1NUIA

Crystal structure of the primase fragment of bacteriophage t7 primase-helicase protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
246
structure length
242
Chain Sequence
VFLYHIPCDNCGSSDGNSLFSDGHTFCYVCEKWTATKERASKRKPSGGKPGTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primase/helicase
publication title Modular Architecture of the Bacteriophage T7 Primase Couples RNA primer Synthesis to DNA Synthesis
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Replication
total genus 62
structure length 242
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08273 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nuiA01
1USPB 4Y52I 2JA7I 1WCMI 3CQZI 3HOXI 4BBSI 4A3CI 2DE5A 4A3FI 3RZOI 3S1RI 3GTQI 2E2JI 2NVTI 1TWHI 2K5RA 4NBEA 2JA6I 5C4JI 3GKQA 3H0GI 2R7ZI 3S2DI 3PO3I 1I50I 1TWCI 4BBRI 1TWAI 3M4OI 3GTKI 1WW9A 1NUIA 4NBAA 4QTUA 2BJOA 3U50C 4NBFA 3EERA 3HOYI 3S1QI 3I4MI 1ML8A 3ESWA 3HOUI 3S15I 4A3KI 4NB9A 5C4XI 4A3II 1ZB9A 3GTPI 4A3BI 2NVXI 3RZDI 1YUAA 3GTJI 3GTLI 3S17I 1I6HI 1USPA 2P3YA 1SFOI 4QTTA 3VB9A 1VLAA 4NBHA 2F4OA 5IP9I 2F4MA 3HOVI 1Y1VS 5IP7I 1Y1WI 4A3DI 1X3ZA 1TWGI 3I07A 4NBGA 1N2FA 4A3EI 2RBLA 3HOZI 2J6AA 4A3MI 3GTGI 2JNYA 3S16I 3S2HI 2B63I 4BXXI 1TWFI 4NBDA 4Y7NI 1TFIA 3I4NI 3Q87A 2AKLA 4A3LI 3M3YI 1X3WA 2R92I 4A3JI 3GTMS 4XX2A 4NOZA 1RLYA 1I3QI 3LUSA 2PK7A 2DE7A 2VUMI 4NB8A 2KPIA 3PO2I 2R93I 3H3VJ 2DE6A 3FKII 1Y1VI 2HF1A 4NBCA 1R9TI 1ZB8A 3D6WA 3HOWI 4A3GI 3GCFA 4A93I 1PFTA 3VMHA 3S14I 3PO3S 3VMIA 2JR6A 3VMGA 2NVQI 2E2II 3GTOI 3K7AI 2NVYI 1K83I 2E2HI 1L1OC 5C3EI 4MH4A 5CM2M 2YU9I 4X6AI 4NBBA 1LQLA 1QYPA 1DL6A 2JS4A 5C44I 4BY7I 2JA5I 5FLMI 3S1NI 2JA8I 1RO4A 3S1MI 4BY1I 3GTMI
chains in the Genus database with same CATH superfamily
2JMOA 1WJ2A 4RVGA 4BBSI 2GU2A 2JIQA 4HGZA 1ZH1A 1VQN1 2QRDB 5D1OA 3G71Z 3CCE1 2NVTI 1TWHI 2QA4Z 3CD61 2JA6I 2W03A 3G4S1 3GKQA 1KQSY 1Q861 2OTJZ 1I50I 2RPRA 3I561 3CCS1 3CCLZ 3CD6Z 1WIIA 3M4OI 1S7MA 3GTKI 3G4SZ 1YI21 1NUIA 4NBAA 4E2XA 3CC21 1Q7Y2 2JIRA 3I4MI 2VPXA 3ESWA 3HOUI 2M6NA 2QKDA 5IT9f 5C4XI 5A2Qf 2H85A 3IFUA 1YUAA 3GTJI 1NJI1 3GTLI 3CCJZ 3S17I 1USPA 1VQKZ 1VLAA 4NBHA 2F4MA 1YJ91 2W04A 2PMZA 2R6MA 1NP6A 5AN9F 4A3DI 4S1TA 3OW2Z 3I07A 4NBGA 4A3EI 1FDIA 3CCU1 3BG0B 3VTNA 1VQP1 2JNYA 2B63I 2AKLA 2VPWA 5LL6f 1JJ2Z 2V8KA 3J81f 2OOYB 1KD12 2E9HA 3CC4Z 1K731 1K8A1 3PO2I 1Q812 4HH4A 3H3VJ 1W2BY 3FQMA 3FKII 2RT9A 1VQOZ 1Y1VI 1VQ6Z 4A3GI 3D6WA 3GCFA 1QVGZ 3CCR1 1K83I 5C3EI 2OTLZ 5IT9b 5CM2M 4X6AI 2VPZA 5A2Qb 3CCQZ 4NBBA 1YIJ1 1LQLA 2JS4A 2O4HA 5C44I 2RHBA 1Q821 1RO4A 3S1MI 3F3PC 4BY1I 4MXUA 1N8R1 2JA7I 4MD9A 1QVFZ 2AYDA 2IZ4A 2E2JI 3CXCZ 1FDOA 1VQL1 2K5RA 4NBEA 2QRCB 3CCVZ 3CPWY 3JAMb 3PO3I 2NAPA 4BBRI 2I3CA 3G711 4NH1C 3U50C 2BJOA 3J81b 1YJNZ 3EERA 2QA41 4RVHA 3HOYI 2WB1A 1ML8A 3I55Z 2GTHA 4A3II 1ZB9A 2OTJ1 3P5JB 2NVXI 3CCL1 4MD7A 1I6HI 1KRLA 1SFOI 4EWCA 5IP9I 1VQ8Z 5D1PA 2VF1A 1Y1WI 1KC81 2M48A 1Y8CA 3CMEZ 1VQ9Z 2RBLA 3NFZA 2OOXB 2HU9A 3CCJ1 4DQYB 1VQK1 3BG1B 3GTGI 3S16I 3S2HI 4NBDA 4Y7NI 1TFIA 3Q87A 2GTIA 1RO0A 3TE5B 1X3WA 2EGTA 1KQSZ 2LEXA 3GTMS 4NOZA 1RLYA 2V45A 2PK7A 4RV9A 2DE7A 1Q862 2ZAEB 2R93I 1RO2A 2HF1A 3JAMf 1R9TI 1ZB8A 4DGLA 3HOWI 3VMIA 3VMGA 1VQ7Z 3MZKB 3CC41 2E2II 1JJ2Y 1NJI2 2IV2X 1YITZ 1QYPA 1VQO1 1DL6A 1VQ61 1JWHC 4BY7I 4RVFA 3S1NI 2JA8I 2R7ZI 4E33A 1M901 4Y52I 2V8JA 4A3CI 2Q4ZA 1S72Z 1K9M1 2OTL1 3S1RI 3GTQI 1QVGY 3D2LA 3CCQ1 3G6EZ 2JIOA 1VQ4Z 3H0GI 3CC7Z 2V8IA 2V3VA 4CL1A 5T64A 1P9NA 1TWAI 2LIYA 1RQFA 1VQ5Z 3KIHA 4NBFA 1W2BZ 1QVFY 1K732 3CCV1 3S1QI 2WAQA 1K8A2 3S15I 3FQQA 2P28A 1M1K1 3QWUA 3GTPI 3CXCY 1AA6A 4RVDA 3VB9A 4TNUA 2F4OA 1YJN1 3HOVI 1Y1VS 5IP7I 4E30A 3I551 1X3ZA 1TWGI 1Q822 1N2FA 3T4NB 4E2ZA 3HOZI 1N8R2 4BXXI 1TWFI 1VQMZ 3I4NI 1VQ81 3CPWZ 3M3YI 1QXFA 2QEXZ 2R92I 3J80b 4A3JI 3CMA1 4E31A 5D1OB 1I3QI 2JUBA 3LUSA 3CME1 1VQ91 4DK1A 3D9XA 2Y0SA 2QREB 3KIFA 1Q7Y1 2LFUA 3CMAZ 1QF8A 4E2WA 4MD8A 4E2YA 1YUKA 4NFRA 1PFTA 3VMHA 3S14I 3PO3S 2NVQI 3GTOI 1VQNZ 4MH4A 2YU9I 3F3FC 3MONA 3CCEZ 1RNIA 2JA5I 5FLMI 3EEDA 3OW2Y 1USPB 1WCMI 3CQZI 2IZ3A 3HOXI 3IR7A 1KC82 1VQ71 2DE5A 3I56Z 3CCSZ 3CCM1 4A3FI 3RZOI 2VPYA 1SIWA 1YI2Z 3MZLB 4E32A 3CC2Z 3NH5A 1YIT1 1YHQ1 5C4JI 1X0TA 3CCMZ 1KD11 3S2DI 2YADA 3NDJA 1YHQZ 1TWCI 4HGYA 3IX0A 1Q811 1S721 1WW9A 4QTUA 2O53A 2RIQA 5FLXf 1YJ9Z 3G6E1 3NH4A 4A3KI 1VQ41 2QR1B 3J80f 2PM9A 4NB9A 4A3BI 3CC71 3RZDI 3J7A4 4AYBA 3CCUZ 2P3YA 1VQ51 1VQPZ 4QTTA 3IF8A 2KI7B 1Z03A 3TDHB 5T6BA 1Z02A 1M902 2JIMA 2J6AA 4A3MI 2G2KA 2QLVB 1K9M2 4A3LI 2OZKA 1YJW1 4XX2A 3CCRZ 2VUGA 2K3RA 2VUMI 4NB8A 1YJWZ 2KPIA 1VQM1 4RS4A 2JIPA 1YIJZ 2DE6A 2QEX1 4NBCA 4MRIA 3NH8A 4A93I 1M1K2 5FLXb 2JR6A 1WZNA 2E7ZA 3K7AI 2NVYI 2E2HI 1L1OC 2Q51A 3NDIA 1Z01A 3HKZA 5T67A 1VQLZ 4MONA 1Q16A 3GTMI
chains in the Genus database with same CATH topology
2JMOA 4RVGA 4BBSI 2GU2A 4HGZA 1ZH1A 1VQN1 2QRDB 5D1OA 3G71Z 3CCE1 2NVTI 1TWHI 2QA4Z 3CD61 2JA6I 2W03A 3G4S1 3GKQA 1KQSY 1Q861 2OTJZ 1I50I 2RPRA 3I561 3CCS1 3CCLZ 3CD6Z 1WIIA 3M4OI 1S7MA 3GTKI 3G4SZ 1YI21 1NUIA 4NBAA 4E2XA 3CC21 1Q7Y2 3I4MI 3ESWA 3HOUI 2M6NA 2QKDA 5IT9f 5C4XI 5A2Qf 2H85A 3IFUA 1YUAA 3GTJI 1NJI1 3GTLI 3CCJZ 3S17I 1USPA 1VQKZ 1VLAA 4NBHA 2F4MA 1YJ91 2W04A 2PMZA 2R6MA 1NP6A 5AN9F 4A3DI 4S1TA 3OW2Z 3I07A 4NBGA 4A3EI 3CCU1 3BG0B 3VTNA 1VQP1 2JNYA 2B63I 2AKLA 5LL6f 1JJ2Z 2V8KA 3J81f 2OOYB 1KD12 2E9HA 3CC4Z 1K731 1K8A1 3PO2I 1Q812 4HH4A 3H3VJ 1W2BY 3FQMA 3FKII 2RT9A 1VQOZ 1Y1VI 1VQ6Z 4A3GI 3D6WA 3GCFA 1QVGZ 3CCR1 1K83I 5C3EI 2OTLZ 5IT9b 5CM2M 4X6AI 5A2Qb 3CCQZ 4NBBA 1YIJ1 1LQLA 2JS4A 2O4HA 5C44I 2RHBA 1Q821 1RO4A 3S1MI 3F3PC 4BY1I 4MXUA 1N8R1 2JA7I 4MD9A 1QVFZ 2IZ4A 2E2JI 3CXCZ 1VQL1 2K5RA 4NBEA 2QRCB 3CCVZ 3CPWY 3JAMb 3PO3I 4BBRI 2I3CA 3G711 4NH1C 3U50C 2BJOA 3J81b 1YJNZ 3EERA 2QA41 4RVHA 3HOYI 2WB1A 1ML8A 3I55Z 2GTHA 4A3II 1ZB9A 2OTJ1 3P5JB 2NVXI 3CCL1 4MD7A 1I6HI 1KRLA 1SFOI 4EWCA 5IP9I 1VQ8Z 5D1PA 2VF1A 1Y1WI 1KC81 2M48A 3CMEZ 1VQ9Z 2RBLA 3NFZA 2OOXB 2HU9A 3CCJ1 4DQYB 1VQK1 3BG1B 3GTGI 3S16I 3S2HI 4NBDA 4Y7NI 1TFIA 3Q87A 2GTIA 1RO0A 3TE5B 1X3WA 2EGTA 1KQSZ 3GTMS 4NOZA 1RLYA 2PK7A 4RV9A 2DE7A 1Q862 2ZAEB 2R93I 1RO2A 2HF1A 3JAMf 1R9TI 1ZB8A 4DGLA 3HOWI 3VMIA 3VMGA 1VQ7Z 3MZKB 3CC41 2E2II 1JJ2Y 1NJI2 1YITZ 1QYPA 1VQO1 1DL6A 1VQ61 1JWHC 4BY7I 4RVFA 3S1NI 2JA8I 2R7ZI 4E33A 1M901 4Y52I 2V8JA 4A3CI 2Q4ZA 1S72Z 1K9M1 2OTL1 3S1RI 3GTQI 1QVGY 3CCQ1 3G6EZ 1VQ4Z 3H0GI 3CC7Z 2V8IA 4CL1A 5T64A 1P9NA 1TWAI 2LIYA 1RQFA 1VQ5Z 3KIHA 4NBFA 1W2BZ 1QVFY 1K732 3CCV1 3S1QI 2WAQA 1K8A2 3S15I 3FQQA 2P28A 1M1K1 3QWUA 3GTPI 3CXCY 4RVDA 3VB9A 4TNUA 2F4OA 1YJN1 3HOVI 1Y1VS 5IP7I 4E30A 3I551 1X3ZA 1TWGI 1Q822 1N2FA 3T4NB 4E2ZA 3HOZI 1N8R2 4BXXI 1TWFI 1VQMZ 3I4NI 1VQ81 3CPWZ 3M3YI 2QEXZ 2R92I 3J80b 4A3JI 3CMA1 4E31A 5D1OB 1I3QI 2JUBA 3LUSA 3CME1 1VQ91 4DK1A 3D9XA 2Y0SA 2QREB 3KIFA 1Q7Y1 2LFUA 3CMAZ 1QF8A 4E2WA 4MD8A 4E2YA 1YUKA 4NFRA 1PFTA 3VMHA 3S14I 3PO3S 2NVQI 3GTOI 1VQNZ 4MH4A 2YU9I 3F3FC 3MONA 3CCEZ 1RNIA 2JA5I 5FLMI 3EEDA 3OW2Y 1USPB 1WCMI 3CQZI 2IZ3A 3HOXI 1KC82 1VQ71 2DE5A 3I56Z 3CCSZ 3CCM1 4A3FI 3RZOI 1YI2Z 3MZLB 4E32A 3CC2Z 3NH5A 1YIT1 1YHQ1 5C4JI 1X0TA 3CCMZ 1KD11 3S2DI 2YADA 3NDJA 1YHQZ 1TWCI 4HGYA 3IX0A 1Q811 1S721 1WW9A 4QTUA 2O53A 2RIQA 5FLXf 1YJ9Z 3G6E1 3NH4A 4A3KI 1VQ41 2QR1B 3J80f 2PM9A 4NB9A 4A3BI 3CC71 3RZDI 3J7A4 4AYBA 3CCUZ 2P3YA 1VQ51 1VQPZ 4QTTA 3IF8A 2KI7B 1Z03A 3TDHB 5T6BA 1Z02A 1M902 2J6AA 4A3MI 2G2KA 2QLVB 1K9M2 4A3LI 2OZKA 1YJW1 4XX2A 3CCRZ 2VUGA 2K3RA 2VUMI 4NB8A 1YJWZ 2KPIA 1VQM1 4RS4A 1YIJZ 2DE6A 2QEX1 4NBCA 4MRIA 3NH8A 4A93I 1M1K2 5FLXb 2JR6A 3K7AI 2NVYI 2E2HI 1L1OC 2Q51A 3NDIA 1Z01A 3HKZA 5T67A 1VQLZ 4MONA 3GTMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP B;  4Y52 I;  2JA7 I;  1WCM I;  3CQZ I;  3HOX I;  4BBS I;  4A3C I;  2DE5 A;  4A3F I;  3RZO I;  3S1R I;  3GTQ I;  2E2J I;  2NVT I;  1TWH I;  2K5R A;  4NBE A;  2JA6 I;  5C4J I;  3GKQ A;  3H0G I;  2R7Z I;  3S2D I;  3PO3 I;  1I50 I;  1TWC I;  4BBR I;  1TWA I;  3M4O I;  3GTK I;  1WW9 A;  1NUI A;  4NBA A;  4QTU A;  2BJO A;  3U50 C;  4NBF A;  3EER A;  3HOY I;  3S1Q I;  3I4M I;  1ML8 A;  3ESW A;  3HOU I;  3S15 I;  4A3K I;  4NB9 A;  5C4X I;  4A3I I;  1ZB9 A;  3GTP I;  4A3B I;  2NVX I;  3RZD I;  1YUA A;  3GTJ I;  3GTL I;  3S17 I;  1I6H I;  1USP A;  2P3Y A;  1SFO I;  4QTT A;  3VB9 A;  1VLA A;  4NBH A;  2F4O A;  5IP9 I;  2F4M A;  3HOV I;  1Y1V S;  5IP7 I;  1Y1W I;  4A3D I;  1X3Z A;  1TWG I;  3I07 A;  4NBG A;  1N2F A;  4A3E I;  2RBL A;  3HOZ I;  2J6A A;  4A3M I;  3GTG I;  2JNY A;  3S16 I;  3S2H I;  2B63 I;  4BXX I;  1TWF I;  4NBD A;  4Y7N I;  1TFI A;  3I4N I;  3Q87 A;  2AKL A;  4A3L I;  3M3Y I;  1X3W A;  2R92 I;  4A3J I;  3GTM S;  4XX2 A;  4NOZ A;  1RLY A;  1I3Q I;  3LUS A;  2PK7 A;  2DE7 A;  2VUM I;  4NB8 A;  2KPI A;  3PO2 I;  2R93 I;  3H3V J;  2DE6 A;  3FKI I;  1Y1V I;  2HF1 A;  4NBC A;  1R9T I;  1ZB8 A;  3D6W A;  3HOW I;  4A3G I;  3GCF A;  4A93 I;  1PFT A;  3VMH A;  3S14 I;  3PO3 S;  3VMI A;  2JR6 A;  3VMG A;  2NVQ I;  2E2I I;  3GTO I;  3K7A I;  2NVY I;  1K83 I;  2E2H I;  1L1O C;  5C3E I;  4MH4 A;  5CM2 M;  2YU9 I;  4X6A I;  4NBB A;  1LQL A;  1QYP A;  1DL6 A;  2JS4 A;  5C44 I;  4BY7 I;  2JA5 I;  5FLM I;  3S1N I;  2JA8 I;  1RO4 A;  3S1M I;  4BY1 I;  3GTM I; 
#chains in the Genus database with same CATH topology
 2JMO A;  1WJ2 A;  4RVG A;  4BBS I;  2GU2 A;  2JIQ A;  4HGZ A;  1ZH1 A;  1VQN 1;  2QRD B;  5D1O A;  3G71 Z;  3CCE 1;  2NVT I;  1TWH I;  2QA4 Z;  3CD6 1;  2JA6 I;  2W03 A;  3G4S 1;  3GKQ A;  1KQS Y;  1Q86 1;  2OTJ Z;  1I50 I;  2RPR A;  3I56 1;  3CCS 1;  3CCL Z;  3CD6 Z;  1WII A;  3M4O I;  1S7M A;  3GTK I;  3G4S Z;  1YI2 1;  1NUI A;  4NBA A;  4E2X A;  3CC2 1;  1Q7Y 2;  2JIR A;  3I4M I;  2VPX A;  3ESW A;  3HOU I;  2M6N A;  2QKD A;  5IT9 f;  5C4X I;  5A2Q f;  2H85 A;  3IFU A;  1YUA A;  3GTJ I;  1NJI 1;  3GTL I;  3CCJ Z;  3S17 I;  1USP A;  1VQK Z;  1VLA A;  4NBH A;  2F4M A;  1YJ9 1;  2W04 A;  2PMZ A;  2R6M A;  1NP6 A;  5AN9 F;  4A3D I;  4S1T A;  3OW2 Z;  3I07 A;  4NBG A;  4A3E I;  1FDI A;  3CCU 1;  3BG0 B;  3VTN A;  1VQP 1;  2JNY A;  2B63 I;  2AKL A;  2VPW A;  5LL6 f;  1JJ2 Z;  2V8K A;  3J81 f;  2OOY B;  1KD1 2;  2E9H A;  3CC4 Z;  1K73 1;  1K8A 1;  3PO2 I;  1Q81 2;  4HH4 A;  3H3V J;  1W2B Y;  3FQM A;  3FKI I;  2RT9 A;  1VQO Z;  1Y1V I;  1VQ6 Z;  4A3G I;  3D6W A;  3GCF A;  1QVG Z;  3CCR 1;  1K83 I;  5C3E I;  2OTL Z;  5IT9 b;  5CM2 M;  4X6A I;  2VPZ A;  5A2Q b;  3CCQ Z;  4NBB A;  1YIJ 1;  1LQL A;  2JS4 A;  2O4H A;  5C44 I;  2RHB A;  1Q82 1;  1RO4 A;  3S1M I;  3F3P C;  4BY1 I;  4MXU A;  1N8R 1;  2JA7 I;  4MD9 A;  1QVF Z;  2AYD A;  2IZ4 A;  2E2J I;  3CXC Z;  1FDO A;  1VQL 1;  2K5R A;  4NBE A;  2QRC B;  3CCV Z;  3CPW Y;  3JAM b;  3PO3 I;  2NAP A;  4BBR I;  2I3C A;  3G71 1;  4NH1 C;  3U50 C;  2BJO A;  3J81 b;  1YJN Z;  3EER A;  2QA4 1;  4RVH A;  3HOY I;  2WB1 A;  1ML8 A;  3I55 Z;  2GTH A;  4A3I I;  1ZB9 A;  2OTJ 1;  3P5J B;  2NVX I;  3CCL 1;  4MD7 A;  1I6H I;  1KRL A;  1SFO I;  4EWC A;  5IP9 I;  1VQ8 Z;  5D1P A;  2VF1 A;  1Y1W I;  1KC8 1;  2M48 A;  1Y8C A;  3CME Z;  1VQ9 Z;  2RBL A;  3NFZ A;  2OOX B;  2HU9 A;  3CCJ 1;  4DQY B;  1VQK 1;  3BG1 B;  3GTG I;  3S16 I;  3S2H I;  4NBD A;  4Y7N I;  1TFI A;  3Q87 A;  2GTI A;  1RO0 A;  3TE5 B;  1X3W A;  2EGT A;  1KQS Z;  2LEX A;  3GTM S;  4NOZ A;  1RLY A;  2V45 A;  2PK7 A;  4RV9 A;  2DE7 A;  1Q86 2;  2ZAE B;  2R93 I;  1RO2 A;  2HF1 A;  3JAM f;  1R9T I;  1ZB8 A;  4DGL A;  3HOW I;  3VMI A;  3VMG A;  1VQ7 Z;  3MZK B;  3CC4 1;  2E2I I;  1JJ2 Y;  1NJI 2;  2IV2 X;  1YIT Z;  1QYP A;  1VQO 1;  1DL6 A;  1VQ6 1;  1JWH C;  4BY7 I;  4RVF A;  3S1N I;  2JA8 I;  2R7Z I;  4E33 A;  1M90 1;  4Y52 I;  2V8J A;  4A3C I;  2Q4Z A;  1S72 Z;  1K9M 1;  2OTL 1;  3S1R I;  3GTQ I;  1QVG Y;  3D2L A;  3CCQ 1;  3G6E Z;  2JIO A;  1VQ4 Z;  3H0G I;  3CC7 Z;  2V8I A;  2V3V A;  4CL1 A;  5T64 A;  1P9N A;  1TWA I;  2LIY A;  1RQF A;  1VQ5 Z;  3KIH A;  4NBF A;  1W2B Z;  1QVF Y;  1K73 2;  3CCV 1;  3S1Q I;  2WAQ A;  1K8A 2;  3S15 I;  3FQQ A;  2P28 A;  1M1K 1;  3QWU A;  3GTP I;  3CXC Y;  1AA6 A;  4RVD A;  3VB9 A;  4TNU A;  2F4O A;  1YJN 1;  3HOV I;  1Y1V S;  5IP7 I;  4E30 A;  3I55 1;  1X3Z A;  1TWG I;  1Q82 2;  1N2F A;  3T4N B;  4E2Z A;  3HOZ I;  1N8R 2;  4BXX I;  1TWF I;  1VQM Z;  3I4N I;  1VQ8 1;  3CPW Z;  3M3Y I;  1QXF A;  2QEX Z;  2R92 I;  3J80 b;  4A3J I;  3CMA 1;  4E31 A;  5D1O B;  1I3Q I;  2JUB A;  3LUS A;  3CME 1;  1VQ9 1;  4DK1 A;  3D9X A;  2Y0S A;  2QRE B;  3KIF A;  1Q7Y 1;  2LFU A;  3CMA Z;  1QF8 A;  4E2W A;  4MD8 A;  4E2Y A;  1YUK A;  4NFR A;  1PFT A;  3VMH A;  3S14 I;  3PO3 S;  2NVQ I;  3GTO I;  1VQN Z;  4MH4 A;  2YU9 I;  3F3F C;  3MON A;  3CCE Z;  1RNI A;  2JA5 I;  5FLM I;  3EED A;  3OW2 Y;  1USP B;  1WCM I;  3CQZ I;  2IZ3 A;  3HOX I;  3IR7 A;  1KC8 2;  1VQ7 1;  2DE5 A;  3I56 Z;  3CCS Z;  3CCM 1;  4A3F I;  3RZO I;  2VPY A;  1SIW A;  1YI2 Z;  3MZL B;  4E32 A;  3CC2 Z;  3NH5 A;  1YIT 1;  1YHQ 1;  5C4J I;  1X0T A;  3CCM Z;  1KD1 1;  3S2D I;  2YAD A;  3NDJ A;  1YHQ Z;  1TWC I;  4HGY A;  3IX0 A;  1Q81 1;  1S72 1;  1WW9 A;  4QTU A;  2O53 A;  2RIQ A;  5FLX f;  1YJ9 Z;  3G6E 1;  3NH4 A;  4A3K I;  1VQ4 1;  2QR1 B;  3J80 f;  2PM9 A;  4NB9 A;  4A3B I;  3CC7 1;  3RZD I;  3J7A 4;  4AYB A;  3CCU Z;  2P3Y A;  1VQ5 1;  1VQP Z;  4QTT A;  3IF8 A;  2KI7 B;  1Z03 A;  3TDH B;  5T6B A;  1Z02 A;  1M90 2;  2JIM A;  2J6A A;  4A3M I;  2G2K A;  2QLV B;  1K9M 2;  4A3L I;  2OZK A;  1YJW 1;  4XX2 A;  3CCR Z;  2VUG A;  2K3R A;  2VUM I;  4NB8 A;  1YJW Z;  2KPI A;  1VQM 1;  4RS4 A;  2JIP A;  1YIJ Z;  2DE6 A;  2QEX 1;  4NBC A;  4MRI A;  3NH8 A;  4A93 I;  1M1K 2;  5FLX b;  2JR6 A;  1WZN A;  2E7Z A;  3K7A I;  2NVY I;  2E2H I;  1L1O C;  2Q51 A;  3NDI A;  1Z01 A;  3HKZ A;  5T67 A;  1VQL Z;  4MON A;  1Q16 A;  3GTM I; 
#chains in the Genus database with same CATH homology
 2JMO A;  4RVG A;  4BBS I;  2GU2 A;  4HGZ A;  1ZH1 A;  1VQN 1;  2QRD B;  5D1O A;  3G71 Z;  3CCE 1;  2NVT I;  1TWH I;  2QA4 Z;  3CD6 1;  2JA6 I;  2W03 A;  3G4S 1;  3GKQ A;  1KQS Y;  1Q86 1;  2OTJ Z;  1I50 I;  2RPR A;  3I56 1;  3CCS 1;  3CCL Z;  3CD6 Z;  1WII A;  3M4O I;  1S7M A;  3GTK I;  3G4S Z;  1YI2 1;  1NUI A;  4NBA A;  4E2X A;  3CC2 1;  1Q7Y 2;  3I4M I;  3ESW A;  3HOU I;  2M6N A;  2QKD A;  5IT9 f;  5C4X I;  5A2Q f;  2H85 A;  3IFU A;  1YUA A;  3GTJ I;  1NJI 1;  3GTL I;  3CCJ Z;  3S17 I;  1USP A;  1VQK Z;  1VLA A;  4NBH A;  2F4M A;  1YJ9 1;  2W04 A;  2PMZ A;  2R6M A;  1NP6 A;  5AN9 F;  4A3D I;  4S1T A;  3OW2 Z;  3I07 A;  4NBG A;  4A3E I;  3CCU 1;  3BG0 B;  3VTN A;  1VQP 1;  2JNY A;  2B63 I;  2AKL A;  5LL6 f;  1JJ2 Z;  2V8K A;  3J81 f;  2OOY B;  1KD1 2;  2E9H A;  3CC4 Z;  1K73 1;  1K8A 1;  3PO2 I;  1Q81 2;  4HH4 A;  3H3V J;  1W2B Y;  3FQM A;  3FKI I;  2RT9 A;  1VQO Z;  1Y1V I;  1VQ6 Z;  4A3G I;  3D6W A;  3GCF A;  1QVG Z;  3CCR 1;  1K83 I;  5C3E I;  2OTL Z;  5IT9 b;  5CM2 M;  4X6A I;  5A2Q b;  3CCQ Z;  4NBB A;  1YIJ 1;  1LQL A;  2JS4 A;  2O4H A;  5C44 I;  2RHB A;  1Q82 1;  1RO4 A;  3S1M I;  3F3P C;  4BY1 I;  4MXU A;  1N8R 1;  2JA7 I;  4MD9 A;  1QVF Z;  2IZ4 A;  2E2J I;  3CXC Z;  1VQL 1;  2K5R A;  4NBE A;  2QRC B;  3CCV Z;  3CPW Y;  3JAM b;  3PO3 I;  4BBR I;  2I3C A;  3G71 1;  4NH1 C;  3U50 C;  2BJO A;  3J81 b;  1YJN Z;  3EER A;  2QA4 1;  4RVH A;  3HOY I;  2WB1 A;  1ML8 A;  3I55 Z;  2GTH A;  4A3I I;  1ZB9 A;  2OTJ 1;  3P5J B;  2NVX I;  3CCL 1;  4MD7 A;  1I6H I;  1KRL A;  1SFO I;  4EWC A;  5IP9 I;  1VQ8 Z;  5D1P A;  2VF1 A;  1Y1W I;  1KC8 1;  2M48 A;  3CME Z;  1VQ9 Z;  2RBL A;  3NFZ A;  2OOX B;  2HU9 A;  3CCJ 1;  4DQY B;  1VQK 1;  3BG1 B;  3GTG I;  3S16 I;  3S2H I;  4NBD A;  4Y7N I;  1TFI A;  3Q87 A;  2GTI A;  1RO0 A;  3TE5 B;  1X3W A;  2EGT A;  1KQS Z;  3GTM S;  4NOZ A;  1RLY A;  2PK7 A;  4RV9 A;  2DE7 A;  1Q86 2;  2ZAE B;  2R93 I;  1RO2 A;  2HF1 A;  3JAM f;  1R9T I;  1ZB8 A;  4DGL A;  3HOW I;  3VMI A;  3VMG A;  1VQ7 Z;  3MZK B;  3CC4 1;  2E2I I;  1JJ2 Y;  1NJI 2;  1YIT Z;  1QYP A;  1VQO 1;  1DL6 A;  1VQ6 1;  1JWH C;  4BY7 I;  4RVF A;  3S1N I;  2JA8 I;  2R7Z I;  4E33 A;  1M90 1;  4Y52 I;  2V8J A;  4A3C I;  2Q4Z A;  1S72 Z;  1K9M 1;  2OTL 1;  3S1R I;  3GTQ I;  1QVG Y;  3CCQ 1;  3G6E Z;  1VQ4 Z;  3H0G I;  3CC7 Z;  2V8I A;  4CL1 A;  5T64 A;  1P9N A;  1TWA I;  2LIY A;  1RQF A;  1VQ5 Z;  3KIH A;  4NBF A;  1W2B Z;  1QVF Y;  1K73 2;  3CCV 1;  3S1Q I;  2WAQ A;  1K8A 2;  3S15 I;  3FQQ A;  2P28 A;  1M1K 1;  3QWU A;  3GTP I;  3CXC Y;  4RVD A;  3VB9 A;  4TNU A;  2F4O A;  1YJN 1;  3HOV I;  1Y1V S;  5IP7 I;  4E30 A;  3I55 1;  1X3Z A;  1TWG I;  1Q82 2;  1N2F A;  3T4N B;  4E2Z A;  3HOZ I;  1N8R 2;  4BXX I;  1TWF I;  1VQM Z;  3I4N I;  1VQ8 1;  3CPW Z;  3M3Y I;  2QEX Z;  2R92 I;  3J80 b;  4A3J I;  3CMA 1;  4E31 A;  5D1O B;  1I3Q I;  2JUB A;  3LUS A;  3CME 1;  1VQ9 1;  4DK1 A;  3D9X A;  2Y0S A;  2QRE B;  3KIF A;  1Q7Y 1;  2LFU A;  3CMA Z;  1QF8 A;  4E2W A;  4MD8 A;  4E2Y A;  1YUK A;  4NFR A;  1PFT A;  3VMH A;  3S14 I;  3PO3 S;  2NVQ I;  3GTO I;  1VQN Z;  4MH4 A;  2YU9 I;  3F3F C;  3MON A;  3CCE Z;  1RNI A;  2JA5 I;  5FLM I;  3EED A;  3OW2 Y;  1USP B;  1WCM I;  3CQZ I;  2IZ3 A;  3HOX I;  1KC8 2;  1VQ7 1;  2DE5 A;  3I56 Z;  3CCS Z;  3CCM 1;  4A3F I;  3RZO I;  1YI2 Z;  3MZL B;  4E32 A;  3CC2 Z;  3NH5 A;  1YIT 1;  1YHQ 1;  5C4J I;  1X0T A;  3CCM Z;  1KD1 1;  3S2D I;  2YAD A;  3NDJ A;  1YHQ Z;  1TWC I;  4HGY A;  3IX0 A;  1Q81 1;  1S72 1;  1WW9 A;  4QTU A;  2O53 A;  2RIQ A;  5FLX f;  1YJ9 Z;  3G6E 1;  3NH4 A;  4A3K I;  1VQ4 1;  2QR1 B;  3J80 f;  2PM9 A;  4NB9 A;  4A3B I;  3CC7 1;  3RZD I;  3J7A 4;  4AYB A;  3CCU Z;  2P3Y A;  1VQ5 1;  1VQP Z;  4QTT A;  3IF8 A;  2KI7 B;  1Z03 A;  3TDH B;  5T6B A;  1Z02 A;  1M90 2;  2J6A A;  4A3M I;  2G2K A;  2QLV B;  1K9M 2;  4A3L I;  2OZK A;  1YJW 1;  4XX2 A;  3CCR Z;  2VUG A;  2K3R A;  2VUM I;  4NB8 A;  1YJW Z;  2KPI A;  1VQM 1;  4RS4 A;  1YIJ Z;  2DE6 A;  2QEX 1;  4NBC A;  4MRI A;  3NH8 A;  4A93 I;  1M1K 2;  5FLX b;  2JR6 A;  3K7A I;  2NVY I;  2E2H I;  1L1O C;  2Q51 A;  3NDI A;  1Z01 A;  3HKZ A;  5T67 A;  1VQL Z;  4MON A;  3GTM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...