2QA41

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qa4100
3CCR1 3CCS1 1YJW1 3G6EZ 3CXCY 1K8A1 2QA4Z 1YI2Z 1M1K1 1K9M2 2OTL1 1VQ41 3CCEZ 1QVFY 1JJ2Z 3CCRZ 3CC71 3I55Z 1Q7Y2 1YJWZ 3G4SZ 1N8R2 2OTLZ 1YHQZ 3CD6Z 3CXCZ 1VQ51 1YIT1 3CMA1 1Q861 1QVFZ 3G71Z 2QA41 1YI21 3CCE1 2QEX1 3CME1 1K731 3I551 1NJI1 1Q811 1M902 3OW2Y 3G4S1 1KQSY 1YHQ1 3CD61 2QEXZ 3CMEZ 1KC82 3CCVZ 1Q822 3G711 1K8A2 3OW2Z 1M1K2 1VQ6Z 3CC41 1VQMZ 1K9M1 1KQSZ 1VQ7Z 1KD11 3CC4Z 3CCLZ 1VQOZ 3CCQZ 3CCV1 3CCU1 3I56Z 1Q862 3CCJ1 3CC2Z 3CPWY 2OTJZ 1VQ61 3CCUZ 1VQM1 1VQ8Z 1VQKZ 1K732 3CCJZ 1Q812 1YJ9Z 1VQ71 3CCL1 3CPWZ 1VQO1 1VQN1 3CCQ1 1S721 1Q7Y1 3I561 3CC21 1N8R1 1W2BY 1VQL1 1VQP1 1VQNZ 1S72Z 2OTJ1 1VQ9Z 1VQ81 1VQK1 3CCSZ 1QVGY 1YJ91 1VQLZ 1VQPZ 1YJN1 1KD12 1VQ4Z 3CCM1 1W2BZ 3CC7Z 1NJI2 1YIJ1 1M901 1YJNZ 3G6E1 1QVGZ 1JJ2Y 3CCMZ 1VQ5Z 1YITZ 1KC81 1VQ91 1YIJZ 3CMAZ 1Q821
chains in the Genus database with same CATH superfamily
2LFUA 2JIMA 3S1NI 3P5JB 1K8A1 2O4HA 3VMIA 2LIYA 3J80f 2YADA 1WZNA 1RQFA 5FLXb 3JAMb 1YHQZ 4E2ZA 1X3WA 5A2Qb 4HGZA 2KI7B 2QRDB 1YI21 5T6BA 2VUMI 2V8JA 3OW2Y 2NVYI 3G4S1 1WCMI 1QXFA 3FQMA 3CD61 1KC82 4EWCA 2JIRA 2P28A 2F4OA 4A3EI 4S1TA 1Q822 4A3MI 3MONA 3ESWA 3KIHA 4E31A 4DK1A 3OW2Z 3I07A 3CC41 3BG0B 4NB9A 2W04A 4E30A 1KD11 3CC4Z 3CCLZ 4A3JI 3S1QI 3GKQA 1VQOZ 3CCQZ 2K3RA 1Z03A 3NFZA 4RVDA 3S1RI 2GTHA 3GTMI 2RIQA 4RS4A 5D1OA 3HOVI 4NB8A 2OTJZ 3IFUA 4MD8A 1VQM1 1K732 4A93I 4NBFA 2OOYB 2QKDA 5D1OB 4A3GI 4BBRI 4RVHA 5T67A 1VQN1 1L1OC 1S721 3GTQI 1Q16A 4MONA 1TWFI 3J80b 1W2BY 1VQP1 1VQNZ 1S72Z 1NUIA 3EERA 2QR1B 4MD7A 2JA8I 2KPIA 3K7AI 2R7ZI 5LL6f 1QVGY 3S1MI 1PFTA 1VQPZ 2K5RA 3J81f 1VQ4Z 2W03A 3PO2I 1W2BZ 3S17I 4MD9A 1WW9A 1YIJ1 1N2FA 1WJ2A 3TDHB 2E9HA 1QVGZ 4E2XA 3M4OI 1TFIA 1KC81 1YIJZ 2J6AA 3CMAZ 3H3VJ 1Q821 3CCS1 1X0TA 2Q51A 3S14I 3CXCY 5C3EI 1QVFY 4NBGA 1Y1VI 4QTTA 3EEDA 1Y1WI 2GU2A 3CXCZ 1YIT1 3CQZI 4BBSI 1QVFZ 4RVGA 2Y0SA 1SIWA 4AYBA 3QWUA 5FLMI 2R93I 3H0GI 2WAQA 3CME1 1AA6A 1K731 3NH8A 5IT9f 3IX0A 1M902 1KQSY 2DE6A 1YHQ1 3CMEZ 2V45A 3CCVZ 3HOWI 3NH5A 4BXXI 2NVXI 1SFOI 2JUBA 1VQ6Z 3GTPI 3PO3I 1KQSZ 1Y8CA 1VQ7Z 3NDIA 2NAPA 3J81b 3CCU1 3I56Z 3VB9A 3CCJ1 3CC2Z 2ZAEB 2B63I 3CCUZ 1RO2A 2DE5A 3CCJZ 1Q812 1Z01A 3KIFA 1YJ9Z 2JA6I 2JMOA 3CCL1 1VQO1 2QREB 3CCQ1 2DE7A 3GTGI 4A3KI 4DGLA 2OTJ1 1WIIA 2E2II 1USPA 5T64A 2NVTI 3T4NB 3CCM1 2I3CA 1USPB 2HF1A 3CC7Z 3MZLB 4HGYA 2WB1A 1M901 5IT9b 1TWGI 3CCMZ 3BG1B 1VQ5Z 4A3FI 4NBAA 3U50C 5C44I 2Q4ZA 2JA7I 2AYDA 3CCR1 1YJW1 3GTMS 2IZ4A 2QA4Z 1VQ41 3CCEZ 1QYPA 3CCRZ 1Q7Y2 3I55Z 1YJWZ 4E2WA 1N8R2 3S2DI 2JIOA 4NBEA 2H85A 2OZKA 3CMA1 1I6HI 1RO4A 1NP6A 1YUKA 3G71Z 4BY7I 3LUSA 1NJI1 1Q811 1YUAA 1ZH1A 2JS4A 1RNIA 1R9TI 4A3LI 3HKZA 2M6NA 3FQQA 2RPRA 4MRIA 3VMGA 4RV9A 4E33A 2OOXB 2E2HI 1K83I 4TNUA 2JR6A 3F3PC 1M1K2 2V3VA 1K9M1 2VUGA 2P3YA 1ML8A 1ZB8A 3MZKB 3RZDI 3D2LA 4A3BI 2JNYA 1JWHC 3D6WA 1RLYA 2VF1A 3CCV1 3S16I 1Q862 1VQ61 2EGTA 1VQ8Z 1VQKZ 1P9NA 2RHBA 2PK7A 1VQ71 4A3DI 4MH4A 2RBLA 2E2JI 1Q7Y1 3I561 4NOZA 5IP7I 2BJOA 4NH1C 3CC21 1N8R1 1VLAA 1TWHI 4NBHA 1VQ9Z 3HOYI 4NBDA 1YJ91 1YJN1 4BY1I 3PO3S 2VPWA 1NJI2 2LEXA 2VPZA 1YJNZ 4MXUA 1RO0A 3G6E1 1JJ2Y 4NBBA 5AN9F 3VMHA 3G6EZ 2IZ3A 1YI2Z 1M1K1 1K9M2 2OTL1 5D1PA 2QLVB 4E32A 1JJ2Z 3CC71 1FDIA 1DL6A 3G4SZ 2OTLZ 1I3QI 3CD6Z 4QTUA 1VQ51 2QRCB 2AKLA 4A3II 1Q861 3IR7A 2IV2X 1ZB9A 2QA41 3CCE1 2QEX1 4X6AI 3M3YI 3I551 4E2YA 1TWAI 2R6MA 2QEXZ 2G2KA 4Y52I 1TWCI 3S15I 4Y7NI 3D9XA 3G711 1K8A2 2GTIA 2NVQI 4RVFA 2PM9A 1VQMZ 1KRLA 3J7A4 5C4JI 3Q87A 4HH4A 5C4XI 3TE5B 5FLXf 3JAMf 3NDJA 3VTNA 4DQYB 5A2Qf 2JA5I 2V8IA 1I50I 2RT9A 3RZOI 3CPWY 1FDOA 2E7ZA 2F4MA 5IP9I 2VPXA 3GTKI 2O53A 3NH4A 2R92I 3CPWZ 4XX2A 4NFRA 1S7MA 3IF8A 1Z02A 4NBCA 1VQL1 3HOZI 1X3ZA 2JIPA 2VPYA 1VQ81 1VQK1 3FKII 3GTLI 3CCSZ 3F3FC 1Y1VS 3GCFA 4CL1A 1VQLZ 2JIQA 1KD12 2V8KA 3I4NI 3GTJI 3I4MI 4A3CI 3HOXI 5CM2M 2YU9I 3HOUI 2M48A 3S2HI 1QF8A 3GTOI 2PMZA 1YITZ 1LQLA 1VQ91 2HU9A
chains in the Genus database with same CATH topology
2LFUA 3S1NI 3P5JB 1K8A1 2O4HA 3VMIA 2LIYA 3J80f 2YADA 1RQFA 5FLXb 3JAMb 1YHQZ 4E2ZA 1X3WA 5A2Qb 4HGZA 2KI7B 2QRDB 1YI21 5T6BA 2VUMI 2V8JA 3OW2Y 2NVYI 3G4S1 1WCMI 3FQMA 3CD61 1KC82 4EWCA 2P28A 2F4OA 4A3EI 4S1TA 1Q822 4A3MI 3MONA 3ESWA 3KIHA 4E31A 4DK1A 3OW2Z 3I07A 3CC41 3BG0B 4NB9A 2W04A 4E30A 1KD11 3CC4Z 3CCLZ 4A3JI 3S1QI 3GKQA 1VQOZ 3CCQZ 2K3RA 1Z03A 3NFZA 4RVDA 3S1RI 2GTHA 3GTMI 2RIQA 4RS4A 5D1OA 3HOVI 4NB8A 2OTJZ 3IFUA 4MD8A 1VQM1 1K732 4A93I 4NBFA 2OOYB 2QKDA 5D1OB 4A3GI 4BBRI 4RVHA 5T67A 1VQN1 1L1OC 1S721 3GTQI 4MONA 1TWFI 3J80b 1W2BY 1VQP1 1VQNZ 1S72Z 1NUIA 3EERA 2QR1B 4MD7A 2JA8I 2KPIA 3K7AI 2R7ZI 5LL6f 1QVGY 3S1MI 1PFTA 1VQPZ 2K5RA 3J81f 1VQ4Z 2W03A 3PO2I 1W2BZ 3S17I 4MD9A 1WW9A 1YIJ1 1N2FA 3TDHB 2E9HA 1QVGZ 4E2XA 3M4OI 1TFIA 1KC81 1YIJZ 2J6AA 3CMAZ 3H3VJ 1Q821 3CCS1 1X0TA 2Q51A 3S14I 3CXCY 5C3EI 1QVFY 4NBGA 1Y1VI 4QTTA 3EEDA 1Y1WI 2GU2A 3CXCZ 1YIT1 3CQZI 4BBSI 1QVFZ 4RVGA 2Y0SA 4AYBA 3QWUA 5FLMI 2R93I 3H0GI 2WAQA 3CME1 1K731 3NH8A 5IT9f 3IX0A 1M902 1KQSY 2DE6A 1YHQ1 3CMEZ 3CCVZ 3HOWI 3NH5A 4BXXI 2NVXI 1SFOI 2JUBA 1VQ6Z 3GTPI 3PO3I 1KQSZ 1VQ7Z 3NDIA 3J81b 3CCU1 3I56Z 3VB9A 3CCJ1 3CC2Z 2ZAEB 2B63I 3CCUZ 1RO2A 2DE5A 3CCJZ 1Q812 1Z01A 3KIFA 1YJ9Z 2JA6I 2JMOA 3CCL1 1VQO1 2QREB 3CCQ1 2DE7A 3GTGI 4A3KI 4DGLA 2OTJ1 1WIIA 2E2II 1USPA 5T64A 2NVTI 3T4NB 3CCM1 2I3CA 1USPB 2HF1A 3CC7Z 3MZLB 4HGYA 2WB1A 1M901 5IT9b 1TWGI 3CCMZ 3BG1B 1VQ5Z 4A3FI 4NBAA 3U50C 5C44I 2Q4ZA 2JA7I 3CCR1 1YJW1 3GTMS 2IZ4A 2QA4Z 1VQ41 3CCEZ 1QYPA 3CCRZ 1Q7Y2 3I55Z 1YJWZ 4E2WA 1N8R2 3S2DI 4NBEA 2H85A 2OZKA 3CMA1 1I6HI 1RO4A 1NP6A 1YUKA 3G71Z 4BY7I 3LUSA 1NJI1 1Q811 1YUAA 1ZH1A 2JS4A 1RNIA 1R9TI 4A3LI 3HKZA 2M6NA 3FQQA 2RPRA 4MRIA 3VMGA 4RV9A 4E33A 2OOXB 2E2HI 1K83I 4TNUA 2JR6A 3F3PC 1M1K2 1K9M1 2VUGA 2P3YA 1ML8A 1ZB8A 3MZKB 3RZDI 4A3BI 2JNYA 1JWHC 3D6WA 1RLYA 2VF1A 3CCV1 3S16I 1Q862 1VQ61 2EGTA 1VQ8Z 1VQKZ 1P9NA 2RHBA 2PK7A 1VQ71 4A3DI 4MH4A 2RBLA 2E2JI 1Q7Y1 3I561 4NOZA 5IP7I 2BJOA 4NH1C 3CC21 1N8R1 1VLAA 1TWHI 4NBHA 1VQ9Z 3HOYI 4NBDA 1YJ91 1YJN1 4BY1I 3PO3S 1NJI2 1YJNZ 4MXUA 1RO0A 3G6E1 1JJ2Y 4NBBA 5AN9F 3VMHA 3G6EZ 2IZ3A 1YI2Z 1M1K1 1K9M2 2OTL1 5D1PA 2QLVB 4E32A 1JJ2Z 3CC71 1DL6A 3G4SZ 2OTLZ 1I3QI 3CD6Z 4QTUA 1VQ51 2QRCB 2AKLA 4A3II 1Q861 1ZB9A 2QA41 3CCE1 2QEX1 4X6AI 3M3YI 3I551 4E2YA 1TWAI 2R6MA 2QEXZ 2G2KA 4Y52I 1TWCI 3S15I 4Y7NI 3D9XA 3G711 1K8A2 2GTIA 2NVQI 4RVFA 2PM9A 1VQMZ 1KRLA 3J7A4 5C4JI 3Q87A 4HH4A 5C4XI 3TE5B 5FLXf 3JAMf 3NDJA 3VTNA 4DQYB 5A2Qf 2JA5I 2V8IA 1I50I 2RT9A 3RZOI 3CPWY 2F4MA 5IP9I 3GTKI 2O53A 3NH4A 2R92I 3CPWZ 4XX2A 4NFRA 1S7MA 3IF8A 1Z02A 4NBCA 1VQL1 3HOZI 1X3ZA 1VQ81 1VQK1 3FKII 3GTLI 3CCSZ 3F3FC 1Y1VS 3GCFA 4CL1A 1VQLZ 1KD12 2V8KA 3I4NI 3GTJI 3I4MI 4A3CI 3HOXI 5CM2M 2YU9I 3HOUI 2M48A 3S2HI 1QF8A 3GTOI 2PMZA 1YITZ 1LQLA 1VQ91 2HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR 1;  3CCS 1;  1YJW 1;  3G6E Z;  3CXC Y;  1K8A 1;  2QA4 Z;  1YI2 Z;  1M1K 1;  1K9M 2;  2OTL 1;  1VQ4 1;  3CCE Z;  1QVF Y;  1JJ2 Z;  3CCR Z;  3CC7 1;  3I55 Z;  1Q7Y 2;  1YJW Z;  3G4S Z;  1N8R 2;  2OTL Z;  1YHQ Z;  3CD6 Z;  3CXC Z;  1VQ5 1;  1YIT 1;  3CMA 1;  1Q86 1;  1QVF Z;  3G71 Z;  2QA4 1;  1YI2 1;  3CCE 1;  2QEX 1;  3CME 1;  1K73 1;  3I55 1;  1NJI 1;  1Q81 1;  1M90 2;  3OW2 Y;  3G4S 1;  1KQS Y;  1YHQ 1;  3CD6 1;  2QEX Z;  3CME Z;  1KC8 2;  3CCV Z;  1Q82 2;  3G71 1;  1K8A 2;  3OW2 Z;  1M1K 2;  1VQ6 Z;  3CC4 1;  1VQM Z;  1K9M 1;  1KQS Z;  1VQ7 Z;  1KD1 1;  3CC4 Z;  3CCL Z;  1VQO Z;  3CCQ Z;  3CCV 1;  3CCU 1;  3I56 Z;  1Q86 2;  3CCJ 1;  3CC2 Z;  3CPW Y;  2OTJ Z;  1VQ6 1;  3CCU Z;  1VQM 1;  1VQ8 Z;  1VQK Z;  1K73 2;  3CCJ Z;  1Q81 2;  1YJ9 Z;  1VQ7 1;  3CCL 1;  3CPW Z;  1VQO 1;  1VQN 1;  3CCQ 1;  1S72 1;  1Q7Y 1;  3I56 1;  3CC2 1;  1N8R 1;  1W2B Y;  1VQL 1;  1VQP 1;  1VQN Z;  1S72 Z;  2OTJ 1;  1VQ9 Z;  1VQ8 1;  1VQK 1;  3CCS Z;  1QVG Y;  1YJ9 1;  1VQL Z;  1VQP Z;  1YJN 1;  1KD1 2;  1VQ4 Z;  3CCM 1;  1W2B Z;  3CC7 Z;  1NJI 2;  1YIJ 1;  1M90 1;  1YJN Z;  3G6E 1;  1QVG Z;  1JJ2 Y;  3CCM Z;  1VQ5 Z;  1YIT Z;  1KC8 1;  1VQ9 1;  1YIJ Z;  3CMA Z;  1Q82 1; 
#chains in the Genus database with same CATH topology
 2LFU A;  2JIM A;  3S1N I;  3P5J B;  1K8A 1;  2O4H A;  3VMI A;  2LIY A;  3J80 f;  2YAD A;  1WZN A;  1RQF A;  5FLX b;  3JAM b;  1YHQ Z;  4E2Z A;  1X3W A;  5A2Q b;  4HGZ A;  2KI7 B;  2QRD B;  1YI2 1;  5T6B A;  2VUM I;  2V8J A;  3OW2 Y;  2NVY I;  3G4S 1;  1WCM I;  1QXF A;  3FQM A;  3CD6 1;  1KC8 2;  4EWC A;  2JIR A;  2P28 A;  2F4O A;  4A3E I;  4S1T A;  1Q82 2;  4A3M I;  3MON A;  3ESW A;  3KIH A;  4E31 A;  4DK1 A;  3OW2 Z;  3I07 A;  3CC4 1;  3BG0 B;  4NB9 A;  2W04 A;  4E30 A;  1KD1 1;  3CC4 Z;  3CCL Z;  4A3J I;  3S1Q I;  3GKQ A;  1VQO Z;  3CCQ Z;  2K3R A;  1Z03 A;  3NFZ A;  4RVD A;  3S1R I;  2GTH A;  3GTM I;  2RIQ A;  4RS4 A;  5D1O A;  3HOV I;  4NB8 A;  2OTJ Z;  3IFU A;  4MD8 A;  1VQM 1;  1K73 2;  4A93 I;  4NBF A;  2OOY B;  2QKD A;  5D1O B;  4A3G I;  4BBR I;  4RVH A;  5T67 A;  1VQN 1;  1L1O C;  1S72 1;  3GTQ I;  1Q16 A;  4MON A;  1TWF I;  3J80 b;  1W2B Y;  1VQP 1;  1VQN Z;  1S72 Z;  1NUI A;  3EER A;  2QR1 B;  4MD7 A;  2JA8 I;  2KPI A;  3K7A I;  2R7Z I;  5LL6 f;  1QVG Y;  3S1M I;  1PFT A;  1VQP Z;  2K5R A;  3J81 f;  1VQ4 Z;  2W03 A;  3PO2 I;  1W2B Z;  3S17 I;  4MD9 A;  1WW9 A;  1YIJ 1;  1N2F A;  1WJ2 A;  3TDH B;  2E9H A;  1QVG Z;  4E2X A;  3M4O I;  1TFI A;  1KC8 1;  1YIJ Z;  2J6A A;  3CMA Z;  3H3V J;  1Q82 1;  3CCS 1;  1X0T A;  2Q51 A;  3S14 I;  3CXC Y;  5C3E I;  1QVF Y;  4NBG A;  1Y1V I;  4QTT A;  3EED A;  1Y1W I;  2GU2 A;  3CXC Z;  1YIT 1;  3CQZ I;  4BBS I;  1QVF Z;  4RVG A;  2Y0S A;  1SIW A;  4AYB A;  3QWU A;  5FLM I;  2R93 I;  3H0G I;  2WAQ A;  3CME 1;  1AA6 A;  1K73 1;  3NH8 A;  5IT9 f;  3IX0 A;  1M90 2;  1KQS Y;  2DE6 A;  1YHQ 1;  3CME Z;  2V45 A;  3CCV Z;  3HOW I;  3NH5 A;  4BXX I;  2NVX I;  1SFO I;  2JUB A;  1VQ6 Z;  3GTP I;  3PO3 I;  1KQS Z;  1Y8C A;  1VQ7 Z;  3NDI A;  2NAP A;  3J81 b;  3CCU 1;  3I56 Z;  3VB9 A;  3CCJ 1;  3CC2 Z;  2ZAE B;  2B63 I;  3CCU Z;  1RO2 A;  2DE5 A;  3CCJ Z;  1Q81 2;  1Z01 A;  3KIF A;  1YJ9 Z;  2JA6 I;  2JMO A;  3CCL 1;  1VQO 1;  2QRE B;  3CCQ 1;  2DE7 A;  3GTG I;  4A3K I;  4DGL A;  2OTJ 1;  1WII A;  2E2I I;  1USP A;  5T64 A;  2NVT I;  3T4N B;  3CCM 1;  2I3C A;  1USP B;  2HF1 A;  3CC7 Z;  3MZL B;  4HGY A;  2WB1 A;  1M90 1;  5IT9 b;  1TWG I;  3CCM Z;  3BG1 B;  1VQ5 Z;  4A3F I;  4NBA A;  3U50 C;  5C44 I;  2Q4Z A;  2JA7 I;  2AYD A;  3CCR 1;  1YJW 1;  3GTM S;  2IZ4 A;  2QA4 Z;  1VQ4 1;  3CCE Z;  1QYP A;  3CCR Z;  1Q7Y 2;  3I55 Z;  1YJW Z;  4E2W A;  1N8R 2;  3S2D I;  2JIO A;  4NBE A;  2H85 A;  2OZK A;  3CMA 1;  1I6H I;  1RO4 A;  1NP6 A;  1YUK A;  3G71 Z;  4BY7 I;  3LUS A;  1NJI 1;  1Q81 1;  1YUA A;  1ZH1 A;  2JS4 A;  1RNI A;  1R9T I;  4A3L I;  3HKZ A;  2M6N A;  3FQQ A;  2RPR A;  4MRI A;  3VMG A;  4RV9 A;  4E33 A;  2OOX B;  2E2H I;  1K83 I;  4TNU A;  2JR6 A;  3F3P C;  1M1K 2;  2V3V A;  1K9M 1;  2VUG A;  2P3Y A;  1ML8 A;  1ZB8 A;  3MZK B;  3RZD I;  3D2L A;  4A3B I;  2JNY A;  1JWH C;  3D6W A;  1RLY A;  2VF1 A;  3CCV 1;  3S16 I;  1Q86 2;  1VQ6 1;  2EGT A;  1VQ8 Z;  1VQK Z;  1P9N A;  2RHB A;  2PK7 A;  1VQ7 1;  4A3D I;  4MH4 A;  2RBL A;  2E2J I;  1Q7Y 1;  3I56 1;  4NOZ A;  5IP7 I;  2BJO A;  4NH1 C;  3CC2 1;  1N8R 1;  1VLA A;  1TWH I;  4NBH A;  1VQ9 Z;  3HOY I;  4NBD A;  1YJ9 1;  1YJN 1;  4BY1 I;  3PO3 S;  2VPW A;  1NJI 2;  2LEX A;  2VPZ A;  1YJN Z;  4MXU A;  1RO0 A;  3G6E 1;  1JJ2 Y;  4NBB A;  5AN9 F;  3VMH A;  3G6E Z;  2IZ3 A;  1YI2 Z;  1M1K 1;  1K9M 2;  2OTL 1;  5D1P A;  2QLV B;  4E32 A;  1JJ2 Z;  3CC7 1;  1FDI A;  1DL6 A;  3G4S Z;  2OTL Z;  1I3Q I;  3CD6 Z;  4QTU A;  1VQ5 1;  2QRC B;  2AKL A;  4A3I I;  1Q86 1;  3IR7 A;  2IV2 X;  1ZB9 A;  2QA4 1;  3CCE 1;  2QEX 1;  4X6A I;  3M3Y I;  3I55 1;  4E2Y A;  1TWA I;  2R6M A;  2QEX Z;  2G2K A;  4Y52 I;  1TWC I;  3S15 I;  4Y7N I;  3D9X A;  3G71 1;  1K8A 2;  2GTI A;  2NVQ I;  4RVF A;  2PM9 A;  1VQM Z;  1KRL A;  3J7A 4;  5C4J I;  3Q87 A;  4HH4 A;  5C4X I;  3TE5 B;  5FLX f;  3JAM f;  3NDJ A;  3VTN A;  4DQY B;  5A2Q f;  2JA5 I;  2V8I A;  1I50 I;  2RT9 A;  3RZO I;  3CPW Y;  1FDO A;  2E7Z A;  2F4M A;  5IP9 I;  2VPX A;  3GTK I;  2O53 A;  3NH4 A;  2R92 I;  3CPW Z;  4XX2 A;  4NFR A;  1S7M A;  3IF8 A;  1Z02 A;  4NBC A;  1VQL 1;  3HOZ I;  1X3Z A;  2JIP A;  2VPY A;  1VQ8 1;  1VQK 1;  3FKI I;  3GTL I;  3CCS Z;  3F3F C;  1Y1V S;  3GCF A;  4CL1 A;  1VQL Z;  2JIQ A;  1KD1 2;  2V8K A;  3I4N I;  3GTJ I;  3I4M I;  4A3C I;  3HOX I;  5CM2 M;  2YU9 I;  3HOU I;  2M48 A;  3S2H I;  1QF8 A;  3GTO I;  2PMZ A;  1YIT Z;  1LQL A;  1VQ9 1;  2HU9 A; 
#chains in the Genus database with same CATH homology
 2LFU A;  3S1N I;  3P5J B;  1K8A 1;  2O4H A;  3VMI A;  2LIY A;  3J80 f;  2YAD A;  1RQF A;  5FLX b;  3JAM b;  1YHQ Z;  4E2Z A;  1X3W A;  5A2Q b;  4HGZ A;  2KI7 B;  2QRD B;  1YI2 1;  5T6B A;  2VUM I;  2V8J A;  3OW2 Y;  2NVY I;  3G4S 1;  1WCM I;  3FQM A;  3CD6 1;  1KC8 2;  4EWC A;  2P28 A;  2F4O A;  4A3E I;  4S1T A;  1Q82 2;  4A3M I;  3MON A;  3ESW A;  3KIH A;  4E31 A;  4DK1 A;  3OW2 Z;  3I07 A;  3CC4 1;  3BG0 B;  4NB9 A;  2W04 A;  4E30 A;  1KD1 1;  3CC4 Z;  3CCL Z;  4A3J I;  3S1Q I;  3GKQ A;  1VQO Z;  3CCQ Z;  2K3R A;  1Z03 A;  3NFZ A;  4RVD A;  3S1R I;  2GTH A;  3GTM I;  2RIQ A;  4RS4 A;  5D1O A;  3HOV I;  4NB8 A;  2OTJ Z;  3IFU A;  4MD8 A;  1VQM 1;  1K73 2;  4A93 I;  4NBF A;  2OOY B;  2QKD A;  5D1O B;  4A3G I;  4BBR I;  4RVH A;  5T67 A;  1VQN 1;  1L1O C;  1S72 1;  3GTQ I;  4MON A;  1TWF I;  3J80 b;  1W2B Y;  1VQP 1;  1VQN Z;  1S72 Z;  1NUI A;  3EER A;  2QR1 B;  4MD7 A;  2JA8 I;  2KPI A;  3K7A I;  2R7Z I;  5LL6 f;  1QVG Y;  3S1M I;  1PFT A;  1VQP Z;  2K5R A;  3J81 f;  1VQ4 Z;  2W03 A;  3PO2 I;  1W2B Z;  3S17 I;  4MD9 A;  1WW9 A;  1YIJ 1;  1N2F A;  3TDH B;  2E9H A;  1QVG Z;  4E2X A;  3M4O I;  1TFI A;  1KC8 1;  1YIJ Z;  2J6A A;  3CMA Z;  3H3V J;  1Q82 1;  3CCS 1;  1X0T A;  2Q51 A;  3S14 I;  3CXC Y;  5C3E I;  1QVF Y;  4NBG A;  1Y1V I;  4QTT A;  3EED A;  1Y1W I;  2GU2 A;  3CXC Z;  1YIT 1;  3CQZ I;  4BBS I;  1QVF Z;  4RVG A;  2Y0S A;  4AYB A;  3QWU A;  5FLM I;  2R93 I;  3H0G I;  2WAQ A;  3CME 1;  1K73 1;  3NH8 A;  5IT9 f;  3IX0 A;  1M90 2;  1KQS Y;  2DE6 A;  1YHQ 1;  3CME Z;  3CCV Z;  3HOW I;  3NH5 A;  4BXX I;  2NVX I;  1SFO I;  2JUB A;  1VQ6 Z;  3GTP I;  3PO3 I;  1KQS Z;  1VQ7 Z;  3NDI A;  3J81 b;  3CCU 1;  3I56 Z;  3VB9 A;  3CCJ 1;  3CC2 Z;  2ZAE B;  2B63 I;  3CCU Z;  1RO2 A;  2DE5 A;  3CCJ Z;  1Q81 2;  1Z01 A;  3KIF A;  1YJ9 Z;  2JA6 I;  2JMO A;  3CCL 1;  1VQO 1;  2QRE B;  3CCQ 1;  2DE7 A;  3GTG I;  4A3K I;  4DGL A;  2OTJ 1;  1WII A;  2E2I I;  1USP A;  5T64 A;  2NVT I;  3T4N B;  3CCM 1;  2I3C A;  1USP B;  2HF1 A;  3CC7 Z;  3MZL B;  4HGY A;  2WB1 A;  1M90 1;  5IT9 b;  1TWG I;  3CCM Z;  3BG1 B;  1VQ5 Z;  4A3F I;  4NBA A;  3U50 C;  5C44 I;  2Q4Z A;  2JA7 I;  3CCR 1;  1YJW 1;  3GTM S;  2IZ4 A;  2QA4 Z;  1VQ4 1;  3CCE Z;  1QYP A;  3CCR Z;  1Q7Y 2;  3I55 Z;  1YJW Z;  4E2W A;  1N8R 2;  3S2D I;  4NBE A;  2H85 A;  2OZK A;  3CMA 1;  1I6H I;  1RO4 A;  1NP6 A;  1YUK A;  3G71 Z;  4BY7 I;  3LUS A;  1NJI 1;  1Q81 1;  1YUA A;  1ZH1 A;  2JS4 A;  1RNI A;  1R9T I;  4A3L I;  3HKZ A;  2M6N A;  3FQQ A;  2RPR A;  4MRI A;  3VMG A;  4RV9 A;  4E33 A;  2OOX B;  2E2H I;  1K83 I;  4TNU A;  2JR6 A;  3F3P C;  1M1K 2;  1K9M 1;  2VUG A;  2P3Y A;  1ML8 A;  1ZB8 A;  3MZK B;  3RZD I;  4A3B I;  2JNY A;  1JWH C;  3D6W A;  1RLY A;  2VF1 A;  3CCV 1;  3S16 I;  1Q86 2;  1VQ6 1;  2EGT A;  1VQ8 Z;  1VQK Z;  1P9N A;  2RHB A;  2PK7 A;  1VQ7 1;  4A3D I;  4MH4 A;  2RBL A;  2E2J I;  1Q7Y 1;  3I56 1;  4NOZ A;  5IP7 I;  2BJO A;  4NH1 C;  3CC2 1;  1N8R 1;  1VLA A;  1TWH I;  4NBH A;  1VQ9 Z;  3HOY I;  4NBD A;  1YJ9 1;  1YJN 1;  4BY1 I;  3PO3 S;  1NJI 2;  1YJN Z;  4MXU A;  1RO0 A;  3G6E 1;  1JJ2 Y;  4NBB A;  5AN9 F;  3VMH A;  3G6E Z;  2IZ3 A;  1YI2 Z;  1M1K 1;  1K9M 2;  2OTL 1;  5D1P A;  2QLV B;  4E32 A;  1JJ2 Z;  3CC7 1;  1DL6 A;  3G4S Z;  2OTL Z;  1I3Q I;  3CD6 Z;  4QTU A;  1VQ5 1;  2QRC B;  2AKL A;  4A3I I;  1Q86 1;  1ZB9 A;  2QA4 1;  3CCE 1;  2QEX 1;  4X6A I;  3M3Y I;  3I55 1;  4E2Y A;  1TWA I;  2R6M A;  2QEX Z;  2G2K A;  4Y52 I;  1TWC I;  3S15 I;  4Y7N I;  3D9X A;  3G71 1;  1K8A 2;  2GTI A;  2NVQ I;  4RVF A;  2PM9 A;  1VQM Z;  1KRL A;  3J7A 4;  5C4J I;  3Q87 A;  4HH4 A;  5C4X I;  3TE5 B;  5FLX f;  3JAM f;  3NDJ A;  3VTN A;  4DQY B;  5A2Q f;  2JA5 I;  2V8I A;  1I50 I;  2RT9 A;  3RZO I;  3CPW Y;  2F4M A;  5IP9 I;  3GTK I;  2O53 A;  3NH4 A;  2R92 I;  3CPW Z;  4XX2 A;  4NFR A;  1S7M A;  3IF8 A;  1Z02 A;  4NBC A;  1VQL 1;  3HOZ I;  1X3Z A;  1VQ8 1;  1VQK 1;  3FKI I;  3GTL I;  3CCS Z;  3F3F C;  1Y1V S;  3GCF A;  4CL1 A;  1VQL Z;  1KD1 2;  2V8K A;  3I4N I;  3GTJ I;  3I4M I;  4A3C I;  3HOX I;  5CM2 M;  2YU9 I;  3HOU I;  2M48 A;  3S2H I;  1QF8 A;  3GTO I;  2PMZ A;  1YIT Z;  1LQL A;  1VQ9 1;  2HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...