1NUIA

Crystal structure of the primase fragment of bacteriophage t7 primase-helicase protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
246
structure length
242
Chain Sequence
VFLYHIPCDNCGSSDGNSLFSDGHTFCYVCEKWTATKERASKRKPSGGKPGTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular Architecture of the Bacteriophage T7 Primase Couples RNA primer Synthesis to DNA Synthesis
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Replication
molecule keywords DNA primase/helicase
total genus 62
structure length 242
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08273 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nuiA01
4A93I 3S17I 4NBCA 3S2HI 2DE5A 3S1MI 4NBDA 2JA5I 2JS4A 1USPB 2NVXI 3VMHA 3S2DI 3GTPI 4A3DI 3I07A 1ZB9A 2R93I 3GTKI 3I4NI 2AKLA 1QYPA 1I6HI 3VMGA 4A3MI 1Y1VS 4XX2A 5IP9I 4A3GI 1I3QI 1ML8A 2F4MA 1SFOI 3D6WA 3S14I 3HOUI 4Y52I 1TWCI 3S1NI 2BJOA 3HOWI 4NBHA 4NOZA 4BY1I 1RO4A 3S15I 1N2FA 2J6AA 3Q87A 3ESWA 3GTMI 4NBGA 2R7ZI 4A3LI 2JNYA 2K5RA 4Y7NI 5C44I 3RZOI 4A3CI 2E2II 3PO3I 1X3ZA 4QTTA 2P3YA 4BBRI 2E2JI 1PFTA 1Y1VI 3GTJI 3RZDI 2JR6A 3EERA 2JA8I 3HOYI 4QTUA 1YUAA 2NVQI 4X6AI 4BXXI 3K7AI 5FLMI 2HF1A 1TWHI 5C4JI 2DE7A 3GCFA 2B63I 1TWFI 1WW9A 1NUIA 2KPIA 3U50C 3GTMS 3H3VJ 2JA7I 2PK7A 5CM2M 4A3KI 1X3WA 1WCMI 5C3EI 2RBLA 3FKII 3VB9A 3HOZI 4A3BI 4BY7I 3S1QI 1DL6A 4A3JI 3GTOI 3M3YI 3GTGI 3CQZI 3S16I 3GTQI 4A3FI 1ZB8A 1K83I 5IP7I 1VLAA 1RLYA 2NVYI 3HOVI 3PO2I 1Y1WI 4BBSI 4NBBA 2NVTI 1TFIA 4NBEA 3S1RI 5C4XI 4NB9A 4A3II 3GTLI 2YU9I 4NBAA 2F4OA 3H0GI 3GKQA 1LQLA 4NB8A 1TWGI 2VUMI 3VMIA 1R9TI 1USPA 4NBFA 1TWAI 4A3EI 2JA6I 3LUSA 2R92I 4MH4A 2E2HI 3PO3S 1L1OC 1I50I 3M4OI 3I4MI 2DE6A 3HOXI
chains in the Genus database with same CATH superfamily
4A93I 1N8R1 3S2HI 2DE5A 3S1MI 1N8R2 3G6EZ 1Q861 1WZNA 2AKLA 4XX2A 4A3GI 2G2KA 3CC4Z 1QF8A 3CCE1 1SFOI 5D1OA 3OW2Y 1JWHC 3CCV1 4Y52I 3CXCY 3S1NI 2BJOA 3F3PC 2O4HA 3G71Z 4MXUA 1VQ41 3CXCZ 2QEX1 1W2BY 1VQN1 2J6AA 3Q87A 2JIRA 4A3LI 1VQ51 1QVFY 4Y7NI 1X3ZA 4BBRI 2JR6A 3EERA 2QRDB 1Q822 3I561 1RO0A 4HGYA 4BXXI 4X6AI 3J80f 3IFUA 2M48A 2HF1A 3G711 1VQ4Z 4E33A 3NH4A 2QR1B 2B63I 5T64A 1QVGZ 2OTJZ 3GTMS 1M902 1VQ61 3H3VJ 2PK7A 4MD8A 3HKZA 3VTNA 5C3EI 3CPWY 1QVGY 1K8A2 2PM9A 2AYDA 4RVFA 2RIQA 3GTOI 1K732 3G4SZ 4A3FI 2QA4Z 1YJ91 5IP7I 2R6MA 1Z03A 3FQQA 1RLYA 3HOVI 3PO2I 3CC41 1AA6A 4NB9A 4A3II 4NBAA 4RS4A 3QWUA 1LQLA 4NB8A 1TWGI 1YIJZ 2JIMA 3JAMb 1USPA 2JIOA 3F3FC 1VQNZ 3LUSA 3CME1 4MH4A 4E2YA 3PO3S 1L1OC 4S1TA 1S721 1KC82 2W04A 4NBCA 3CCQZ 3CC2Z 3NFZA 3CD61 3NH8A 1M1K2 1USPB 4A3DI 5FLXf 2R93I 3I4NI 1QYPA 1VQL1 3CCL1 5IP9I 4DQYB 1I3QI 1VQOZ 3D6WA 1YJW1 1K731 1YI2Z 4TNUA 4NOZA 1VQ8Z 2RT9A 3CCSZ 4BY1I 3S15I 1KD12 1KC81 3GTMI 4NBGA 1VQPZ 1M901 2OTL1 2E2II 1Z02A 3I551 3CCM1 4HH4A 2ZAEB 2E2JI 3J80b 1Y1VI 3RZDI 4RVHA 5D1PA 3JAMf 3MONA 4QTUA 1W2BZ 2NVQI 1VQ5Z 1ZH1A 4RV9A 3K7AI 5FLMI 1TWHI 3NH5A 5C4JI 2IZ4A 2LEXA 2JIPA 3GCFA 1WW9A 4E32A 1NUIA 2KPIA 2P28A 3U50C 1K9M2 1WJ2A 5A2Qf 5CM2M 2E9HA 4A3KI 1VQ9Z 1VQKZ 2KI7B 3HOZI 3D9XA 2QEXZ 3M3YI 2V8KA 3GTGI 3S16I 1Q821 3GTQI 2GTHA 1KQSY 1VLAA 2QRCB 2NVYI 1Y1WI 1VQM1 1TFIA 5IT9b 3MZKB 1YJWZ 5C4XI 2YU9I 2E7ZA 2HU9A 2VUMI 2QKDA 1R9TI 4NBFA 3CCS1 1TWAI 1NJI2 2IZ3A 1K8A1 4RVGA 1K9M1 3BG1B 4RVDA 1JJ2Z 1KRLA 1X0TA 2R92I 1VQ71 4E2WA 4HGZA 3G6E1 5T6BA 2K3RA 2DE6A 2GTIA 2LIYA 2RHBA 2V3VA 2Y0SA 3S2DI 2VF1A 3GTPI 3I07A 1RO2A 1ZB9A 3GTKI 3MZLB 2Q4ZA 4EWCA 2IV2X 3VMGA 4A3MI 1M1K1 1Y1VS 4MD9A 3HOUI 3TDHB 2QA41 4E30A 3HOWI 3J81f 1RNIA 3BG0B 1RO4A 4DGLA 2VPWA 3CCJZ 2K5RA 3RZOI 4QTTA 2P3YA 2QLVB 1VQMZ 1NJI1 1NP6A 2JA8I 3HOYI 2VUGA 3G4S1 3TE5B 1VQP1 1YHQZ 1YIT1 3IX0A 2H85A 2DE7A 1WIIA 2OOYB 1VQO1 2PMZA 3CC7Z 3CC21 1VQ91 2JA7I 1X3WA 3CCR1 3FQMA 3FKII 3VB9A 2V8JA 1VQLZ 4A3BI 4BY7I 4A3JI 3IR7A 2JMOA 1K83I 1S7MA 1YUKA 2W03A 3P5JB 4BBSI 4NBBA 2O53A 2VPXA 3CC71 3KIHA 4MRIA 3S1RI 2VPYA 1Q7Y2 4NFRA 2F4OA 3CCU1 2NAPA 1YJN1 2VPZA 4A3EI 4E2XA 1Y8CA 3CCJ1 2OZKA 1VQK1 1I50I 1YI21 3M4OI 1QXFA 4AYBA 3I4MI 1Q862 1FDIA 3S17I 4NBDA 2JA5I 5LL6f 2JS4A 1Z01A 4MONA 1VQ7Z 2NVXI 3VMHA 3CCUZ 4NH1C 5IT9f 2OOXB 1YJNZ 2JUBA 3J7A4 5AN9F 1I6HI 3T4NB 2Q51A 3CCQ1 3CD6Z 1QVFZ 1ML8A 2F4MA 3NDJA 3S14I 3CMEZ 3CCEZ 1TWCI 1RQFA 1YJ9Z 1VQ6Z 3CCVZ 2I3CA 1SIWA 4NBHA 4E2ZA 1Q811 1Q812 1N2FA 5A2Qb 2RPRA 3ESWA 2V45A 2R7ZI 2JNYA 2EGTA 5C44I 4A3CI 3PO3I 3OW2Z 1YIJ1 3CMAZ 1Q7Y1 1PFTA 3GTJI 4DK1A 1YUAA 3CPWZ 3IF8A 1YHQ1 1YITZ 3I56Z 3D2LA 1TWFI 3J81b 2OTJ1 3CCRZ 3CMA1 1WCMI 2OTLZ 2RBLA 1KD11 4CL1A 5D1OB 3I55Z 3S1QI 1DL6A 1KQSZ 1P9NA 3CQZI 3KIFA 2GU2A 5T67A 1ZB8A 4E31A 2QREB 2WB1A 2YADA 2NVTI 3CCLZ 4NBEA 2V8IA 5FLXb 3GTLI 1Q16A 3H0GI 3GKQA 2JIQA 3NDIA 3CCMZ 3EEDA 3VMIA 2LFUA 1FDOA 2JA6I 1VQ81 4MD7A 2E2HI 2WAQA 1JJ2Y 2M6NA 1S72Z 3HOXI
chains in the Genus database with same CATH topology
4A93I 1N8R1 3S2HI 2DE5A 3S1MI 1N8R2 3G6EZ 1Q861 2AKLA 4XX2A 4A3GI 2G2KA 3CC4Z 1QF8A 3CCE1 1SFOI 5D1OA 3OW2Y 1JWHC 3CCV1 4Y52I 3CXCY 3S1NI 2BJOA 3F3PC 2O4HA 3G71Z 4MXUA 1VQ41 3CXCZ 2QEX1 1W2BY 1VQN1 2J6AA 3Q87A 4A3LI 1VQ51 1QVFY 4Y7NI 1X3ZA 4BBRI 2JR6A 3EERA 2QRDB 1Q822 3I561 1RO0A 4HGYA 4BXXI 4X6AI 3J80f 3IFUA 2M48A 2HF1A 3G711 1VQ4Z 4E33A 3NH4A 2QR1B 2B63I 5T64A 1QVGZ 2OTJZ 3GTMS 1M902 1VQ61 3H3VJ 2PK7A 4MD8A 3HKZA 3VTNA 5C3EI 3CPWY 1QVGY 1K8A2 2PM9A 4RVFA 2RIQA 3GTOI 1K732 3G4SZ 4A3FI 2QA4Z 1YJ91 5IP7I 2R6MA 1Z03A 3FQQA 1RLYA 3HOVI 3PO2I 3CC41 4NB9A 4A3II 4NBAA 4RS4A 3QWUA 1LQLA 4NB8A 1TWGI 1YIJZ 3JAMb 1USPA 3F3FC 1VQNZ 3LUSA 3CME1 4MH4A 4E2YA 3PO3S 1L1OC 4S1TA 1S721 1KC82 2W04A 4NBCA 3CCQZ 3CC2Z 3NFZA 3CD61 3NH8A 1M1K2 1USPB 4A3DI 5FLXf 2R93I 3I4NI 1QYPA 1VQL1 3CCL1 5IP9I 4DQYB 1I3QI 1VQOZ 3D6WA 1YJW1 1K731 1YI2Z 4TNUA 4NOZA 1VQ8Z 2RT9A 3CCSZ 4BY1I 3S15I 1KD12 1KC81 3GTMI 4NBGA 1VQPZ 1M901 2OTL1 2E2II 1Z02A 3I551 3CCM1 4HH4A 2ZAEB 2E2JI 3J80b 1Y1VI 3RZDI 4RVHA 5D1PA 3JAMf 3MONA 4QTUA 1W2BZ 2NVQI 1VQ5Z 1ZH1A 4RV9A 3K7AI 5FLMI 1TWHI 3NH5A 5C4JI 2IZ4A 3GCFA 1WW9A 4E32A 1NUIA 2KPIA 2P28A 3U50C 1K9M2 5A2Qf 5CM2M 2E9HA 4A3KI 1VQ9Z 1VQKZ 2KI7B 3HOZI 3D9XA 2QEXZ 3M3YI 2V8KA 3GTGI 3S16I 1Q821 3GTQI 2GTHA 1KQSY 1VLAA 2QRCB 2NVYI 1Y1WI 1VQM1 1TFIA 5IT9b 3MZKB 1YJWZ 5C4XI 2YU9I 2HU9A 2VUMI 2QKDA 1R9TI 4NBFA 3CCS1 1TWAI 1NJI2 2IZ3A 1K8A1 4RVGA 1K9M1 3BG1B 4RVDA 1JJ2Z 1KRLA 1X0TA 2R92I 1VQ71 4E2WA 4HGZA 3G6E1 5T6BA 2K3RA 2DE6A 2GTIA 2LIYA 2RHBA 2Y0SA 3S2DI 2VF1A 3GTPI 3I07A 1RO2A 1ZB9A 3GTKI 3MZLB 2Q4ZA 4EWCA 3VMGA 4A3MI 1M1K1 1Y1VS 4MD9A 3HOUI 3TDHB 2QA41 4E30A 3HOWI 3J81f 1RNIA 3BG0B 1RO4A 4DGLA 3CCJZ 2K5RA 3RZOI 4QTTA 2P3YA 2QLVB 1VQMZ 1NJI1 1NP6A 2JA8I 3HOYI 2VUGA 3G4S1 3TE5B 1VQP1 1YHQZ 1YIT1 3IX0A 2H85A 2DE7A 1WIIA 2OOYB 1VQO1 2PMZA 3CC7Z 3CC21 1VQ91 2JA7I 1X3WA 3CCR1 3FQMA 3FKII 3VB9A 2V8JA 1VQLZ 4A3BI 4BY7I 4A3JI 2JMOA 1K83I 1S7MA 1YUKA 2W03A 3P5JB 4BBSI 4NBBA 2O53A 3KIHA 3CC71 4MRIA 3S1RI 1Q7Y2 4NFRA 2F4OA 3CCU1 1YJN1 4A3EI 4E2XA 3CCJ1 2OZKA 1VQK1 1I50I 1YI21 3M4OI 4AYBA 3I4MI 1Q862 3S17I 4NBDA 2JA5I 5LL6f 2JS4A 1Z01A 4MONA 1VQ7Z 2NVXI 3VMHA 3CCUZ 4NH1C 5IT9f 2OOXB 1YJNZ 2JUBA 3J7A4 5AN9F 1I6HI 3T4NB 2Q51A 3CCQ1 3CD6Z 1QVFZ 1ML8A 2F4MA 3NDJA 3S14I 3CMEZ 3CCEZ 1TWCI 1RQFA 1YJ9Z 1VQ6Z 3CCVZ 2I3CA 1Q811 4NBHA 4E2ZA 1Q812 1N2FA 5A2Qb 2RPRA 3ESWA 2R7ZI 2JNYA 2EGTA 5C44I 4A3CI 3PO3I 3OW2Z 1YIJ1 3CMAZ 1Q7Y1 1PFTA 3GTJI 4DK1A 1YUAA 3CPWZ 3IF8A 1YHQ1 1YITZ 3I56Z 1TWFI 3J81b 2OTJ1 3CCRZ 3CMA1 1WCMI 2OTLZ 2RBLA 1KD11 4CL1A 5D1OB 3I55Z 3S1QI 1DL6A 1KQSZ 1P9NA 3CQZI 3KIFA 2GU2A 5T67A 1ZB8A 4E31A 2QREB 2WB1A 2YADA 2NVTI 3CCLZ 4NBEA 2V8IA 5FLXb 3GTLI 3H0GI 3GKQA 3NDIA 3CCMZ 3EEDA 3VMIA 2LFUA 2JA6I 1VQ81 4MD7A 2E2HI 2WAQA 1JJ2Y 2M6NA 1S72Z 3HOXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A93 I;  3S17 I;  4NBC A;  3S2H I;  2DE5 A;  3S1M I;  4NBD A;  2JA5 I;  2JS4 A;  1USP B;  2NVX I;  3VMH A;  3S2D I;  3GTP I;  4A3D I;  3I07 A;  1ZB9 A;  2R93 I;  3GTK I;  3I4N I;  2AKL A;  1QYP A;  1I6H I;  3VMG A;  4A3M I;  1Y1V S;  4XX2 A;  5IP9 I;  4A3G I;  1I3Q I;  1ML8 A;  2F4M A;  1SFO I;  3D6W A;  3S14 I;  3HOU I;  4Y52 I;  1TWC I;  3S1N I;  2BJO A;  3HOW I;  4NBH A;  4NOZ A;  4BY1 I;  1RO4 A;  3S15 I;  1N2F A;  2J6A A;  3Q87 A;  3ESW A;  3GTM I;  4NBG A;  2R7Z I;  4A3L I;  2JNY A;  2K5R A;  4Y7N I;  5C44 I;  3RZO I;  4A3C I;  2E2I I;  3PO3 I;  1X3Z A;  4QTT A;  2P3Y A;  4BBR I;  2E2J I;  1PFT A;  1Y1V I;  3GTJ I;  3RZD I;  2JR6 A;  3EER A;  2JA8 I;  3HOY I;  4QTU A;  1YUA A;  2NVQ I;  4X6A I;  4BXX I;  3K7A I;  5FLM I;  2HF1 A;  1TWH I;  5C4J I;  2DE7 A;  3GCF A;  2B63 I;  1TWF I;  1WW9 A;  1NUI A;  2KPI A;  3U50 C;  3GTM S;  3H3V J;  2JA7 I;  2PK7 A;  5CM2 M;  4A3K I;  1X3W A;  1WCM I;  5C3E I;  2RBL A;  3FKI I;  3VB9 A;  3HOZ I;  4A3B I;  4BY7 I;  3S1Q I;  1DL6 A;  4A3J I;  3GTO I;  3M3Y I;  3GTG I;  3CQZ I;  3S16 I;  3GTQ I;  4A3F I;  1ZB8 A;  1K83 I;  5IP7 I;  1VLA A;  1RLY A;  2NVY I;  3HOV I;  3PO2 I;  1Y1W I;  4BBS I;  4NBB A;  2NVT I;  1TFI A;  4NBE A;  3S1R I;  5C4X I;  4NB9 A;  4A3I I;  3GTL I;  2YU9 I;  4NBA A;  2F4O A;  3H0G I;  3GKQ A;  1LQL A;  4NB8 A;  1TWG I;  2VUM I;  3VMI A;  1R9T I;  1USP A;  4NBF A;  1TWA I;  4A3E I;  2JA6 I;  3LUS A;  2R92 I;  4MH4 A;  2E2H I;  3PO3 S;  1L1O C;  1I50 I;  3M4O I;  3I4M I;  2DE6 A;  3HOX I; 
#chains in the Genus database with same CATH topology
 4A93 I;  1N8R 1;  3S2H I;  2DE5 A;  3S1M I;  1N8R 2;  3G6E Z;  1Q86 1;  1WZN A;  2AKL A;  4XX2 A;  4A3G I;  2G2K A;  3CC4 Z;  1QF8 A;  3CCE 1;  1SFO I;  5D1O A;  3OW2 Y;  1JWH C;  3CCV 1;  4Y52 I;  3CXC Y;  3S1N I;  2BJO A;  3F3P C;  2O4H A;  3G71 Z;  4MXU A;  1VQ4 1;  3CXC Z;  2QEX 1;  1W2B Y;  1VQN 1;  2J6A A;  3Q87 A;  2JIR A;  4A3L I;  1VQ5 1;  1QVF Y;  4Y7N I;  1X3Z A;  4BBR I;  2JR6 A;  3EER A;  2QRD B;  1Q82 2;  3I56 1;  1RO0 A;  4HGY A;  4BXX I;  4X6A I;  3J80 f;  3IFU A;  2M48 A;  2HF1 A;  3G71 1;  1VQ4 Z;  4E33 A;  3NH4 A;  2QR1 B;  2B63 I;  5T64 A;  1QVG Z;  2OTJ Z;  3GTM S;  1M90 2;  1VQ6 1;  3H3V J;  2PK7 A;  4MD8 A;  3HKZ A;  3VTN A;  5C3E I;  3CPW Y;  1QVG Y;  1K8A 2;  2PM9 A;  2AYD A;  4RVF A;  2RIQ A;  3GTO I;  1K73 2;  3G4S Z;  4A3F I;  2QA4 Z;  1YJ9 1;  5IP7 I;  2R6M A;  1Z03 A;  3FQQ A;  1RLY A;  3HOV I;  3PO2 I;  3CC4 1;  1AA6 A;  4NB9 A;  4A3I I;  4NBA A;  4RS4 A;  3QWU A;  1LQL A;  4NB8 A;  1TWG I;  1YIJ Z;  2JIM A;  3JAM b;  1USP A;  2JIO A;  3F3F C;  1VQN Z;  3LUS A;  3CME 1;  4MH4 A;  4E2Y A;  3PO3 S;  1L1O C;  4S1T A;  1S72 1;  1KC8 2;  2W04 A;  4NBC A;  3CCQ Z;  3CC2 Z;  3NFZ A;  3CD6 1;  3NH8 A;  1M1K 2;  1USP B;  4A3D I;  5FLX f;  2R93 I;  3I4N I;  1QYP A;  1VQL 1;  3CCL 1;  5IP9 I;  4DQY B;  1I3Q I;  1VQO Z;  3D6W A;  1YJW 1;  1K73 1;  1YI2 Z;  4TNU A;  4NOZ A;  1VQ8 Z;  2RT9 A;  3CCS Z;  4BY1 I;  3S15 I;  1KD1 2;  1KC8 1;  3GTM I;  4NBG A;  1VQP Z;  1M90 1;  2OTL 1;  2E2I I;  1Z02 A;  3I55 1;  3CCM 1;  4HH4 A;  2ZAE B;  2E2J I;  3J80 b;  1Y1V I;  3RZD I;  4RVH A;  5D1P A;  3JAM f;  3MON A;  4QTU A;  1W2B Z;  2NVQ I;  1VQ5 Z;  1ZH1 A;  4RV9 A;  3K7A I;  5FLM I;  1TWH I;  3NH5 A;  5C4J I;  2IZ4 A;  2LEX A;  2JIP A;  3GCF A;  1WW9 A;  4E32 A;  1NUI A;  2KPI A;  2P28 A;  3U50 C;  1K9M 2;  1WJ2 A;  5A2Q f;  5CM2 M;  2E9H A;  4A3K I;  1VQ9 Z;  1VQK Z;  2KI7 B;  3HOZ I;  3D9X A;  2QEX Z;  3M3Y I;  2V8K A;  3GTG I;  3S16 I;  1Q82 1;  3GTQ I;  2GTH A;  1KQS Y;  1VLA A;  2QRC B;  2NVY I;  1Y1W I;  1VQM 1;  1TFI A;  5IT9 b;  3MZK B;  1YJW Z;  5C4X I;  2YU9 I;  2E7Z A;  2HU9 A;  2VUM I;  2QKD A;  1R9T I;  4NBF A;  3CCS 1;  1TWA I;  1NJI 2;  2IZ3 A;  1K8A 1;  4RVG A;  1K9M 1;  3BG1 B;  4RVD A;  1JJ2 Z;  1KRL A;  1X0T A;  2R92 I;  1VQ7 1;  4E2W A;  4HGZ A;  3G6E 1;  5T6B A;  2K3R A;  2DE6 A;  2GTI A;  2LIY A;  2RHB A;  2V3V A;  2Y0S A;  3S2D I;  2VF1 A;  3GTP I;  3I07 A;  1RO2 A;  1ZB9 A;  3GTK I;  3MZL B;  2Q4Z A;  4EWC A;  2IV2 X;  3VMG A;  4A3M I;  1M1K 1;  1Y1V S;  4MD9 A;  3HOU I;  3TDH B;  2QA4 1;  4E30 A;  3HOW I;  3J81 f;  1RNI A;  3BG0 B;  1RO4 A;  4DGL A;  2VPW A;  3CCJ Z;  2K5R A;  3RZO I;  4QTT A;  2P3Y A;  2QLV B;  1VQM Z;  1NJI 1;  1NP6 A;  2JA8 I;  3HOY I;  2VUG A;  3G4S 1;  3TE5 B;  1VQP 1;  1YHQ Z;  1YIT 1;  3IX0 A;  2H85 A;  2DE7 A;  1WII A;  2OOY B;  1VQO 1;  2PMZ A;  3CC7 Z;  3CC2 1;  1VQ9 1;  2JA7 I;  1X3W A;  3CCR 1;  3FQM A;  3FKI I;  3VB9 A;  2V8J A;  1VQL Z;  4A3B I;  4BY7 I;  4A3J I;  3IR7 A;  2JMO A;  1K83 I;  1S7M A;  1YUK A;  2W03 A;  3P5J B;  4BBS I;  4NBB A;  2O53 A;  2VPX A;  3CC7 1;  3KIH A;  4MRI A;  3S1R I;  2VPY A;  1Q7Y 2;  4NFR A;  2F4O A;  3CCU 1;  2NAP A;  1YJN 1;  2VPZ A;  4A3E I;  4E2X A;  1Y8C A;  3CCJ 1;  2OZK A;  1VQK 1;  1I50 I;  1YI2 1;  3M4O I;  1QXF A;  4AYB A;  3I4M I;  1Q86 2;  1FDI A;  3S17 I;  4NBD A;  2JA5 I;  5LL6 f;  2JS4 A;  1Z01 A;  4MON A;  1VQ7 Z;  2NVX I;  3VMH A;  3CCU Z;  4NH1 C;  5IT9 f;  2OOX B;  1YJN Z;  2JUB A;  3J7A 4;  5AN9 F;  1I6H I;  3T4N B;  2Q51 A;  3CCQ 1;  3CD6 Z;  1QVF Z;  1ML8 A;  2F4M A;  3NDJ A;  3S14 I;  3CME Z;  3CCE Z;  1TWC I;  1RQF A;  1YJ9 Z;  1VQ6 Z;  3CCV Z;  2I3C A;  1SIW A;  4NBH A;  4E2Z A;  1Q81 1;  1Q81 2;  1N2F A;  5A2Q b;  2RPR A;  3ESW A;  2V45 A;  2R7Z I;  2JNY A;  2EGT A;  5C44 I;  4A3C I;  3PO3 I;  3OW2 Z;  1YIJ 1;  3CMA Z;  1Q7Y 1;  1PFT A;  3GTJ I;  4DK1 A;  1YUA A;  3CPW Z;  3IF8 A;  1YHQ 1;  1YIT Z;  3I56 Z;  3D2L A;  1TWF I;  3J81 b;  2OTJ 1;  3CCR Z;  3CMA 1;  1WCM I;  2OTL Z;  2RBL A;  1KD1 1;  4CL1 A;  5D1O B;  3I55 Z;  3S1Q I;  1DL6 A;  1KQS Z;  1P9N A;  3CQZ I;  3KIF A;  2GU2 A;  5T67 A;  1ZB8 A;  4E31 A;  2QRE B;  2WB1 A;  2YAD A;  2NVT I;  3CCL Z;  4NBE A;  2V8I A;  5FLX b;  3GTL I;  1Q16 A;  3H0G I;  3GKQ A;  2JIQ A;  3NDI A;  3CCM Z;  3EED A;  3VMI A;  2LFU A;  1FDO A;  2JA6 I;  1VQ8 1;  4MD7 A;  2E2H I;  2WAQ A;  1JJ2 Y;  2M6N A;  1S72 Z;  3HOX I; 
#chains in the Genus database with same CATH homology
 4A93 I;  1N8R 1;  3S2H I;  2DE5 A;  3S1M I;  1N8R 2;  3G6E Z;  1Q86 1;  2AKL A;  4XX2 A;  4A3G I;  2G2K A;  3CC4 Z;  1QF8 A;  3CCE 1;  1SFO I;  5D1O A;  3OW2 Y;  1JWH C;  3CCV 1;  4Y52 I;  3CXC Y;  3S1N I;  2BJO A;  3F3P C;  2O4H A;  3G71 Z;  4MXU A;  1VQ4 1;  3CXC Z;  2QEX 1;  1W2B Y;  1VQN 1;  2J6A A;  3Q87 A;  4A3L I;  1VQ5 1;  1QVF Y;  4Y7N I;  1X3Z A;  4BBR I;  2JR6 A;  3EER A;  2QRD B;  1Q82 2;  3I56 1;  1RO0 A;  4HGY A;  4BXX I;  4X6A I;  3J80 f;  3IFU A;  2M48 A;  2HF1 A;  3G71 1;  1VQ4 Z;  4E33 A;  3NH4 A;  2QR1 B;  2B63 I;  5T64 A;  1QVG Z;  2OTJ Z;  3GTM S;  1M90 2;  1VQ6 1;  3H3V J;  2PK7 A;  4MD8 A;  3HKZ A;  3VTN A;  5C3E I;  3CPW Y;  1QVG Y;  1K8A 2;  2PM9 A;  4RVF A;  2RIQ A;  3GTO I;  1K73 2;  3G4S Z;  4A3F I;  2QA4 Z;  1YJ9 1;  5IP7 I;  2R6M A;  1Z03 A;  3FQQ A;  1RLY A;  3HOV I;  3PO2 I;  3CC4 1;  4NB9 A;  4A3I I;  4NBA A;  4RS4 A;  3QWU A;  1LQL A;  4NB8 A;  1TWG I;  1YIJ Z;  3JAM b;  1USP A;  3F3F C;  1VQN Z;  3LUS A;  3CME 1;  4MH4 A;  4E2Y A;  3PO3 S;  1L1O C;  4S1T A;  1S72 1;  1KC8 2;  2W04 A;  4NBC A;  3CCQ Z;  3CC2 Z;  3NFZ A;  3CD6 1;  3NH8 A;  1M1K 2;  1USP B;  4A3D I;  5FLX f;  2R93 I;  3I4N I;  1QYP A;  1VQL 1;  3CCL 1;  5IP9 I;  4DQY B;  1I3Q I;  1VQO Z;  3D6W A;  1YJW 1;  1K73 1;  1YI2 Z;  4TNU A;  4NOZ A;  1VQ8 Z;  2RT9 A;  3CCS Z;  4BY1 I;  3S15 I;  1KD1 2;  1KC8 1;  3GTM I;  4NBG A;  1VQP Z;  1M90 1;  2OTL 1;  2E2I I;  1Z02 A;  3I55 1;  3CCM 1;  4HH4 A;  2ZAE B;  2E2J I;  3J80 b;  1Y1V I;  3RZD I;  4RVH A;  5D1P A;  3JAM f;  3MON A;  4QTU A;  1W2B Z;  2NVQ I;  1VQ5 Z;  1ZH1 A;  4RV9 A;  3K7A I;  5FLM I;  1TWH I;  3NH5 A;  5C4J I;  2IZ4 A;  3GCF A;  1WW9 A;  4E32 A;  1NUI A;  2KPI A;  2P28 A;  3U50 C;  1K9M 2;  5A2Q f;  5CM2 M;  2E9H A;  4A3K I;  1VQ9 Z;  1VQK Z;  2KI7 B;  3HOZ I;  3D9X A;  2QEX Z;  3M3Y I;  2V8K A;  3GTG I;  3S16 I;  1Q82 1;  3GTQ I;  2GTH A;  1KQS Y;  1VLA A;  2QRC B;  2NVY I;  1Y1W I;  1VQM 1;  1TFI A;  5IT9 b;  3MZK B;  1YJW Z;  5C4X I;  2YU9 I;  2HU9 A;  2VUM I;  2QKD A;  1R9T I;  4NBF A;  3CCS 1;  1TWA I;  1NJI 2;  2IZ3 A;  1K8A 1;  4RVG A;  1K9M 1;  3BG1 B;  4RVD A;  1JJ2 Z;  1KRL A;  1X0T A;  2R92 I;  1VQ7 1;  4E2W A;  4HGZ A;  3G6E 1;  5T6B A;  2K3R A;  2DE6 A;  2GTI A;  2LIY A;  2RHB A;  2Y0S A;  3S2D I;  2VF1 A;  3GTP I;  3I07 A;  1RO2 A;  1ZB9 A;  3GTK I;  3MZL B;  2Q4Z A;  4EWC A;  3VMG A;  4A3M I;  1M1K 1;  1Y1V S;  4MD9 A;  3HOU I;  3TDH B;  2QA4 1;  4E30 A;  3HOW I;  3J81 f;  1RNI A;  3BG0 B;  1RO4 A;  4DGL A;  3CCJ Z;  2K5R A;  3RZO I;  4QTT A;  2P3Y A;  2QLV B;  1VQM Z;  1NJI 1;  1NP6 A;  2JA8 I;  3HOY I;  2VUG A;  3G4S 1;  3TE5 B;  1VQP 1;  1YHQ Z;  1YIT 1;  3IX0 A;  2H85 A;  2DE7 A;  1WII A;  2OOY B;  1VQO 1;  2PMZ A;  3CC7 Z;  3CC2 1;  1VQ9 1;  2JA7 I;  1X3W A;  3CCR 1;  3FQM A;  3FKI I;  3VB9 A;  2V8J A;  1VQL Z;  4A3B I;  4BY7 I;  4A3J I;  2JMO A;  1K83 I;  1S7M A;  1YUK A;  2W03 A;  3P5J B;  4BBS I;  4NBB A;  2O53 A;  3KIH A;  3CC7 1;  4MRI A;  3S1R I;  1Q7Y 2;  4NFR A;  2F4O A;  3CCU 1;  1YJN 1;  4A3E I;  4E2X A;  3CCJ 1;  2OZK A;  1VQK 1;  1I50 I;  1YI2 1;  3M4O I;  4AYB A;  3I4M I;  1Q86 2;  3S17 I;  4NBD A;  2JA5 I;  5LL6 f;  2JS4 A;  1Z01 A;  4MON A;  1VQ7 Z;  2NVX I;  3VMH A;  3CCU Z;  4NH1 C;  5IT9 f;  2OOX B;  1YJN Z;  2JUB A;  3J7A 4;  5AN9 F;  1I6H I;  3T4N B;  2Q51 A;  3CCQ 1;  3CD6 Z;  1QVF Z;  1ML8 A;  2F4M A;  3NDJ A;  3S14 I;  3CME Z;  3CCE Z;  1TWC I;  1RQF A;  1YJ9 Z;  1VQ6 Z;  3CCV Z;  2I3C A;  1Q81 1;  4NBH A;  4E2Z A;  1Q81 2;  1N2F A;  5A2Q b;  2RPR A;  3ESW A;  2R7Z I;  2JNY A;  2EGT A;  5C44 I;  4A3C I;  3PO3 I;  3OW2 Z;  1YIJ 1;  3CMA Z;  1Q7Y 1;  1PFT A;  3GTJ I;  4DK1 A;  1YUA A;  3CPW Z;  3IF8 A;  1YHQ 1;  1YIT Z;  3I56 Z;  1TWF I;  3J81 b;  2OTJ 1;  3CCR Z;  3CMA 1;  1WCM I;  2OTL Z;  2RBL A;  1KD1 1;  4CL1 A;  5D1O B;  3I55 Z;  3S1Q I;  1DL6 A;  1KQS Z;  1P9N A;  3CQZ I;  3KIF A;  2GU2 A;  5T67 A;  1ZB8 A;  4E31 A;  2QRE B;  2WB1 A;  2YAD A;  2NVT I;  3CCL Z;  4NBE A;  2V8I A;  5FLX b;  3GTL I;  3H0G I;  3GKQ A;  3NDI A;  3CCM Z;  3EED A;  3VMI A;  2LFU A;  2JA6 I;  1VQ8 1;  4MD7 A;  2E2H I;  2WAQ A;  1JJ2 Y;  2M6N A;  1S72 Z;  3HOX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...