1NUIA

Crystal structure of the primase fragment of bacteriophage t7 primase-helicase protein
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
246
structure length
242
Chain Sequence
VFLYHIPCDNCGSSDGNSLFSDGHTFCYVCEKWTATKERASKRKPSGGKPGTYNVWNFGESNGRYSALTARGISKETCQKAGYWIAKVDGVMYQVADYRDQNGNIVSQKVRDKDKNFKTTGSHKSDALFGKHLWNGGKKIVVTEGEIDMLTVMELQDCKYPVVSLGHGASAAKKTCAANYEYFDQFEQIILMFDMDEAGRKAVEEAAQVLPAGKVRVAVLPCKDANECHLNGHDREIMEQVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primase/helicase
publication title Modular Architecture of the Bacteriophage T7 Primase Couples RNA primer Synthesis to DNA Synthesis
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Replication
total genus 62
structure length 242
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2003-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08273 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1nuiA01
2RBLA 2NVYI 3GTMI 1SFOI 3GTKI 2JA5I 2JR6A 3GCFA 3ESWA 4NBAA 3FKII 5CM2M 1K83I 2JA8I 5FLMI 4BXXI 1Y1VI 1I6HI 3HOUI 4A3BI 5C4JI 3S1QI 3H0GI 1RLYA 4X6AI 3S2DI 2HF1A 1NUIA 3GTPI 2K5RA 3S16I 4BBSI 4NBCA 3RZOI 4BY7I 5IP7I 2AKLA 4NBEA 4A3GI 1Y1VS 4BY1I 1YUAA 3S14I 3S17I 2JS4A 1TWHI 3VMGA 3I4MI 4A3II 4A3KI 3S2HI 3GTOI 4Y7NI 2DE5A 2F4MA 4A3LI 2YU9I 3GTGI 4NOZA 3VB9A 3VMIA 5C3EI 2E2II 4NBDA 4A93I 1PFTA 1TWCI 2KPIA 4XX2A 2F4OA 1N2FA 3GTJI 3HOWI 1I50I 3GTQI 3S1NI 5IP9I 3M4OI 2B63I 4BBRI 3S1RI 2E2JI 2NVQI 4NBGA 2JA7I 3VMHA 3CQZI 1WW9A 3M3YI 4A3CI 1ZB8A 3EERA 2R93I 1X3WA 3HOVI 3HOYI 3Q87A 4A3EI 1ZB9A 1USPA 1LQLA 4NB9A 2PK7A 1DL6A 4NBHA 3D6WA 3RZDI 4Y52I 3K7AI 3HOZI 1TWFI 2P3YA 2R7ZI 3U50C 4NB8A 2JA6I 1R9TI 3I4NI 4MH4A 3PO3S 1USPB 1TFIA 2BJOA 1L1OC 1Y1WI 1ML8A 3GTLI 2NVXI 1VLAA 2R92I 4A3FI 4QTTA 3I07A 3S1MI 4QTUA 2NVTI 3PO3I 3HOXI 5C44I 1TWAI 1TWGI 2E2HI 5C4XI 1I3QI 2J6AA 2DE7A 4NBFA 3GTMS 1RO4A 4A3MI 1QYPA 1X3ZA 1WCMI 2DE6A 3PO2I 4A3JI 3S15I 4NBBA 3LUSA 2JNYA 3H3VJ 4A3DI 2VUMI 3GKQA
chains in the Genus database with same CATH superfamily
2RBLA 2M48A 2IV2X 3CPWY 1VQP1 1YITZ 1VQ4Z 4NBAA 5CM2M 2JA8I 1K9M1 2E9HA 2QRCB 2JIQA 2QLVB 3CCEZ 4A3BI 5C4JI 4HGZA 3S1QI 2LEXA 3OW2Z 1VQPZ 3RZOI 4BY7I 1Q812 4NBEA 4RVGA 4BY1I 2JS4A 4E2XA 2OZKA 3CMEZ 2V45A 4E2WA 3F3PC 1VQ91 2DE5A 2F4MA 3IR7A 3IX0A 3JAMb 3VMIA 4A93I 3GTJI 2F4OA 3S1NI 4RVFA 4AYBA 3S1RI 2E2JI 4NBGA 2JA7I 2PMZA 3CQZI 1WW9A 4A3CI 3P5JB 1VQ9Z 1ZB8A 5FLXb 2IZ3A 2V8IA 4NB9A 1AA6A 3MZLB 2PK7A 3G4S1 3D6WA 2Q4ZA 3RZDI 1Q811 4Y52I 1TWFI 2M6NA 4CL1A 1VQ7Z 4NB8A 4DK1A 1USPB 3CC21 3J7A4 1VQ51 2BJOA 2VPWA 3QWUA 3JAMf 3GTLI 1VQL1 3NH5A 3CC71 2PM9A 2LIYA 1RO0A 5T67A 5D1OA 5IT9f 1YJ91 3IFUA 1TWGI 5C4XI 3CC2Z 3J80f 1RO4A 3CCV1 1QYPA 5FLXf 1X3ZA 1WCMI 1ZH1A 1VQLZ 3CC7Z 4A3JI 2QREB 3CXCY 1Q7Y2 2NVYI 1YJ9Z 1SFOI 3GTKI 2JA5I 1VQN1 1KQSY 1YHQ1 1K83I 2QA41 3CCVZ 4E30A 1S721 3HOUI 1VQO1 3H0GI 2RHBA 4X6AI 5T64A 1NUIA 1VQ81 3GTPI 2K5RA 1VQNZ 1N8R2 4NH1C 3J81b 1YHQZ 2QA4Z 2VUGA 1QVGZ 1YUKA 4A3GI 1YIJ1 1S72Z 2OTJ1 3MZKB 3MONA 1VQOZ 3I4MI 3CCS1 4A3II 4A3KI 4HGYA 3S2HI 1YJW1 1VQ8Z 2OOXB 2E2II 4NBDA 1PFTA 1TWCI 1KRLA 1YIJZ 1Q7Y1 2VF1A 2KPIA 2OTJZ 4XX2A 3HOWI 3CME1 5IP9I 3M4OI 2B63I 4BBRI 3CCSZ 3CCL1 3NH8A 1YJWZ 3M3YI 1X3WA 3KIHA 4A3EI 1W2BY 3HKZA 1ZB9A 1USPA 3G6E1 1N8R1 1YI21 3CCLZ 1DL6A 3J81f 2QR1B 3K7AI 3HOZI 2JIPA 2P3YA 4RV9A 3I4NI 5LL6f 3G6EZ 1JWHC 3PO3S 3FQMA 1YI2Z 1VQ71 2K3RA 4QTTA 2JIRA 3S1MI 3OW2Y 3CD61 3PO3I 3HOXI 3CC41 4MD7A 1RQFA 2E2HI 4E2YA 4E32A 5D1PA 2J6AA 3GTMS 1WJ2A 4A3MI 1KC82 1NJI2 4E31A 4E2ZA 3PO2I 4RS4A 4NBBA 1VQK1 1Y1VS 2VPYA 3CD6Z 2VUMI 2RPRA 3GTMI 3CC4Z 1JJ2Z 5A2Qb 3CXCZ 3NDJA 1Y8CA 4EWCA 1KQSZ 4BXXI 1Y1VI 2NAPA 4S1TA 4DGLA 2RIQA 4TNUA 1VQKZ 3S2DI 2Y0SA 4NBCA 2OTL1 1K732 1Q16A 2AKLA 1Z02A 1YJN1 3D2LA 2YADA 1YUAA 4NFRA 2GTIA 2WB1A 2AYDA 1FDOA 1S7MA 1KC81 3TDHB 4Y7NI 1NJI1 3CPWZ 2YU9I 3VB9A 2V3VA 2OTLZ 1NP6A 1YJNZ 1I50I 1VQM1 2NVQI 4DQYB 1SIWA 3BG0B 2R93I 3I551 3HOYI 3D9XA 2GTHA 1LQLA 2ZAEB 1VQMZ 4RVHA 2W03A 1Q862 2GU2A 3CCM1 1K731 1M902 1Q822 3I55Z 2JA6I 3CCU1 3CCQ1 2G2KA 1Z01A 2I3CA 4MH4A 2EGTA 5D1OB 3CCMZ 3TE5B 2R92I 1WZNA 4A3FI 3I07A 3NH4A 1QVFY 3CCUZ 4QTUA 3EEDA 3CCQZ 1TWAI 1X0TA 5T6BA 1QVGY 2JIMA 3CCJ1 3I561 3S15I 1Q861 3H3VJ 4A3DI 2JNYA 3GKQA 2O53A 1M901 2JR6A 3GCFA 1M1K2 3KIFA 3G711 3ESWA 1Q821 3FKII 5FLMI 3F3FC 2HU9A 2WAQA 1I6HI 3CCJZ 2E7ZA 3I56Z 3NFZA 5AN9F 1RLYA 2HF1A 4E33A 2RT9A 5IT9b 1VQ61 3S16I 2QRDB 4BBSI 3G71Z 2JMOA 5IP7I 3J80b 1QXFA 4MONA 2KI7B 4MD9A 3S14I 1FDIA 3S17I 1TWHI 3VMGA 2JUBA 2QKDA 2VPZA 3GTOI 4HH4A 1VQ6Z 4A3LI 3GTGI 4NOZA 1Z03A 1KD12 5C3EI 1N2FA 3GTQI 2LFUA 2H85A 1M1K1 1K8A2 2O4HA 1WIIA 3VMHA 2Q51A 3BG1B 1RO2A 3EERA 3G4SZ 2V8KA 3HOVI 3Q87A 2OOYB 2IZ4A 3FQQA 3IF8A 3NDIA 1QF8A 4NBHA 1VQ5Z 3VTNA 2R7ZI 4MD8A 4RVDA 3U50C 1R9TI 1K9M2 3CMA1 1JJ2Y 5A2Qf 1TFIA 2QEX1 1KD11 1L1OC 1Y1WI 1ML8A 2NVXI 1P9NA 1VLAA 2P28A 1RNIA 2JIOA 4MXUA 2NVTI 1K8A1 3CMAZ 3CCR1 3T4NB 5C44I 1W2BZ 2W04A 1QVFZ 2VPXA 1YIT1 1I3QI 4NBFA 2DE7A 2QEXZ 1VQ41 2R6MA 2DE6A 2V8JA 3CCE1 3LUSA 4MRIA 3CCRZ
chains in the Genus database with same CATH topology
2RBLA 2M48A 3CPWY 1VQP1 1YITZ 1VQ4Z 4NBAA 5CM2M 2JA8I 1K9M1 2E9HA 2QRCB 3CCEZ 2QLVB 4A3BI 5C4JI 4HGZA 3S1QI 3OW2Z 1VQPZ 3RZOI 4BY7I 1Q812 4NBEA 4RVGA 4BY1I 2JS4A 4E2XA 2OZKA 3CMEZ 4E2WA 3F3PC 1VQ91 2DE5A 2F4MA 3IX0A 3JAMb 3VMIA 4A93I 3GTJI 2F4OA 3S1NI 4RVFA 4AYBA 3S1RI 2E2JI 4NBGA 2JA7I 2PMZA 3CQZI 1WW9A 4A3CI 3P5JB 1VQ9Z 1ZB8A 5FLXb 2IZ3A 2V8IA 4NB9A 3MZLB 2PK7A 3G4S1 3D6WA 2Q4ZA 3RZDI 1Q811 4Y52I 1TWFI 2M6NA 4CL1A 1VQ7Z 4NB8A 4DK1A 1USPB 3CC21 3J7A4 1VQ51 2BJOA 3QWUA 3JAMf 3GTLI 1VQL1 3NH5A 3CC71 2PM9A 2LIYA 1RO0A 5T67A 5D1OA 5IT9f 1YJ91 3IFUA 1TWGI 5C4XI 3CC2Z 3J80f 1RO4A 3CCV1 1QYPA 5FLXf 1X3ZA 1WCMI 1ZH1A 1VQLZ 3CC7Z 4A3JI 2QREB 3CXCY 1Q7Y2 2NVYI 1YJ9Z 1SFOI 3GTKI 2JA5I 1VQN1 1KQSY 1YHQ1 1K83I 2QA41 3CCVZ 4E30A 1S721 3HOUI 1VQO1 3H0GI 2RHBA 4X6AI 5T64A 1NUIA 1VQ81 3GTPI 2K5RA 1VQNZ 1N8R2 4NH1C 3J81b 1YHQZ 2QA4Z 2VUGA 1QVGZ 1YUKA 4A3GI 1YIJ1 1S72Z 2OTJ1 3MZKB 3MONA 1VQOZ 3I4MI 3CCS1 4A3II 4A3KI 4HGYA 3S2HI 1YJW1 1VQ8Z 2OOXB 2E2II 4NBDA 1PFTA 1TWCI 1KRLA 1YIJZ 1Q7Y1 2VF1A 2KPIA 2OTJZ 4XX2A 3HOWI 3CME1 5IP9I 3M4OI 2B63I 4BBRI 3CCSZ 3CCL1 3NH8A 1YJWZ 3M3YI 1X3WA 3KIHA 4A3EI 1W2BY 3HKZA 1ZB9A 1USPA 3G6E1 1N8R1 1YI21 3CCLZ 1DL6A 3J81f 2QR1B 3K7AI 3HOZI 2P3YA 4RV9A 3I4NI 5LL6f 3G6EZ 1JWHC 3PO3S 3FQMA 1YI2Z 1VQ71 2K3RA 4QTTA 3S1MI 3OW2Y 3CD61 3PO3I 3HOXI 3CC41 4MD7A 1RQFA 2E2HI 4E2YA 4E32A 5D1PA 2J6AA 3GTMS 4A3MI 1KC82 1NJI2 4E31A 4E2ZA 3PO2I 4RS4A 4NBBA 1VQK1 1Y1VS 3CD6Z 2VUMI 2RPRA 3GTMI 3CC4Z 1JJ2Z 5A2Qb 3CXCZ 3NDJA 4EWCA 1KQSZ 4BXXI 1Y1VI 4S1TA 4DGLA 2RIQA 4TNUA 1VQKZ 3S2DI 2Y0SA 4NBCA 2OTL1 1K732 2AKLA 1Z02A 1YJN1 2YADA 1YUAA 4NFRA 2GTIA 2WB1A 1S7MA 1KC81 3TDHB 4Y7NI 1NJI1 3CPWZ 2YU9I 3VB9A 2OTLZ 1NP6A 1YJNZ 1I50I 1VQM1 2NVQI 4DQYB 3BG0B 2R93I 3I551 3HOYI 3D9XA 2GTHA 1LQLA 2ZAEB 1VQMZ 4RVHA 2W03A 1Q862 2GU2A 3CCM1 1K731 1M902 1Q822 3I55Z 2JA6I 3CCU1 3CCQ1 2G2KA 1Z01A 2I3CA 4MH4A 2EGTA 5D1OB 3CCMZ 3TE5B 2R92I 4A3FI 3I07A 3NH4A 1QVFY 3CCUZ 4QTUA 3EEDA 3CCQZ 1TWAI 1X0TA 5T6BA 1QVGY 3CCJ1 3I561 3S15I 1Q861 3H3VJ 4A3DI 2JNYA 3GKQA 2O53A 1M901 2JR6A 3GCFA 1M1K2 3KIFA 3G711 3ESWA 1Q821 3FKII 5FLMI 3F3FC 2HU9A 2WAQA 1I6HI 3CCJZ 3I56Z 3NFZA 5AN9F 1RLYA 2HF1A 4E33A 2RT9A 5IT9b 1VQ61 3S16I 2QRDB 4BBSI 3G71Z 2JMOA 5IP7I 3J80b 4MONA 2KI7B 4MD9A 3S14I 3S17I 1TWHI 3VMGA 2JUBA 2QKDA 3GTOI 4HH4A 1VQ6Z 4A3LI 3GTGI 4NOZA 1Z03A 1KD12 5C3EI 1N2FA 3GTQI 2LFUA 2H85A 1M1K1 1K8A2 2O4HA 1WIIA 3VMHA 2Q51A 3BG1B 1RO2A 3EERA 3G4SZ 2V8KA 3HOVI 3Q87A 2OOYB 2IZ4A 3FQQA 3IF8A 3NDIA 1QF8A 4NBHA 1VQ5Z 3VTNA 2R7ZI 4MD8A 4RVDA 3U50C 1R9TI 1K9M2 3CMA1 1JJ2Y 5A2Qf 1TFIA 2QEX1 1KD11 1L1OC 1Y1WI 1ML8A 2NVXI 1P9NA 1VLAA 2P28A 1RNIA 4MXUA 2NVTI 1K8A1 3CMAZ 3CCR1 3T4NB 5C44I 1W2BZ 2W04A 1QVFZ 1YIT1 1I3QI 4NBFA 2DE7A 2QEXZ 1VQ41 2R6MA 2DE6A 2V8JA 3CCE1 3LUSA 4MRIA 3CCRZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RBL A;  2NVY I;  3GTM I;  1SFO I;  3GTK I;  2JA5 I;  2JR6 A;  3GCF A;  3ESW A;  4NBA A;  3FKI I;  5CM2 M;  1K83 I;  2JA8 I;  5FLM I;  4BXX I;  1Y1V I;  1I6H I;  3HOU I;  4A3B I;  5C4J I;  3S1Q I;  3H0G I;  1RLY A;  4X6A I;  3S2D I;  2HF1 A;  1NUI A;  3GTP I;  2K5R A;  3S16 I;  4BBS I;  4NBC A;  3RZO I;  4BY7 I;  5IP7 I;  2AKL A;  4NBE A;  4A3G I;  1Y1V S;  4BY1 I;  1YUA A;  3S14 I;  3S17 I;  2JS4 A;  1TWH I;  3VMG A;  3I4M I;  4A3I I;  4A3K I;  3S2H I;  3GTO I;  4Y7N I;  2DE5 A;  2F4M A;  4A3L I;  2YU9 I;  3GTG I;  4NOZ A;  3VB9 A;  3VMI A;  5C3E I;  2E2I I;  4NBD A;  4A93 I;  1PFT A;  1TWC I;  2KPI A;  4XX2 A;  2F4O A;  1N2F A;  3GTJ I;  3HOW I;  1I50 I;  3GTQ I;  3S1N I;  5IP9 I;  3M4O I;  2B63 I;  4BBR I;  3S1R I;  2E2J I;  2NVQ I;  4NBG A;  2JA7 I;  3VMH A;  3CQZ I;  1WW9 A;  3M3Y I;  4A3C I;  1ZB8 A;  3EER A;  2R93 I;  1X3W A;  3HOV I;  3HOY I;  3Q87 A;  4A3E I;  1ZB9 A;  1USP A;  1LQL A;  4NB9 A;  2PK7 A;  1DL6 A;  4NBH A;  3D6W A;  3RZD I;  4Y52 I;  3K7A I;  3HOZ I;  1TWF I;  2P3Y A;  2R7Z I;  3U50 C;  4NB8 A;  2JA6 I;  1R9T I;  3I4N I;  4MH4 A;  3PO3 S;  1USP B;  1TFI A;  2BJO A;  1L1O C;  1Y1W I;  1ML8 A;  3GTL I;  2NVX I;  1VLA A;  2R92 I;  4A3F I;  4QTT A;  3I07 A;  3S1M I;  4QTU A;  2NVT I;  3PO3 I;  3HOX I;  5C44 I;  1TWA I;  1TWG I;  2E2H I;  5C4X I;  1I3Q I;  2J6A A;  2DE7 A;  4NBF A;  3GTM S;  1RO4 A;  4A3M I;  1QYP A;  1X3Z A;  1WCM I;  2DE6 A;  3PO2 I;  4A3J I;  3S15 I;  4NBB A;  3LUS A;  2JNY A;  3H3V J;  4A3D I;  2VUM I;  3GKQ A; 
#chains in the Genus database with same CATH topology
 2RBL A;  2M48 A;  2IV2 X;  3CPW Y;  1VQP 1;  1YIT Z;  1VQ4 Z;  4NBA A;  5CM2 M;  2JA8 I;  1K9M 1;  2E9H A;  2QRC B;  2JIQ A;  2QLV B;  3CCE Z;  4A3B I;  5C4J I;  4HGZ A;  3S1Q I;  2LEX A;  3OW2 Z;  1VQP Z;  3RZO I;  4BY7 I;  1Q81 2;  4NBE A;  4RVG A;  4BY1 I;  2JS4 A;  4E2X A;  2OZK A;  3CME Z;  2V45 A;  4E2W A;  3F3P C;  1VQ9 1;  2DE5 A;  2F4M A;  3IR7 A;  3IX0 A;  3JAM b;  3VMI A;  4A93 I;  3GTJ I;  2F4O A;  3S1N I;  4RVF A;  4AYB A;  3S1R I;  2E2J I;  4NBG A;  2JA7 I;  2PMZ A;  3CQZ I;  1WW9 A;  4A3C I;  3P5J B;  1VQ9 Z;  1ZB8 A;  5FLX b;  2IZ3 A;  2V8I A;  4NB9 A;  1AA6 A;  3MZL B;  2PK7 A;  3G4S 1;  3D6W A;  2Q4Z A;  3RZD I;  1Q81 1;  4Y52 I;  1TWF I;  2M6N A;  4CL1 A;  1VQ7 Z;  4NB8 A;  4DK1 A;  1USP B;  3CC2 1;  3J7A 4;  1VQ5 1;  2BJO A;  2VPW A;  3QWU A;  3JAM f;  3GTL I;  1VQL 1;  3NH5 A;  3CC7 1;  2PM9 A;  2LIY A;  1RO0 A;  5T67 A;  5D1O A;  5IT9 f;  1YJ9 1;  3IFU A;  1TWG I;  5C4X I;  3CC2 Z;  3J80 f;  1RO4 A;  3CCV 1;  1QYP A;  5FLX f;  1X3Z A;  1WCM I;  1ZH1 A;  1VQL Z;  3CC7 Z;  4A3J I;  2QRE B;  3CXC Y;  1Q7Y 2;  2NVY I;  1YJ9 Z;  1SFO I;  3GTK I;  2JA5 I;  1VQN 1;  1KQS Y;  1YHQ 1;  1K83 I;  2QA4 1;  3CCV Z;  4E30 A;  1S72 1;  3HOU I;  1VQO 1;  3H0G I;  2RHB A;  4X6A I;  5T64 A;  1NUI A;  1VQ8 1;  3GTP I;  2K5R A;  1VQN Z;  1N8R 2;  4NH1 C;  3J81 b;  1YHQ Z;  2QA4 Z;  2VUG A;  1QVG Z;  1YUK A;  4A3G I;  1YIJ 1;  1S72 Z;  2OTJ 1;  3MZK B;  3MON A;  1VQO Z;  3I4M I;  3CCS 1;  4A3I I;  4A3K I;  4HGY A;  3S2H I;  1YJW 1;  1VQ8 Z;  2OOX B;  2E2I I;  4NBD A;  1PFT A;  1TWC I;  1KRL A;  1YIJ Z;  1Q7Y 1;  2VF1 A;  2KPI A;  2OTJ Z;  4XX2 A;  3HOW I;  3CME 1;  5IP9 I;  3M4O I;  2B63 I;  4BBR I;  3CCS Z;  3CCL 1;  3NH8 A;  1YJW Z;  3M3Y I;  1X3W A;  3KIH A;  4A3E I;  1W2B Y;  3HKZ A;  1ZB9 A;  1USP A;  3G6E 1;  1N8R 1;  1YI2 1;  3CCL Z;  1DL6 A;  3J81 f;  2QR1 B;  3K7A I;  3HOZ I;  2JIP A;  2P3Y A;  4RV9 A;  3I4N I;  5LL6 f;  3G6E Z;  1JWH C;  3PO3 S;  3FQM A;  1YI2 Z;  1VQ7 1;  2K3R A;  4QTT A;  2JIR A;  3S1M I;  3OW2 Y;  3CD6 1;  3PO3 I;  3HOX I;  3CC4 1;  4MD7 A;  1RQF A;  2E2H I;  4E2Y A;  4E32 A;  5D1P A;  2J6A A;  3GTM S;  1WJ2 A;  4A3M I;  1KC8 2;  1NJI 2;  4E31 A;  4E2Z A;  3PO2 I;  4RS4 A;  4NBB A;  1VQK 1;  1Y1V S;  2VPY A;  3CD6 Z;  2VUM I;  2RPR A;  3GTM I;  3CC4 Z;  1JJ2 Z;  5A2Q b;  3CXC Z;  3NDJ A;  1Y8C A;  4EWC A;  1KQS Z;  4BXX I;  1Y1V I;  2NAP A;  4S1T A;  4DGL A;  2RIQ A;  4TNU A;  1VQK Z;  3S2D I;  2Y0S A;  4NBC A;  2OTL 1;  1K73 2;  1Q16 A;  2AKL A;  1Z02 A;  1YJN 1;  3D2L A;  2YAD A;  1YUA A;  4NFR A;  2GTI A;  2WB1 A;  2AYD A;  1FDO A;  1S7M A;  1KC8 1;  3TDH B;  4Y7N I;  1NJI 1;  3CPW Z;  2YU9 I;  3VB9 A;  2V3V A;  2OTL Z;  1NP6 A;  1YJN Z;  1I50 I;  1VQM 1;  2NVQ I;  4DQY B;  1SIW A;  3BG0 B;  2R93 I;  3I55 1;  3HOY I;  3D9X A;  2GTH A;  1LQL A;  2ZAE B;  1VQM Z;  4RVH A;  2W03 A;  1Q86 2;  2GU2 A;  3CCM 1;  1K73 1;  1M90 2;  1Q82 2;  3I55 Z;  2JA6 I;  3CCU 1;  3CCQ 1;  2G2K A;  1Z01 A;  2I3C A;  4MH4 A;  2EGT A;  5D1O B;  3CCM Z;  3TE5 B;  2R92 I;  1WZN A;  4A3F I;  3I07 A;  3NH4 A;  1QVF Y;  3CCU Z;  4QTU A;  3EED A;  3CCQ Z;  1TWA I;  1X0T A;  5T6B A;  1QVG Y;  2JIM A;  3CCJ 1;  3I56 1;  3S15 I;  1Q86 1;  3H3V J;  4A3D I;  2JNY A;  3GKQ A;  2O53 A;  1M90 1;  2JR6 A;  3GCF A;  1M1K 2;  3KIF A;  3G71 1;  3ESW A;  1Q82 1;  3FKI I;  5FLM I;  3F3F C;  2HU9 A;  2WAQ A;  1I6H I;  3CCJ Z;  2E7Z A;  3I56 Z;  3NFZ A;  5AN9 F;  1RLY A;  2HF1 A;  4E33 A;  2RT9 A;  5IT9 b;  1VQ6 1;  3S16 I;  2QRD B;  4BBS I;  3G71 Z;  2JMO A;  5IP7 I;  3J80 b;  1QXF A;  4MON A;  2KI7 B;  4MD9 A;  3S14 I;  1FDI A;  3S17 I;  1TWH I;  3VMG A;  2JUB A;  2QKD A;  2VPZ A;  3GTO I;  4HH4 A;  1VQ6 Z;  4A3L I;  3GTG I;  4NOZ A;  1Z03 A;  1KD1 2;  5C3E I;  1N2F A;  3GTQ I;  2LFU A;  2H85 A;  1M1K 1;  1K8A 2;  2O4H A;  1WII A;  3VMH A;  2Q51 A;  3BG1 B;  1RO2 A;  3EER A;  3G4S Z;  2V8K A;  3HOV I;  3Q87 A;  2OOY B;  2IZ4 A;  3FQQ A;  3IF8 A;  3NDI A;  1QF8 A;  4NBH A;  1VQ5 Z;  3VTN A;  2R7Z I;  4MD8 A;  4RVD A;  3U50 C;  1R9T I;  1K9M 2;  3CMA 1;  1JJ2 Y;  5A2Q f;  1TFI A;  2QEX 1;  1KD1 1;  1L1O C;  1Y1W I;  1ML8 A;  2NVX I;  1P9N A;  1VLA A;  2P28 A;  1RNI A;  2JIO A;  4MXU A;  2NVT I;  1K8A 1;  3CMA Z;  3CCR 1;  3T4N B;  5C44 I;  1W2B Z;  2W04 A;  1QVF Z;  2VPX A;  1YIT 1;  1I3Q I;  4NBF A;  2DE7 A;  2QEX Z;  1VQ4 1;  2R6M A;  2DE6 A;  2V8J A;  3CCE 1;  3LUS A;  4MRI A;  3CCR Z; 
#chains in the Genus database with same CATH homology
 2RBL A;  2M48 A;  3CPW Y;  1VQP 1;  1YIT Z;  1VQ4 Z;  4NBA A;  5CM2 M;  2JA8 I;  1K9M 1;  2E9H A;  2QRC B;  3CCE Z;  2QLV B;  4A3B I;  5C4J I;  4HGZ A;  3S1Q I;  3OW2 Z;  1VQP Z;  3RZO I;  4BY7 I;  1Q81 2;  4NBE A;  4RVG A;  4BY1 I;  2JS4 A;  4E2X A;  2OZK A;  3CME Z;  4E2W A;  3F3P C;  1VQ9 1;  2DE5 A;  2F4M A;  3IX0 A;  3JAM b;  3VMI A;  4A93 I;  3GTJ I;  2F4O A;  3S1N I;  4RVF A;  4AYB A;  3S1R I;  2E2J I;  4NBG A;  2JA7 I;  2PMZ A;  3CQZ I;  1WW9 A;  4A3C I;  3P5J B;  1VQ9 Z;  1ZB8 A;  5FLX b;  2IZ3 A;  2V8I A;  4NB9 A;  3MZL B;  2PK7 A;  3G4S 1;  3D6W A;  2Q4Z A;  3RZD I;  1Q81 1;  4Y52 I;  1TWF I;  2M6N A;  4CL1 A;  1VQ7 Z;  4NB8 A;  4DK1 A;  1USP B;  3CC2 1;  3J7A 4;  1VQ5 1;  2BJO A;  3QWU A;  3JAM f;  3GTL I;  1VQL 1;  3NH5 A;  3CC7 1;  2PM9 A;  2LIY A;  1RO0 A;  5T67 A;  5D1O A;  5IT9 f;  1YJ9 1;  3IFU A;  1TWG I;  5C4X I;  3CC2 Z;  3J80 f;  1RO4 A;  3CCV 1;  1QYP A;  5FLX f;  1X3Z A;  1WCM I;  1ZH1 A;  1VQL Z;  3CC7 Z;  4A3J I;  2QRE B;  3CXC Y;  1Q7Y 2;  2NVY I;  1YJ9 Z;  1SFO I;  3GTK I;  2JA5 I;  1VQN 1;  1KQS Y;  1YHQ 1;  1K83 I;  2QA4 1;  3CCV Z;  4E30 A;  1S72 1;  3HOU I;  1VQO 1;  3H0G I;  2RHB A;  4X6A I;  5T64 A;  1NUI A;  1VQ8 1;  3GTP I;  2K5R A;  1VQN Z;  1N8R 2;  4NH1 C;  3J81 b;  1YHQ Z;  2QA4 Z;  2VUG A;  1QVG Z;  1YUK A;  4A3G I;  1YIJ 1;  1S72 Z;  2OTJ 1;  3MZK B;  3MON A;  1VQO Z;  3I4M I;  3CCS 1;  4A3I I;  4A3K I;  4HGY A;  3S2H I;  1YJW 1;  1VQ8 Z;  2OOX B;  2E2I I;  4NBD A;  1PFT A;  1TWC I;  1KRL A;  1YIJ Z;  1Q7Y 1;  2VF1 A;  2KPI A;  2OTJ Z;  4XX2 A;  3HOW I;  3CME 1;  5IP9 I;  3M4O I;  2B63 I;  4BBR I;  3CCS Z;  3CCL 1;  3NH8 A;  1YJW Z;  3M3Y I;  1X3W A;  3KIH A;  4A3E I;  1W2B Y;  3HKZ A;  1ZB9 A;  1USP A;  3G6E 1;  1N8R 1;  1YI2 1;  3CCL Z;  1DL6 A;  3J81 f;  2QR1 B;  3K7A I;  3HOZ I;  2P3Y A;  4RV9 A;  3I4N I;  5LL6 f;  3G6E Z;  1JWH C;  3PO3 S;  3FQM A;  1YI2 Z;  1VQ7 1;  2K3R A;  4QTT A;  3S1M I;  3OW2 Y;  3CD6 1;  3PO3 I;  3HOX I;  3CC4 1;  4MD7 A;  1RQF A;  2E2H I;  4E2Y A;  4E32 A;  5D1P A;  2J6A A;  3GTM S;  4A3M I;  1KC8 2;  1NJI 2;  4E31 A;  4E2Z A;  3PO2 I;  4RS4 A;  4NBB A;  1VQK 1;  1Y1V S;  3CD6 Z;  2VUM I;  2RPR A;  3GTM I;  3CC4 Z;  1JJ2 Z;  5A2Q b;  3CXC Z;  3NDJ A;  4EWC A;  1KQS Z;  4BXX I;  1Y1V I;  4S1T A;  4DGL A;  2RIQ A;  4TNU A;  1VQK Z;  3S2D I;  2Y0S A;  4NBC A;  2OTL 1;  1K73 2;  2AKL A;  1Z02 A;  1YJN 1;  2YAD A;  1YUA A;  4NFR A;  2GTI A;  2WB1 A;  1S7M A;  1KC8 1;  3TDH B;  4Y7N I;  1NJI 1;  3CPW Z;  2YU9 I;  3VB9 A;  2OTL Z;  1NP6 A;  1YJN Z;  1I50 I;  1VQM 1;  2NVQ I;  4DQY B;  3BG0 B;  2R93 I;  3I55 1;  3HOY I;  3D9X A;  2GTH A;  1LQL A;  2ZAE B;  1VQM Z;  4RVH A;  2W03 A;  1Q86 2;  2GU2 A;  3CCM 1;  1K73 1;  1M90 2;  1Q82 2;  3I55 Z;  2JA6 I;  3CCU 1;  3CCQ 1;  2G2K A;  1Z01 A;  2I3C A;  4MH4 A;  2EGT A;  5D1O B;  3CCM Z;  3TE5 B;  2R92 I;  4A3F I;  3I07 A;  3NH4 A;  1QVF Y;  3CCU Z;  4QTU A;  3EED A;  3CCQ Z;  1TWA I;  1X0T A;  5T6B A;  1QVG Y;  3CCJ 1;  3I56 1;  3S15 I;  1Q86 1;  3H3V J;  4A3D I;  2JNY A;  3GKQ A;  2O53 A;  1M90 1;  2JR6 A;  3GCF A;  1M1K 2;  3KIF A;  3G71 1;  3ESW A;  1Q82 1;  3FKI I;  5FLM I;  3F3F C;  2HU9 A;  2WAQ A;  1I6H I;  3CCJ Z;  3I56 Z;  3NFZ A;  5AN9 F;  1RLY A;  2HF1 A;  4E33 A;  2RT9 A;  5IT9 b;  1VQ6 1;  3S16 I;  2QRD B;  4BBS I;  3G71 Z;  2JMO A;  5IP7 I;  3J80 b;  4MON A;  2KI7 B;  4MD9 A;  3S14 I;  3S17 I;  1TWH I;  3VMG A;  2JUB A;  2QKD A;  3GTO I;  4HH4 A;  1VQ6 Z;  4A3L I;  3GTG I;  4NOZ A;  1Z03 A;  1KD1 2;  5C3E I;  1N2F A;  3GTQ I;  2LFU A;  2H85 A;  1M1K 1;  1K8A 2;  2O4H A;  1WII A;  3VMH A;  2Q51 A;  3BG1 B;  1RO2 A;  3EER A;  3G4S Z;  2V8K A;  3HOV I;  3Q87 A;  2OOY B;  2IZ4 A;  3FQQ A;  3IF8 A;  3NDI A;  1QF8 A;  4NBH A;  1VQ5 Z;  3VTN A;  2R7Z I;  4MD8 A;  4RVD A;  3U50 C;  1R9T I;  1K9M 2;  3CMA 1;  1JJ2 Y;  5A2Q f;  1TFI A;  2QEX 1;  1KD1 1;  1L1O C;  1Y1W I;  1ML8 A;  2NVX I;  1P9N A;  1VLA A;  2P28 A;  1RNI A;  4MXU A;  2NVT I;  1K8A 1;  3CMA Z;  3CCR 1;  3T4N B;  5C44 I;  1W2B Z;  2W04 A;  1QVF Z;  1YIT 1;  1I3Q I;  4NBF A;  2DE7 A;  2QEX Z;  1VQ4 1;  2R6M A;  2DE6 A;  2V8J A;  3CCE 1;  3LUS A;  4MRI A;  3CCR Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...