A;  1W2B Y;  3CMA 1;  2JUB A;  2OTJ Z;  1NP6 A;  3PO2 I;  1RO0 A;  1Z02 A;  4NBF A;  1VQ6 Z;  3MZK B;  1VQK Z;  3CD6 Z;  3NID B;  2E2H I;  3NVQ A;  3OW2 Y;  2JA8 I;  2VDK B;  2R6M A;  1M1K 1;  4MRI A;  1QYP A;  1K83 I;  3CCE Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...