1NUIA

Crystal structure of the primase fragment of bacteriophage t7 primase-helicase protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
246
structure length
242
Chain Sequence
VFLYHIPCDNCGSSDGNSLFSDGHTFCYVCEKWTATKERASKRKPSGGKPGTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modular Architecture of the Bacteriophage T7 Primase Couples RNA primer Synthesis to DNA Synthesis
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Replication
molecule keywords DNA primase/helicase
total genus 62
structure length 242
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08273 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nuiA01
3FKII 5CM2M 3GTMS 4XX2A 3GTKI 4A93I 3GCFA 1TWGI 2YU9I 3PO3S 1X3ZA 1TFIA 1WCMI 3ESWA 4NBHA 5C44I 3HOXI 4QTTA 2B63I 4Y52I 3VMHA 2DE6A 3GKQA 3S1NI 4BBRI 3S2HI 3HOWI 3CQZI 1DL6A 1ZB9A 1R9TI 3HOVI 3HOUI 1I50I 2JA8I 4BY7I 2E2JI 2NVYI 1USPB 3HOYI 1ML8A 2R93I 1I6HI 4A3CI 3M3YI 4NB8A 1K83I 2RBLA 4Y7NI 2E2HI 5C3EI 2NVQI 2R7ZI 2DE5A 3S1MI 1RLYA 4A3EI 1Y1WI 1USPA 3S1RI 3S15I 4QTUA 1RO4A 2R92I 3H3VJ 4BBSI 4A3II 1SFOI 3K7AI 3HOZI 4A3BI 5C4JI 2PK7A 1VLAA 2KPIA 3VMIA 2J6AA 2JA5I 2BJOA 3S14I 4NB9A 3RZDI 3S2DI 2P3YA 3M4OI 3GTJI 4A3MI 1TWCI 3VB9A 3I4MI 1I3QI 2E2II 5IP7I 5FLMI 3U50C 3PO3I 1WW9A 3I4NI 3Q87A 4NBFA 4NBCA 1YUAA 3S17I 2JA6I 3PO2I 2NVTI 1ZB8A 4A3KI 1LQLA 4NBEA 3D6WA 4NBGA 3LUSA 2NVXI 3S16I 4A3GI 4NBAA 1N2FA 3GTGI 2K5RA 1L1OC 3S1QI 2JR6A 1X3WA 3RZOI 5C4XI 4NOZA 1TWFI 3I07A 2VUMI 1Y1VS 4A3DI 2JNYA 1NUIA 3GTLI 4MH4A 4A3LI 4BY1I 2F4MA 1QYPA 3H0GI 2AKLA 3GTQI 1Y1VI 1PFTA 1TWAI 4A3JI 4NBDA 2HF1A 4BXXI 3EERA 4NBBA 3GTOI 4A3FI 3GTMI 4X6AI 1TWHI 2JA7I 2F4OA 5IP9I 3GTPI 2JS4A 2DE7A 3VMGA
chains in the Genus database with same CATH superfamily
3CD61 2OOYB 4XX2A 2RHBA 4A93I 2JIMA 5LL6f 3PO3S 1YJN1 1WCMI 3MZLB 5C44I 2V3VA 4E30A 1S721 2QRCB 3CCEZ 2LEXA 3D2LA 2DE6A 3GKQA 2G2KA 3CCLZ 3CQZI 4E31A 2JUBA 1USPB 1YI21 3CCE1 2R93I 3CCMZ 1S72Z 1KC82 2VPZA 2W03A 1KQSZ 3M3YI 5AN9F 2GU2A 2RBLA 1Q811 3S1MI 1WIIA 3CC41 1YJ9Z 1VQK1 1Y1WI 3CMA1 4QTUA 1RO4A 3CD6Z 3H3VJ 3K7AI 1VQ5Z 5C4JI 1VLAA 2JA5I 3IF8A 1RQFA 2BJOA 3RZDI 1Z03A 4DQYB 2JIRA 2P3YA 1YIT1 3OW2Z 3CC7Z 1I3QI 3CMEZ 3CCRZ 3J7A4 3Q87A 1VQ51 4NBCA 1Q16A 2OTJ1 1YHQZ 4A3KI 4EWCA 1LQLA 1YJ91 2NVXI 2PM9A 3G4S1 3GTGI 2K5RA 3CC2Z 3S1QI 2R6MA 1M901 3CCM1 2QEXZ 3JAMf 5C4XI 3I07A 2VUMI 2QA41 2YADA 2QRDB 1NUIA 1Q861 4A3LI 3CCVZ 1Y1VI 2P28A 3T4NB 3G6EZ 2QA4Z 1W2BZ 4TNUA 4HGZA 1VQ4Z 4MRIA 2QEX1 2LFUA 2JA7I 3GTPI 1JJ2Y 2JS4A 2VPXA 1Q7Y1 5D1PA 1TWGI 1K8A1 2VPWA 3TDHB 1QVFY 1FDOA 3ESWA 4NBHA 3FQMA 4QTTA 2M6NA 1YJW1 1M1K2 3F3FC 3S2HI 1ZB9A 4RVGA 3EEDA 2NVYI 3NH5A 1ML8A 1I6HI 3TE5B 4S1TA 3CCQ1 2IZ3A 2QKDA 2NVQI 2JIPA 2DE5A 1NJI2 1M902 3S1RI 3S15I 1RNIA 4A3II 1YI2Z 1KD11 1AA6A 2Y0SA 4RVHA 3S14I 1KD12 4MD7A 3CXCY 5FLXb 3M4OI 4CL1A 1Q7Y2 1W2BY 3J81b 5IP7I 4RVFA 2IZ4A 3J80b 4AYBA 3PO3I 1VQ7Z 3G71Z 2VUGA 1JWHC 1VQ6Z 1Z01A 3CCU1 3PO2I 2QR1B 4RS4A 2NVTI 1KRLA 1VQN1 3LUSA 3CCJ1 2EGTA 1YJNZ 5IT9b 3QWUA 1SIWA 4HH4A 1L1OC 1VQO1 4E2ZA 2OZKA 1QF8A 1NP6A 3I551 3CC71 2JNYA 4BY1I 2F4MA 1QYPA 3H0GI 1VQOZ 1YITZ 1PFTA 1TWAI 3CCJZ 2V8KA 4NBDA 2HF1A 1K732 1K9M2 5T67A 3EERA 4NBBA 1RO0A 3GTMI 4X6AI 1QVFZ 2F4OA 2JMOA 3CCSZ 2DE7A 3VMGA 2E2HI 3IX0A 3GTMS 3MONA 2E9HA 5D1OB 3GTKI 1VQKZ 3NH4A 3CC4Z 4DK1A 1X3ZA 2GTIA 3I561 2ZAEB 3HOXI 1VQNZ 1WZNA 2B63I 4Y52I 3VMHA 3CPWZ 1K731 1VQ71 4NH1C 4BBRI 3HOVI 1I50I 2JIOA 1YUKA 3CCL1 1VQP1 1K8A2 1P9NA 2QLVB 3IR7A 2LIYA 2K3RA 2HU9A 5A2Qb 4NB8A 1QVGZ 1S7MA 4A3EI 1USPA 2R92I 1SFOI 3JAMb 2PK7A 2KPIA 3D9XA 3J80f 1VQL1 3NDJA 3S2DI 2VF1A 3GTJI 3VB9A 1JJ2Z 3VTNA 3U50C 2VPYA 3I4NI 2WB1A 3MZKB 1VQLZ 1K9M1 2V8IA 3NH8A 5T6BA 2M48A 1ZB8A 2WAQA 2AYDA 4NBGA 1VQ41 1VQ8Z 3HKZA 1Z02A 3S16I 3CCUZ 1Y8CA 3KIHA 3G711 1NJI1 3CPWY 1X0TA 1YIJ1 4HGYA 1VQMZ 4E2XA 2V45A 3GTLI 2AKLA 3GTQI 2E7ZA 4MXUA 4A3JI 3I56Z 2O4HA 4BXXI 2H85A 1YIJZ 1YHQ1 4A3FI 1TWHI 3BG1B 2OTJZ 1N8R1 3FKII 5CM2M 1KC81 2Q51A 3GCFA 2NAPA 2RT9A 2YU9I 1TFIA 3CME1 1Q821 1VQ81 2GTHA 2I3CA 2W04A 1VQ91 3S1NI 3HOWI 1DL6A 2PMZA 1R9TI 3HOUI 3CCR1 2JA8I 4BY7I 3BG0B 2E2JI 1YJWZ 3HOYI 1Q862 2RIQA 3CMAZ 3OW2Y 1VQ9Z 2RPRA 4A3CI 5IT9f 2OTLZ 1K83I 4Y7NI 2R7ZI 5C3EI 4RV9A 4NFRA 1RLYA 1QXFA 4BBSI 1VQ61 3IFUA 4A3BI 3HOZI 2KI7B 3VMIA 2J6AA 2OOXB 4NB9A 3G6E1 1Q822 3CCV1 4A3MI 1TWCI 5T64A 5D1OA 1N8R2 1VQPZ 3I4MI 4DGLA 4MD8A 1VQM1 1WJ2A 2E2II 5FLMI 1WW9A 4E2WA 3KIFA 4E32A 4E2YA 2JIQA 4NBFA 4MD9A 3CCS1 1YUAA 3S17I 2JA6I 2Q4ZA 3CC21 1ZH1A 3G4SZ 4NBEA 3D6WA 3FQQA 1KQSY 3F3PC 2IV2X 4A3GI 1M1K1 2OTL1 4NBAA 3CCQZ 1N2FA 2JR6A 2V8JA 1X3WA 1Q812 3I55Z 1FDIA 3RZOI 4NOZA 1TWFI 2QREB 1Y1VS 4E33A 3NFZA 1QVGY 4A3DI 4MH4A 4MONA 3P5JB 5FLXf 5A2Qf 2O53A 3NDIA 4RVDA 3J81f 3CXCZ 3GTOI 5IP9I 1RO2A
chains in the Genus database with same CATH topology
3CD61 2OOYB 4XX2A 2RHBA 4A93I 5LL6f 3PO3S 1YJN1 1WCMI 3MZLB 5C44I 4E30A 1S721 2QRCB 3CCEZ 2DE6A 3GKQA 2G2KA 3CCLZ 3CQZI 4E31A 2JUBA 1USPB 1YI21 3CCE1 2R93I 3CCMZ 1S72Z 1KC82 2W03A 1KQSZ 3M3YI 5AN9F 2GU2A 1Q811 2RBLA 3S1MI 1WIIA 3CC41 1YJ9Z 1VQK1 1Y1WI 3CMA1 4QTUA 1RO4A 3CD6Z 3H3VJ 3K7AI 1VQ5Z 5C4JI 1VLAA 2JA5I 3IF8A 1RQFA 2BJOA 3RZDI 1Z03A 4DQYB 2P3YA 1YIT1 3OW2Z 3CC7Z 1I3QI 3CMEZ 3CCRZ 3J7A4 3Q87A 1VQ51 4NBCA 2OTJ1 1YHQZ 4A3KI 4EWCA 1LQLA 1YJ91 2NVXI 2PM9A 3G4S1 3GTGI 2K5RA 3CC2Z 3S1QI 2R6MA 1M901 3CCM1 2QEXZ 3JAMf 5C4XI 3I07A 2VUMI 2QA41 2YADA 2QRDB 1NUIA 1Q861 4A3LI 3CCVZ 1Y1VI 2P28A 3T4NB 3G6EZ 2QA4Z 1W2BZ 4TNUA 4HGZA 1VQ4Z 4MRIA 2QEX1 2LFUA 2JA7I 3GTPI 1JJ2Y 2JS4A 1Q7Y1 5D1PA 1TWGI 1K8A1 3TDHB 1QVFY 3ESWA 4NBHA 3FQMA 4QTTA 2M6NA 1YJW1 1M1K2 3F3FC 3S2HI 1ZB9A 4RVGA 3EEDA 2NVYI 3NH5A 1ML8A 1I6HI 3TE5B 4S1TA 3CCQ1 2IZ3A 2QKDA 2NVQI 2DE5A 1NJI2 1M902 3S1RI 3S15I 1RNIA 4A3II 1YI2Z 1KD11 2Y0SA 4RVHA 3S14I 1KD12 4MD7A 3CXCY 5FLXb 3M4OI 4CL1A 1Q7Y2 1W2BY 3J81b 5IP7I 4RVFA 2IZ4A 3J80b 4AYBA 3PO3I 1VQ7Z 3G71Z 2VUGA 1JWHC 1VQ6Z 1Z01A 3CCU1 3PO2I 2QR1B 4RS4A 2NVTI 1KRLA 1VQN1 3LUSA 3CCJ1 2EGTA 1YJNZ 5IT9b 3QWUA 4HH4A 1L1OC 1VQO1 4E2ZA 2OZKA 1QF8A 1NP6A 3I551 3CC71 2JNYA 4BY1I 2F4MA 1QYPA 3H0GI 1VQOZ 1YITZ 1PFTA 1TWAI 3CCJZ 2V8KA 4NBDA 2HF1A 1K732 1K9M2 5T67A 3EERA 4NBBA 1RO0A 3GTMI 4X6AI 1QVFZ 2F4OA 2JMOA 3CCSZ 2DE7A 3VMGA 2E2HI 3IX0A 3GTMS 3MONA 2E9HA 5D1OB 3GTKI 1VQKZ 3NH4A 3CC4Z 4DK1A 1X3ZA 2GTIA 3I561 2ZAEB 3HOXI 1VQNZ 2B63I 4Y52I 3VMHA 3CPWZ 1K731 1VQ71 4NH1C 4BBRI 3HOVI 1I50I 1YUKA 3CCL1 1VQP1 1K8A2 1P9NA 2QLVB 2LIYA 2K3RA 2HU9A 5A2Qb 4NB8A 1QVGZ 1S7MA 4A3EI 1USPA 2R92I 1SFOI 3JAMb 2PK7A 2KPIA 3D9XA 3J80f 1VQL1 3NDJA 3S2DI 2VF1A 3GTJI 3VB9A 1JJ2Z 3VTNA 3U50C 3I4NI 2WB1A 3MZKB 1VQLZ 1K9M1 2V8IA 3NH8A 5T6BA 2M48A 1ZB8A 2WAQA 4NBGA 1VQ41 1VQ8Z 3HKZA 1Z02A 3S16I 3CCUZ 3KIHA 3G711 1NJI1 3CPWY 1X0TA 1YIJ1 4HGYA 1VQMZ 4E2XA 3GTLI 2AKLA 3GTQI 4MXUA 4A3JI 3I56Z 2O4HA 4BXXI 2H85A 1YIJZ 1YHQ1 4A3FI 1TWHI 3BG1B 2OTJZ 1N8R1 3FKII 5CM2M 1KC81 2Q51A 3GCFA 2RT9A 2YU9I 1TFIA 3CME1 1Q821 1VQ81 2GTHA 2I3CA 2W04A 1VQ91 3S1NI 3HOWI 1DL6A 2PMZA 1R9TI 3HOUI 3CCR1 2JA8I 4BY7I 3BG0B 2E2JI 1YJWZ 3HOYI 1Q862 2RIQA 3CMAZ 3OW2Y 1VQ9Z 2RPRA 4A3CI 5IT9f 2OTLZ 1K83I 4Y7NI 2R7ZI 5C3EI 4RV9A 4NFRA 1RLYA 4BBSI 1VQ61 3IFUA 4A3BI 3HOZI 2KI7B 3VMIA 2J6AA 2OOXB 4NB9A 3G6E1 1Q822 3CCV1 4A3MI 1TWCI 5T64A 5D1OA 1N8R2 1VQPZ 3I4MI 4DGLA 4MD8A 1VQM1 2E2II 5FLMI 1WW9A 4E2WA 3KIFA 4E32A 4E2YA 4NBFA 4MD9A 3CCS1 1YUAA 3S17I 2JA6I 2Q4ZA 3CC21 1ZH1A 3G4SZ 4NBEA 3D6WA 3FQQA 1KQSY 3F3PC 4A3GI 1M1K1 2OTL1 4NBAA 3CCQZ 1N2FA 2JR6A 2V8JA 1X3WA 1Q812 3I55Z 3RZOI 4NOZA 1TWFI 2QREB 1Y1VS 4E33A 3NFZA 1QVGY 4A3DI 4MH4A 4MONA 3P5JB 5FLXf 5A2Qf 2O53A 3NDIA 4RVDA 3J81f 3CXCZ 3GTOI 5IP9I 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI I;  5CM2 M;  3GTM S;  4XX2 A;  3GTK I;  4A93 I;  3GCF A;  1TWG I;  2YU9 I;  3PO3 S;  1X3Z A;  1TFI A;  1WCM I;  3ESW A;  4NBH A;  5C44 I;  3HOX I;  4QTT A;  2B63 I;  4Y52 I;  3VMH A;  2DE6 A;  3GKQ A;  3S1N I;  4BBR I;  3S2H I;  3HOW I;  3CQZ I;  1DL6 A;  1ZB9 A;  1R9T I;  3HOV I;  3HOU I;  1I50 I;  2JA8 I;  4BY7 I;  2E2J I;  2NVY I;  1USP B;  3HOY I;  1ML8 A;  2R93 I;  1I6H I;  4A3C I;  3M3Y I;  4NB8 A;  1K83 I;  2RBL A;  4Y7N I;  2E2H I;  5C3E I;  2NVQ I;  2R7Z I;  2DE5 A;  3S1M I;  1RLY A;  4A3E I;  1Y1W I;  1USP A;  3S1R I;  3S15 I;  4QTU A;  1RO4 A;  2R92 I;  3H3V J;  4BBS I;  4A3I I;  1SFO I;  3K7A I;  3HOZ I;  4A3B I;  5C4J I;  2PK7 A;  1VLA A;  2KPI A;  3VMI A;  2J6A A;  2JA5 I;  2BJO A;  3S14 I;  4NB9 A;  3RZD I;  3S2D I;  2P3Y A;  3M4O I;  3GTJ I;  4A3M I;  1TWC I;  3VB9 A;  3I4M I;  1I3Q I;  2E2I I;  5IP7 I;  5FLM I;  3U50 C;  3PO3 I;  1WW9 A;  3I4N I;  3Q87 A;  4NBF A;  4NBC A;  1YUA A;  3S17 I;  2JA6 I;  3PO2 I;  2NVT I;  1ZB8 A;  4A3K I;  1LQL A;  4NBE A;  3D6W A;  4NBG A;  3LUS A;  2NVX I;  3S16 I;  4A3G I;  4NBA A;  1N2F A;  3GTG I;  2K5R A;  1L1O C;  3S1Q I;  2JR6 A;  1X3W A;  3RZO I;  5C4X I;  4NOZ A;  1TWF I;  3I07 A;  2VUM I;  1Y1V S;  4A3D I;  2JNY A;  1NUI A;  3GTL I;  4MH4 A;  4A3L I;  4BY1 I;  2F4M A;  1QYP A;  3H0G I;  2AKL A;  3GTQ I;  1Y1V I;  1PFT A;  1TWA I;  4A3J I;  4NBD A;  2HF1 A;  4BXX I;  3EER A;  4NBB A;  3GTO I;  4A3F I;  3GTM I;  4X6A I;  1TWH I;  2JA7 I;  2F4O A;  5IP9 I;  3GTP I;  2JS4 A;  2DE7 A;  3VMG A; 
#chains in the Genus database with same CATH topology
 3CD6 1;  2OOY B;  4XX2 A;  2RHB A;  4A93 I;  2JIM A;  5LL6 f;  3PO3 S;  1YJN 1;  1WCM I;  3MZL B;  5C44 I;  2V3V A;  4E30 A;  1S72 1;  2QRC B;  3CCE Z;  2LEX A;  3D2L A;  2DE6 A;  3GKQ A;  2G2K A;  3CCL Z;  3CQZ I;  4E31 A;  2JUB A;  1USP B;  1YI2 1;  3CCE 1;  2R93 I;  3CCM Z;  1S72 Z;  1KC8 2;  2VPZ A;  2W03 A;  1KQS Z;  3M3Y I;  5AN9 F;  2GU2 A;  2RBL A;  1Q81 1;  3S1M I;  1WII A;  3CC4 1;  1YJ9 Z;  1VQK 1;  1Y1W I;  3CMA 1;  4QTU A;  1RO4 A;  3CD6 Z;  3H3V J;  3K7A I;  1VQ5 Z;  5C4J I;  1VLA A;  2JA5 I;  3IF8 A;  1RQF A;  2BJO A;  3RZD I;  1Z03 A;  4DQY B;  2JIR A;  2P3Y A;  1YIT 1;  3OW2 Z;  3CC7 Z;  1I3Q I;  3CME Z;  3CCR Z;  3J7A 4;  3Q87 A;  1VQ5 1;  4NBC A;  1Q16 A;  2OTJ 1;  1YHQ Z;  4A3K I;  4EWC A;  1LQL A;  1YJ9 1;  2NVX I;  2PM9 A;  3G4S 1;  3GTG I;  2K5R A;  3CC2 Z;  3S1Q I;  2R6M A;  1M90 1;  3CCM 1;  2QEX Z;  3JAM f;  5C4X I;  3I07 A;  2VUM I;  2QA4 1;  2YAD A;  2QRD B;  1NUI A;  1Q86 1;  4A3L I;  3CCV Z;  1Y1V I;  2P28 A;  3T4N B;  3G6E Z;  2QA4 Z;  1W2B Z;  4TNU A;  4HGZ A;  1VQ4 Z;  4MRI A;  2QEX 1;  2LFU A;  2JA7 I;  3GTP I;  1JJ2 Y;  2JS4 A;  2VPX A;  1Q7Y 1;  5D1P A;  1TWG I;  1K8A 1;  2VPW A;  3TDH B;  1QVF Y;  1FDO A;  3ESW A;  4NBH A;  3FQM A;  4QTT A;  2M6N A;  1YJW 1;  1M1K 2;  3F3F C;  3S2H I;  1ZB9 A;  4RVG A;  3EED A;  2NVY I;  3NH5 A;  1ML8 A;  1I6H I;  3TE5 B;  4S1T A;  3CCQ 1;  2IZ3 A;  2QKD A;  2NVQ I;  2JIP A;  2DE5 A;  1NJI 2;  1M90 2;  3S1R I;  3S15 I;  1RNI A;  4A3I I;  1YI2 Z;  1KD1 1;  1AA6 A;  2Y0S A;  4RVH A;  3S14 I;  1KD1 2;  4MD7 A;  3CXC Y;  5FLX b;  3M4O I;  4CL1 A;  1Q7Y 2;  1W2B Y;  3J81 b;  5IP7 I;  4RVF A;  2IZ4 A;  3J80 b;  4AYB A;  3PO3 I;  1VQ7 Z;  3G71 Z;  2VUG A;  1JWH C;  1VQ6 Z;  1Z01 A;  3CCU 1;  3PO2 I;  2QR1 B;  4RS4 A;  2NVT I;  1KRL A;  1VQN 1;  3LUS A;  3CCJ 1;  2EGT A;  1YJN Z;  5IT9 b;  3QWU A;  1SIW A;  4HH4 A;  1L1O C;  1VQO 1;  4E2Z A;  2OZK A;  1QF8 A;  1NP6 A;  3I55 1;  3CC7 1;  2JNY A;  4BY1 I;  2F4M A;  1QYP A;  3H0G I;  1VQO Z;  1YIT Z;  1PFT A;  1TWA I;  3CCJ Z;  2V8K A;  4NBD A;  2HF1 A;  1K73 2;  1K9M 2;  5T67 A;  3EER A;  4NBB A;  1RO0 A;  3GTM I;  4X6A I;  1QVF Z;  2F4O A;  2JMO A;  3CCS Z;  2DE7 A;  3VMG A;  2E2H I;  3IX0 A;  3GTM S;  3MON A;  2E9H A;  5D1O B;  3GTK I;  1VQK Z;  3NH4 A;  3CC4 Z;  4DK1 A;  1X3Z A;  2GTI A;  3I56 1;  2ZAE B;  3HOX I;  1VQN Z;  1WZN A;  2B63 I;  4Y52 I;  3VMH A;  3CPW Z;  1K73 1;  1VQ7 1;  4NH1 C;  4BBR I;  3HOV I;  1I50 I;  2JIO A;  1YUK A;  3CCL 1;  1VQP 1;  1K8A 2;  1P9N A;  2QLV B;  3IR7 A;  2LIY A;  2K3R A;  2HU9 A;  5A2Q b;  4NB8 A;  1QVG Z;  1S7M A;  4A3E I;  1USP A;  2R92 I;  1SFO I;  3JAM b;  2PK7 A;  2KPI A;  3D9X A;  3J80 f;  1VQL 1;  3NDJ A;  3S2D I;  2VF1 A;  3GTJ I;  3VB9 A;  1JJ2 Z;  3VTN A;  3U50 C;  2VPY A;  3I4N I;  2WB1 A;  3MZK B;  1VQL Z;  1K9M 1;  2V8I A;  3NH8 A;  5T6B A;  2M48 A;  1ZB8 A;  2WAQ A;  2AYD A;  4NBG A;  1VQ4 1;  1VQ8 Z;  3HKZ A;  1Z02 A;  3S16 I;  3CCU Z;  1Y8C A;  3KIH A;  3G71 1;  1NJI 1;  3CPW Y;  1X0T A;  1YIJ 1;  4HGY A;  1VQM Z;  4E2X A;  2V45 A;  3GTL I;  2AKL A;  3GTQ I;  2E7Z A;  4MXU A;  4A3J I;  3I56 Z;  2O4H A;  4BXX I;  2H85 A;  1YIJ Z;  1YHQ 1;  4A3F I;  1TWH I;  3BG1 B;  2OTJ Z;  1N8R 1;  3FKI I;  5CM2 M;  1KC8 1;  2Q51 A;  3GCF A;  2NAP A;  2RT9 A;  2YU9 I;  1TFI A;  3CME 1;  1Q82 1;  1VQ8 1;  2GTH A;  2I3C A;  2W04 A;  1VQ9 1;  3S1N I;  3HOW I;  1DL6 A;  2PMZ A;  1R9T I;  3HOU I;  3CCR 1;  2JA8 I;  4BY7 I;  3BG0 B;  2E2J I;  1YJW Z;  3HOY I;  1Q86 2;  2RIQ A;  3CMA Z;  3OW2 Y;  1VQ9 Z;  2RPR A;  4A3C I;  5IT9 f;  2OTL Z;  1K83 I;  4Y7N I;  2R7Z I;  5C3E I;  4RV9 A;  4NFR A;  1RLY A;  1QXF A;  4BBS I;  1VQ6 1;  3IFU A;  4A3B I;  3HOZ I;  2KI7 B;  3VMI A;  2J6A A;  2OOX B;  4NB9 A;  3G6E 1;  1Q82 2;  3CCV 1;  4A3M I;  1TWC I;  5T64 A;  5D1O A;  1N8R 2;  1VQP Z;  3I4M I;  4DGL A;  4MD8 A;  1VQM 1;  1WJ2 A;  2E2I I;  5FLM I;  1WW9 A;  4E2W A;  3KIF A;  4E32 A;  4E2Y A;  2JIQ A;  4NBF A;  4MD9 A;  3CCS 1;  1YUA A;  3S17 I;  2JA6 I;  2Q4Z A;  3CC2 1;  1ZH1 A;  3G4S Z;  4NBE A;  3D6W A;  3FQQ A;  1KQS Y;  3F3P C;  2IV2 X;  4A3G I;  1M1K 1;  2OTL 1;  4NBA A;  3CCQ Z;  1N2F A;  2JR6 A;  2V8J A;  1X3W A;  1Q81 2;  3I55 Z;  1FDI A;  3RZO I;  4NOZ A;  1TWF I;  2QRE B;  1Y1V S;  4E33 A;  3NFZ A;  1QVG Y;  4A3D I;  4MH4 A;  4MON A;  3P5J B;  5FLX f;  5A2Q f;  2O53 A;  3NDI A;  4RVD A;  3J81 f;  3CXC Z;  3GTO I;  5IP9 I;  1RO2 A; 
#chains in the Genus database with same CATH homology
 3CD6 1;  2OOY B;  4XX2 A;  2RHB A;  4A93 I;  5LL6 f;  3PO3 S;  1YJN 1;  1WCM I;  3MZL B;  5C44 I;  4E30 A;  1S72 1;  2QRC B;  3CCE Z;  2DE6 A;  3GKQ A;  2G2K A;  3CCL Z;  3CQZ I;  4E31 A;  2JUB A;  1USP B;  1YI2 1;  3CCE 1;  2R93 I;  3CCM Z;  1S72 Z;  1KC8 2;  2W03 A;  1KQS Z;  3M3Y I;  5AN9 F;  2GU2 A;  1Q81 1;  2RBL A;  3S1M I;  1WII A;  3CC4 1;  1YJ9 Z;  1VQK 1;  1Y1W I;  3CMA 1;  4QTU A;  1RO4 A;  3CD6 Z;  3H3V J;  3K7A I;  1VQ5 Z;  5C4J I;  1VLA A;  2JA5 I;  3IF8 A;  1RQF A;  2BJO A;  3RZD I;  1Z03 A;  4DQY B;  2P3Y A;  1YIT 1;  3OW2 Z;  3CC7 Z;  1I3Q I;  3CME Z;  3CCR Z;  3J7A 4;  3Q87 A;  1VQ5 1;  4NBC A;  2OTJ 1;  1YHQ Z;  4A3K I;  4EWC A;  1LQL A;  1YJ9 1;  2NVX I;  2PM9 A;  3G4S 1;  3GTG I;  2K5R A;  3CC2 Z;  3S1Q I;  2R6M A;  1M90 1;  3CCM 1;  2QEX Z;  3JAM f;  5C4X I;  3I07 A;  2VUM I;  2QA4 1;  2YAD A;  2QRD B;  1NUI A;  1Q86 1;  4A3L I;  3CCV Z;  1Y1V I;  2P28 A;  3T4N B;  3G6E Z;  2QA4 Z;  1W2B Z;  4TNU A;  4HGZ A;  1VQ4 Z;  4MRI A;  2QEX 1;  2LFU A;  2JA7 I;  3GTP I;  1JJ2 Y;  2JS4 A;  1Q7Y 1;  5D1P A;  1TWG I;  1K8A 1;  3TDH B;  1QVF Y;  3ESW A;  4NBH A;  3FQM A;  4QTT A;  2M6N A;  1YJW 1;  1M1K 2;  3F3F C;  3S2H I;  1ZB9 A;  4RVG A;  3EED A;  2NVY I;  3NH5 A;  1ML8 A;  1I6H I;  3TE5 B;  4S1T A;  3CCQ 1;  2IZ3 A;  2QKD A;  2NVQ I;  2DE5 A;  1NJI 2;  1M90 2;  3S1R I;  3S15 I;  1RNI A;  4A3I I;  1YI2 Z;  1KD1 1;  2Y0S A;  4RVH A;  3S14 I;  1KD1 2;  4MD7 A;  3CXC Y;  5FLX b;  3M4O I;  4CL1 A;  1Q7Y 2;  1W2B Y;  3J81 b;  5IP7 I;  4RVF A;  2IZ4 A;  3J80 b;  4AYB A;  3PO3 I;  1VQ7 Z;  3G71 Z;  2VUG A;  1JWH C;  1VQ6 Z;  1Z01 A;  3CCU 1;  3PO2 I;  2QR1 B;  4RS4 A;  2NVT I;  1KRL A;  1VQN 1;  3LUS A;  3CCJ 1;  2EGT A;  1YJN Z;  5IT9 b;  3QWU A;  4HH4 A;  1L1O C;  1VQO 1;  4E2Z A;  2OZK A;  1QF8 A;  1NP6 A;  3I55 1;  3CC7 1;  2JNY A;  4BY1 I;  2F4M A;  1QYP A;  3H0G I;  1VQO Z;  1YIT Z;  1PFT A;  1TWA I;  3CCJ Z;  2V8K A;  4NBD A;  2HF1 A;  1K73 2;  1K9M 2;  5T67 A;  3EER A;  4NBB A;  1RO0 A;  3GTM I;  4X6A I;  1QVF Z;  2F4O A;  2JMO A;  3CCS Z;  2DE7 A;  3VMG A;  2E2H I;  3IX0 A;  3GTM S;  3MON A;  2E9H A;  5D1O B;  3GTK I;  1VQK Z;  3NH4 A;  3CC4 Z;  4DK1 A;  1X3Z A;  2GTI A;  3I56 1;  2ZAE B;  3HOX I;  1VQN Z;  2B63 I;  4Y52 I;  3VMH A;  3CPW Z;  1K73 1;  1VQ7 1;  4NH1 C;  4BBR I;  3HOV I;  1I50 I;  1YUK A;  3CCL 1;  1VQP 1;  1K8A 2;  1P9N A;  2QLV B;  2LIY A;  2K3R A;  2HU9 A;  5A2Q b;  4NB8 A;  1QVG Z;  1S7M A;  4A3E I;  1USP A;  2R92 I;  1SFO I;  3JAM b;  2PK7 A;  2KPI A;  3D9X A;  3J80 f;  1VQL 1;  3NDJ A;  3S2D I;  2VF1 A;  3GTJ I;  3VB9 A;  1JJ2 Z;  3VTN A;  3U50 C;  3I4N I;  2WB1 A;  3MZK B;  1VQL Z;  1K9M 1;  2V8I A;  3NH8 A;  5T6B A;  2M48 A;  1ZB8 A;  2WAQ A;  4NBG A;  1VQ4 1;  1VQ8 Z;  3HKZ A;  1Z02 A;  3S16 I;  3CCU Z;  3KIH A;  3G71 1;  1NJI 1;  3CPW Y;  1X0T A;  1YIJ 1;  4HGY A;  1VQM Z;  4E2X A;  3GTL I;  2AKL A;  3GTQ I;  4MXU A;  4A3J I;  3I56 Z;  2O4H A;  4BXX I;  2H85 A;  1YIJ Z;  1YHQ 1;  4A3F I;  1TWH I;  3BG1 B;  2OTJ Z;  1N8R 1;  3FKI I;  5CM2 M;  1KC8 1;  2Q51 A;  3GCF A;  2RT9 A;  2YU9 I;  1TFI A;  3CME 1;  1Q82 1;  1VQ8 1;  2GTH A;  2I3C A;  2W04 A;  1VQ9 1;  3S1N I;  3HOW I;  1DL6 A;  2PMZ A;  1R9T I;  3HOU I;  3CCR 1;  2JA8 I;  4BY7 I;  3BG0 B;  2E2J I;  1YJW Z;  3HOY I;  1Q86 2;  2RIQ A;  3CMA Z;  3OW2 Y;  1VQ9 Z;  2RPR A;  4A3C I;  5IT9 f;  2OTL Z;  1K83 I;  4Y7N I;  2R7Z I;  5C3E I;  4RV9 A;  4NFR A;  1RLY A;  4BBS I;  1VQ6 1;  3IFU A;  4A3B I;  3HOZ I;  2KI7 B;  3VMI A;  2J6A A;  2OOX B;  4NB9 A;  3G6E 1;  1Q82 2;  3CCV 1;  4A3M I;  1TWC I;  5T64 A;  5D1O A;  1N8R 2;  1VQP Z;  3I4M I;  4DGL A;  4MD8 A;  1VQM 1;  2E2I I;  5FLM I;  1WW9 A;  4E2W A;  3KIF A;  4E32 A;  4E2Y A;  4NBF A;  4MD9 A;  3CCS 1;  1YUA A;  3S17 I;  2JA6 I;  2Q4Z A;  3CC2 1;  1ZH1 A;  3G4S Z;  4NBE A;  3D6W A;  3FQQ A;  1KQS Y;  3F3P C;  4A3G I;  1M1K 1;  2OTL 1;  4NBA A;  3CCQ Z;  1N2F A;  2JR6 A;  2V8J A;  1X3W A;  1Q81 2;  3I55 Z;  3RZO I;  4NOZ A;  1TWF I;  2QRE B;  1Y1V S;  4E33 A;  3NFZ A;  1QVG Y;  4A3D I;  4MH4 A;  4MON A;  3P5J B;  5FLX f;  5A2Q f;  2O53 A;  3NDI A;  4RVD A;  3J81 f;  3CXC Z;  3GTO I;  5IP9 I;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...