3CMA1

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cma100
1JJ2Y 3CC21 1S72Z 3G71Z 1YITZ 1M902 3I551 3CMEZ 1K731 1M901 1VQP1 1YHQZ 1QVGZ 3CCQ1 3CCU1 1VQ51 1VQ4Z 1Q812 3CC7Z 3G6E1 1VQ91 3CD6Z 1Q811 3G4SZ 1YJW1 1N8R1 1YJ9Z 3CMA1 3I561 3CCE1 3CPWY 3CC2Z 1KQSZ 1JJ2Z 1VQ81 1Q862 2OTJ1 2QEX1 1VQ61 1VQO1 1Q861 1W2BY 3I55Z 2QA41 2OTL1 1Q7Y2 1VQPZ 3CCQZ 3OW2Y 3CCUZ 1VQ5Z 3OW2Z 3G6EZ 1VQ9Z 3CMAZ 3CCV1 1YJWZ 3I56Z 3CCEZ 3G711 1YJN1 1YI21 1VQL1 1QVFY 3CPWZ 1VQ8Z 1YIJ1 2OTJZ 3CCR1 2QEXZ 1VQ6Z 3CCL1 1VQOZ 3CCJ1 2QA4Z 1VQN1 3CXCY 1KC82 1W2BZ 3CCM1 2OTLZ 1VQK1 1VQM1 1KC81 1Q7Y1 3CCS1 3CC41 1VQ71 1M1K2 1M1K1 1S721 3CCVZ 1YI2Z 1YIT1 1YJNZ 1VQLZ 1K732 3CME1 1QVFZ 1YIJZ 3CCRZ 1NJI2 1K9M2 3CCLZ 1QVGY 1YHQ1 3CCJZ 1NJI1 1K9M1 1VQNZ 3CCMZ 1VQKZ 3CXCZ 1VQMZ 1Q822 1K8A2 1VQ41 1KD12 3CC71 1N8R2 3CCSZ 3CD61 3CC4Z 1VQ7Z 1Q821 1K8A1 1KD11 3G4S1 1KQSY 1YJ91
chains in the Genus database with same CATH superfamily
1JJ2Y 3NFZA 2K5RA 3HOYI 2HF1A 4Y52I 3G71Z 3PO3S 3EEDA 2E2JI 1Z02A 3HKZA 1QXFA 3CCQ1 3HOZI 2E2II 3CD6Z 1Q16A 2JIRA 1YJ9Z 1KQSZ 2Y0SA 1VQ81 3S14I 2LIYA 3S1MI 5IP7I 2O4HA 3F3PC 2JNYA 2OTL1 3GTGI 3IX0A 2JR6A 3IF8A 2RIQA 4DK1A 3CCQZ 3GKQA 4A3GI 4CL1A 3I4MI 3OW2Z 4E2XA 3MONA 2BJOA 5FLMI 5LL6f 1WW9A 1QVFY 2IZ3A 3CPWZ 2NVQI 4XX2A 1VQ8Z 3CCR1 1RLYA 2RBLA 3CCL1 3PO2I 3CCJ1 3GTQI 1KC82 3J81b 1W2BZ 3CCM1 2OTLZ 2V8IA 4NBHA 4NBAA 1VQM1 2R92I 1ML8A 1ZB9A 1VQ71 1I50I 4A3MI 1M1K2 4A3FI 4MH4A 2B63I 1S721 5C4XI 1YIT1 3J80b 2G2KA 3CCRZ 3H3VJ 3GTLI 4A3DI 2QREB 3CCLZ 3Q87A 1YHQ1 3CCJZ 1NJI1 1K9M1 5D1PA 3FQMA 3CCMZ 2E9HA 1VQMZ 2JA5I 1KD12 1WZNA 5C44I 3CQZI 3GCFA 1RO0A 1VQ7Z 1KQSY 3VTNA 2LEXA 2YADA 3GTMS 1S72Z 1YITZ 3I551 2DE7A 2AKLA 5C3EI 3H0GI 1P9NA 4E2WA 1M901 3S17I 3D6WA 1YHQZ 2WB1A 1ZH1A 4NB8A 4NBFA 2GTHA 2K3RA 2WAQA 1L1OC 1VLAA 4RVFA 1Z03A 3M4OI 1RQFA 1Q811 1YJW1 3CPWY 4E30A 4BY1I 1YUKA 4RVDA 2OTJ1 3TE5B 4BBSI 4Y7NI 1Q861 1W2BY 3I55Z 1Y1VI 2W04A 2RHBA 2OOXB 2Q51A 1Q7Y2 5FLXf 5A2Qf 2QRCB 1QYPA 3QWUA 4HH4A 1PFTA 1I6HI 3IFUA 4DQYB 3GTOI 1I3QI 3ESWA 2ZAEB 3KIFA 3T4NB 1YJWZ 1YI21 3TDHB 2OTJZ 1NUIA 4QTUA 3S2HI 3NDJA 3S2DI 1TWGI 3EERA 2JS4A 5CM2M 1Q7Y1 1FDOA 2R93I 3CCS1 2NAPA 3CC41 4TNUA 1WIIA 3P5JB 2P28A 2RPRA 4A3JI 2VF1A 2JIMA 1USPB 4HGYA 1YI2Z 2M48A 3CME1 2JUBA 2V45A 3JAMf 1NJI2 2F4OA 1K9M2 4X6AI 2M6NA 3NH8A 4E33A 3S16I 2V3VA 4NBEA 5C4JI 3CCSZ 3CC4Z 1Q821 1K8A1 1RO2A 1DL6A 2PM9A 1X3WA 1N8R1 3CC21 4MRIA 2H85A 2NVTI 1M902 3CMEZ 3VMHA 1QF8A 2R7ZI 4NBCA 4E2ZA 2VUGA 1QVGZ 4NBBA 3CCU1 2O53A 4NFRA 1R9TI 1Q812 2VPWA 4A3KI 1VQ91 3I561 3CC2Z 3FQQA 2DE5A 1Q862 3F3FC 4AYBA 1VQO1 5FLXb 5A2Qb 2KPIA 2QA41 2JA8I 3HOUI 2RT9A 3S15I 2I3CA 3MZLB 5IP9I 1AA6A 3NH5A 1Y1VS 1SFOI 4A3BI 4NOZA 5IT9f 5T64A 3OW2Y 3CCUZ 2GTIA 3M3YI 2HU9A 2VPZA 1USPA 3KIHA 1VQ9Z 1LQLA 4RVHA 3CCV1 3MZKB 3I56Z 3G711 1K83I 1YJN1 1RO4A 3IR7A 1YIJ1 4A3CI 4BY7I 2OOYB 1VQOZ 3I07A 1VQN1 2QA4Z 1KRLA 4MD8A 3RZDI 2DE6A 3K7AI 2JIOA 4EWCA 2E2HI 2NVXI 2E7ZA 4QTTA 2EGTA 1YUAA 3JAMb 1Z01A 4A3LI 3CCVZ 4E31A 2YU9I 1K732 1YJNZ 1YIJZ 4RS4A 1N2FA 1TWCI 1TWAI 3D9XA 1QVGY 2QRDB 2V8KA 1VQNZ 4S1TA 3CXCZ 4E32A 5D1OA 4MD9A 2VUMI 1Q822 1K8A2 1VQ41 4MXUA 2IZ4A 3CC71 1N8R2 3GTPI 3G4S1 1RNIA 3PO3I 2P3YA 1TFIA 1TWHI 1ZB8A 3S1RI 4NB9A 2AYDA 4A93I 1K731 1VQP1 3GTKI 2QKDA 3J7A4 3VMIA 2V8JA 5T6BA 1VQ51 1Y1WI 1VQ4Z 4BXXI 3S1QI 1SIWA 3CC7Z 2JA6I 3G6E1 2PMZA 3CMA1 2LFUA 3G4SZ 2JIPA 3CCE1 1JJ2Z 4HGZA 2QEX1 1VQ61 2VPYA 1X3ZA 5AN9F 3NH4A 4A3II 2IV2X 3S1NI 2J6AA 5IT9b 1VQPZ 2NVYI 3RZOI 1WJ2A 4MONA 2QLVB 1VQ5Z 4NBGA 1X0TA 2PK7A 2Q4ZA 2R6MA 4RV9A 5D1OB 3G6EZ 3CMAZ 3CCEZ 1VQL1 2KI7B 4MD7A 1S7MA 2JA7I 2QEXZ 1VQ6Z 1NP6A 1WCMI 3CXCY 4DGLA 3VMGA 1VQK1 2QR1B 5T67A 3BG1B 3HOVI 1KC81 1Y8CA 3J81f 3NDIA 2JIQA 2JMOA 4NH1C 1M1K1 3FKII 3D2LA 4E2YA 2VPXA 4BBRI 1FDIA 4NBDA 1VQLZ 3I4NI 3HOXI 2OZKA 1QVFZ 3HOWI 4RVGA 1TWFI 2GU2A 3VB9A 1JWHC 3BG0B 3LUSA 3J80f 1VQKZ 2W03A 4A3EI 2F4MA 3GTMI 3CD61 1KD11 3GTJI 3U50C 1YJ91
chains in the Genus database with same CATH topology
1JJ2Y 3NFZA 2K5RA 3HOYI 2HF1A 4Y52I 3G71Z 3PO3S 3EEDA 2E2JI 1Z02A 3HKZA 3CCQ1 3HOZI 2E2II 3CD6Z 1YJ9Z 1KQSZ 2Y0SA 1VQ81 3S14I 2LIYA 3S1MI 5IP7I 2O4HA 3F3PC 2JNYA 2OTL1 3GTGI 3IX0A 2JR6A 3IF8A 2RIQA 4DK1A 3CCQZ 3GKQA 4A3GI 4CL1A 3I4MI 3OW2Z 4E2XA 3MONA 2BJOA 5FLMI 5LL6f 1WW9A 1QVFY 2IZ3A 3CPWZ 2NVQI 4XX2A 1VQ8Z 3CCR1 1RLYA 2RBLA 3CCL1 3PO2I 3CCJ1 3GTQI 1KC82 3J81b 1W2BZ 3CCM1 2OTLZ 2V8IA 4NBHA 4NBAA 1VQM1 2R92I 1ML8A 1ZB9A 1VQ71 1I50I 4A3MI 1M1K2 4A3FI 4MH4A 2B63I 1S721 5C4XI 1YIT1 3J80b 2G2KA 3CCRZ 3H3VJ 3GTLI 4A3DI 2QREB 3CCLZ 3Q87A 1YHQ1 3CCJZ 1NJI1 1K9M1 5D1PA 3FQMA 3CCMZ 2E9HA 1VQMZ 2JA5I 1KD12 5C44I 3CQZI 3GCFA 1RO0A 1VQ7Z 1KQSY 3VTNA 2YADA 3GTMS 1S72Z 1YITZ 3I551 2DE7A 2AKLA 5C3EI 3H0GI 1P9NA 4E2WA 1M901 3S17I 3D6WA 1YHQZ 2WB1A 1ZH1A 4NB8A 4NBFA 2GTHA 2K3RA 2WAQA 1L1OC 1VLAA 4RVFA 1Z03A 3M4OI 1RQFA 1Q811 1YJW1 3CPWY 4E30A 4BY1I 1YUKA 4RVDA 2OTJ1 3TE5B 4BBSI 4Y7NI 1Q861 1W2BY 3I55Z 1Y1VI 2W04A 2RHBA 2OOXB 2Q51A 1Q7Y2 5FLXf 5A2Qf 2QRCB 1QYPA 3QWUA 4HH4A 1PFTA 1I6HI 3IFUA 4DQYB 3GTOI 1I3QI 3ESWA 2ZAEB 3KIFA 3T4NB 1YJWZ 1YI21 3TDHB 2OTJZ 1NUIA 4QTUA 3S2HI 3NDJA 3S2DI 1TWGI 3EERA 2JS4A 5CM2M 1Q7Y1 2R93I 3CCS1 3CC41 4TNUA 1WIIA 3P5JB 2P28A 2RPRA 4A3JI 2VF1A 1USPB 4HGYA 1YI2Z 2M48A 3CME1 2JUBA 3JAMf 1NJI2 2F4OA 1K9M2 4X6AI 2M6NA 3NH8A 4E33A 3S16I 4NBEA 5C4JI 3CCSZ 3CC4Z 1Q821 1K8A1 1RO2A 1DL6A 2PM9A 1X3WA 1N8R1 3CC21 4MRIA 2H85A 2NVTI 1M902 3CMEZ 3VMHA 1QF8A 2R7ZI 4NBCA 4E2ZA 2VUGA 1QVGZ 4NBBA 3CCU1 2O53A 4NFRA 1R9TI 1Q812 4A3KI 1VQ91 3I561 3CC2Z 3FQQA 2DE5A 1Q862 3F3FC 4AYBA 1VQO1 5FLXb 5A2Qb 2KPIA 2QA41 2JA8I 3HOUI 2RT9A 3S15I 2I3CA 3MZLB 5IP9I 3NH5A 1Y1VS 1SFOI 4A3BI 4NOZA 5IT9f 5T64A 3OW2Y 3CCUZ 2GTIA 3M3YI 2HU9A 1USPA 3KIHA 1VQ9Z 1LQLA 4RVHA 3CCV1 3MZKB 3I56Z 3G711 1K83I 1YJN1 1RO4A 1YIJ1 4A3CI 4BY7I 2OOYB 1VQOZ 3I07A 1VQN1 2QA4Z 1KRLA 4MD8A 3RZDI 2DE6A 3K7AI 4EWCA 2E2HI 2NVXI 4QTTA 2EGTA 1YUAA 3JAMb 1Z01A 4A3LI 4E31A 3CCVZ 2YU9I 1K732 1YJNZ 1YIJZ 4RS4A 1N2FA 1TWCI 1TWAI 3D9XA 1QVGY 2QRDB 2V8KA 1VQNZ 4S1TA 3CXCZ 4E32A 5D1OA 4MD9A 2VUMI 1Q822 1K8A2 1VQ41 4MXUA 2IZ4A 3CC71 1N8R2 3GTPI 3G4S1 1RNIA 3PO3I 2P3YA 1TFIA 1TWHI 1ZB8A 3S1RI 4NB9A 4A93I 1K731 1VQP1 3GTKI 2QKDA 3J7A4 3VMIA 2V8JA 5T6BA 1VQ51 1Y1WI 1VQ4Z 4BXXI 3S1QI 3CC7Z 2JA6I 3G6E1 2PMZA 3CMA1 2LFUA 3G4SZ 3CCE1 1JJ2Z 4HGZA 2QEX1 1VQ61 1X3ZA 5AN9F 3NH4A 4A3II 3S1NI 5IT9b 2J6AA 1VQPZ 2NVYI 3RZOI 4MONA 2QLVB 1VQ5Z 4NBGA 1X0TA 2PK7A 2Q4ZA 2R6MA 4RV9A 5D1OB 3G6EZ 3CMAZ 3CCEZ 1VQL1 2KI7B 4MD7A 1S7MA 2JA7I 2QEXZ 1VQ6Z 1NP6A 1WCMI 3CXCY 4DGLA 3VMGA 1VQK1 2QR1B 5T67A 3BG1B 3HOVI 1KC81 3J81f 3NDIA 2JMOA 4NH1C 1M1K1 3FKII 4E2YA 4BBRI 3I4NI 4NBDA 1VQLZ 3HOXI 2OZKA 1QVFZ 3HOWI 4RVGA 1TWFI 2GU2A 3VB9A 1JWHC 3BG0B 3LUSA 3J80f 1VQKZ 2W03A 4A3EI 2F4MA 3GTMI 3CD61 1KD11 3GTJI 3U50C 1YJ91
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Y;  3CC2 1;  1S72 Z;  3G71 Z;  1YIT Z;  1M90 2;  3I55 1;  3CME Z;  1K73 1;  1M90 1;  1VQP 1;  1YHQ Z;  1QVG Z;  3CCQ 1;  3CCU 1;  1VQ5 1;  1VQ4 Z;  1Q81 2;  3CC7 Z;  3G6E 1;  1VQ9 1;  3CD6 Z;  1Q81 1;  3G4S Z;  1YJW 1;  1N8R 1;  1YJ9 Z;  3CMA 1;  3I56 1;  3CCE 1;  3CPW Y;  3CC2 Z;  1KQS Z;  1JJ2 Z;  1VQ8 1;  1Q86 2;  2OTJ 1;  2QEX 1;  1VQ6 1;  1VQO 1;  1Q86 1;  1W2B Y;  3I55 Z;  2QA4 1;  2OTL 1;  1Q7Y 2;  1VQP Z;  3CCQ Z;  3OW2 Y;  3CCU Z;  1VQ5 Z;  3OW2 Z;  3G6E Z;  1VQ9 Z;  3CMA Z;  3CCV 1;  1YJW Z;  3I56 Z;  3CCE Z;  3G71 1;  1YJN 1;  1YI2 1;  1VQL 1;  1QVF Y;  3CPW Z;  1VQ8 Z;  1YIJ 1;  2OTJ Z;  3CCR 1;  2QEX Z;  1VQ6 Z;  3CCL 1;  1VQO Z;  3CCJ 1;  2QA4 Z;  1VQN 1;  3CXC Y;  1KC8 2;  1W2B Z;  3CCM 1;  2OTL Z;  1VQK 1;  1VQM 1;  1KC8 1;  1Q7Y 1;  3CCS 1;  3CC4 1;  1VQ7 1;  1M1K 2;  1M1K 1;  1S72 1;  3CCV Z;  1YI2 Z;  1YIT 1;  1YJN Z;  1VQL Z;  1K73 2;  3CME 1;  1QVF Z;  1YIJ Z;  3CCR Z;  1NJI 2;  1K9M 2;  3CCL Z;  1QVG Y;  1YHQ 1;  3CCJ Z;  1NJI 1;  1K9M 1;  1VQN Z;  3CCM Z;  1VQK Z;  3CXC Z;  1VQM Z;  1Q82 2;  1K8A 2;  1VQ4 1;  1KD1 2;  3CC7 1;  1N8R 2;  3CCS Z;  3CD6 1;  3CC4 Z;  1VQ7 Z;  1Q82 1;  1K8A 1;  1KD1 1;  3G4S 1;  1KQS Y;  1YJ9 1; 
#chains in the Genus database with same CATH topology
 1JJ2 Y;  3NFZ A;  2K5R A;  3HOY I;  2HF1 A;  4Y52 I;  3G71 Z;  3PO3 S;  3EED A;  2E2J I;  1Z02 A;  3HKZ A;  1QXF A;  3CCQ 1;  3HOZ I;  2E2I I;  3CD6 Z;  1Q16 A;  2JIR A;  1YJ9 Z;  1KQS Z;  2Y0S A;  1VQ8 1;  3S14 I;  2LIY A;  3S1M I;  5IP7 I;  2O4H A;  3F3P C;  2JNY A;  2OTL 1;  3GTG I;  3IX0 A;  2JR6 A;  3IF8 A;  2RIQ A;  4DK1 A;  3CCQ Z;  3GKQ A;  4A3G I;  4CL1 A;  3I4M I;  3OW2 Z;  4E2X A;  3MON A;  2BJO A;  5FLM I;  5LL6 f;  1WW9 A;  1QVF Y;  2IZ3 A;  3CPW Z;  2NVQ I;  4XX2 A;  1VQ8 Z;  3CCR 1;  1RLY A;  2RBL A;  3CCL 1;  3PO2 I;  3CCJ 1;  3GTQ I;  1KC8 2;  3J81 b;  1W2B Z;  3CCM 1;  2OTL Z;  2V8I A;  4NBH A;  4NBA A;  1VQM 1;  2R92 I;  1ML8 A;  1ZB9 A;  1VQ7 1;  1I50 I;  4A3M I;  1M1K 2;  4A3F I;  4MH4 A;  2B63 I;  1S72 1;  5C4X I;  1YIT 1;  3J80 b;  2G2K A;  3CCR Z;  3H3V J;  3GTL I;  4A3D I;  2QRE B;  3CCL Z;  3Q87 A;  1YHQ 1;  3CCJ Z;  1NJI 1;  1K9M 1;  5D1P A;  3FQM A;  3CCM Z;  2E9H A;  1VQM Z;  2JA5 I;  1KD1 2;  1WZN A;  5C44 I;  3CQZ I;  3GCF A;  1RO0 A;  1VQ7 Z;  1KQS Y;  3VTN A;  2LEX A;  2YAD A;  3GTM S;  1S72 Z;  1YIT Z;  3I55 1;  2DE7 A;  2AKL A;  5C3E I;  3H0G I;  1P9N A;  4E2W A;  1M90 1;  3S17 I;  3D6W A;  1YHQ Z;  2WB1 A;  1ZH1 A;  4NB8 A;  4NBF A;  2GTH A;  2K3R A;  2WAQ A;  1L1O C;  1VLA A;  4RVF A;  1Z03 A;  3M4O I;  1RQF A;  1Q81 1;  1YJW 1;  3CPW Y;  4E30 A;  4BY1 I;  1YUK A;  4RVD A;  2OTJ 1;  3TE5 B;  4BBS I;  4Y7N I;  1Q86 1;  1W2B Y;  3I55 Z;  1Y1V I;  2W04 A;  2RHB A;  2OOX B;  2Q51 A;  1Q7Y 2;  5FLX f;  5A2Q f;  2QRC B;  1QYP A;  3QWU A;  4HH4 A;  1PFT A;  1I6H I;  3IFU A;  4DQY B;  3GTO I;  1I3Q I;  3ESW A;  2ZAE B;  3KIF A;  3T4N B;  1YJW Z;  1YI2 1;  3TDH B;  2OTJ Z;  1NUI A;  4QTU A;  3S2H I;  3NDJ A;  3S2D I;  1TWG I;  3EER A;  2JS4 A;  5CM2 M;  1Q7Y 1;  1FDO A;  2R93 I;  3CCS 1;  2NAP A;  3CC4 1;  4TNU A;  1WII A;  3P5J B;  2P28 A;  2RPR A;  4A3J I;  2VF1 A;  2JIM A;  1USP B;  4HGY A;  1YI2 Z;  2M48 A;  3CME 1;  2JUB A;  2V45 A;  3JAM f;  1NJI 2;  2F4O A;  1K9M 2;  4X6A I;  2M6N A;  3NH8 A;  4E33 A;  3S16 I;  2V3V A;  4NBE A;  5C4J I;  3CCS Z;  3CC4 Z;  1Q82 1;  1K8A 1;  1RO2 A;  1DL6 A;  2PM9 A;  1X3W A;  1N8R 1;  3CC2 1;  4MRI A;  2H85 A;  2NVT I;  1M90 2;  3CME Z;  3VMH A;  1QF8 A;  2R7Z I;  4NBC A;  4E2Z A;  2VUG A;  1QVG Z;  4NBB A;  3CCU 1;  2O53 A;  4NFR A;  1R9T I;  1Q81 2;  2VPW A;  4A3K I;  1VQ9 1;  3I56 1;  3CC2 Z;  3FQQ A;  2DE5 A;  1Q86 2;  3F3F C;  4AYB A;  1VQO 1;  5FLX b;  5A2Q b;  2KPI A;  2QA4 1;  2JA8 I;  3HOU I;  2RT9 A;  3S15 I;  2I3C A;  3MZL B;  5IP9 I;  1AA6 A;  3NH5 A;  1Y1V S;  1SFO I;  4A3B I;  4NOZ A;  5IT9 f;  5T64 A;  3OW2 Y;  3CCU Z;  2GTI A;  3M3Y I;  2HU9 A;  2VPZ A;  1USP A;  3KIH A;  1VQ9 Z;  1LQL A;  4RVH A;  3CCV 1;  3MZK B;  3I56 Z;  3G71 1;  1K83 I;  1YJN 1;  1RO4 A;  3IR7 A;  1YIJ 1;  4A3C I;  4BY7 I;  2OOY B;  1VQO Z;  3I07 A;  1VQN 1;  2QA4 Z;  1KRL A;  4MD8 A;  3RZD I;  2DE6 A;  3K7A I;  2JIO A;  4EWC A;  2E2H I;  2NVX I;  2E7Z A;  4QTT A;  2EGT A;  1YUA A;  3JAM b;  1Z01 A;  4A3L I;  3CCV Z;  4E31 A;  2YU9 I;  1K73 2;  1YJN Z;  1YIJ Z;  4RS4 A;  1N2F A;  1TWC I;  1TWA I;  3D9X A;  1QVG Y;  2QRD B;  2V8K A;  1VQN Z;  4S1T A;  3CXC Z;  4E32 A;  5D1O A;  4MD9 A;  2VUM I;  1Q82 2;  1K8A 2;  1VQ4 1;  4MXU A;  2IZ4 A;  3CC7 1;  1N8R 2;  3GTP I;  3G4S 1;  1RNI A;  3PO3 I;  2P3Y A;  1TFI A;  1TWH I;  1ZB8 A;  3S1R I;  4NB9 A;  2AYD A;  4A93 I;  1K73 1;  1VQP 1;  3GTK I;  2QKD A;  3J7A 4;  3VMI A;  2V8J A;  5T6B A;  1VQ5 1;  1Y1W I;  1VQ4 Z;  4BXX I;  3S1Q I;  1SIW A;  3CC7 Z;  2JA6 I;  3G6E 1;  2PMZ A;  3CMA 1;  2LFU A;  3G4S Z;  2JIP A;  3CCE 1;  1JJ2 Z;  4HGZ A;  2QEX 1;  1VQ6 1;  2VPY A;  1X3Z A;  5AN9 F;  3NH4 A;  4A3I I;  2IV2 X;  3S1N I;  2J6A A;  5IT9 b;  1VQP Z;  2NVY I;  3RZO I;  1WJ2 A;  4MON A;  2QLV B;  1VQ5 Z;  4NBG A;  1X0T A;  2PK7 A;  2Q4Z A;  2R6M A;  4RV9 A;  5D1O B;  3G6E Z;  3CMA Z;  3CCE Z;  1VQL 1;  2KI7 B;  4MD7 A;  1S7M A;  2JA7 I;  2QEX Z;  1VQ6 Z;  1NP6 A;  1WCM I;  3CXC Y;  4DGL A;  3VMG A;  1VQK 1;  2QR1 B;  5T67 A;  3BG1 B;  3HOV I;  1KC8 1;  1Y8C A;  3J81 f;  3NDI A;  2JIQ A;  2JMO A;  4NH1 C;  1M1K 1;  3FKI I;  3D2L A;  4E2Y A;  2VPX A;  4BBR I;  1FDI A;  4NBD A;  1VQL Z;  3I4N I;  3HOX I;  2OZK A;  1QVF Z;  3HOW I;  4RVG A;  1TWF I;  2GU2 A;  3VB9 A;  1JWH C;  3BG0 B;  3LUS A;  3J80 f;  1VQK Z;  2W03 A;  4A3E I;  2F4M A;  3GTM I;  3CD6 1;  1KD1 1;  3GTJ I;  3U50 C;  1YJ9 1; 
#chains in the Genus database with same CATH homology
 1JJ2 Y;  3NFZ A;  2K5R A;  3HOY I;  2HF1 A;  4Y52 I;  3G71 Z;  3PO3 S;  3EED A;  2E2J I;  1Z02 A;  3HKZ A;  3CCQ 1;  3HOZ I;  2E2I I;  3CD6 Z;  1YJ9 Z;  1KQS Z;  2Y0S A;  1VQ8 1;  3S14 I;  2LIY A;  3S1M I;  5IP7 I;  2O4H A;  3F3P C;  2JNY A;  2OTL 1;  3GTG I;  3IX0 A;  2JR6 A;  3IF8 A;  2RIQ A;  4DK1 A;  3CCQ Z;  3GKQ A;  4A3G I;  4CL1 A;  3I4M I;  3OW2 Z;  4E2X A;  3MON A;  2BJO A;  5FLM I;  5LL6 f;  1WW9 A;  1QVF Y;  2IZ3 A;  3CPW Z;  2NVQ I;  4XX2 A;  1VQ8 Z;  3CCR 1;  1RLY A;  2RBL A;  3CCL 1;  3PO2 I;  3CCJ 1;  3GTQ I;  1KC8 2;  3J81 b;  1W2B Z;  3CCM 1;  2OTL Z;  2V8I A;  4NBH A;  4NBA A;  1VQM 1;  2R92 I;  1ML8 A;  1ZB9 A;  1VQ7 1;  1I50 I;  4A3M I;  1M1K 2;  4A3F I;  4MH4 A;  2B63 I;  1S72 1;  5C4X I;  1YIT 1;  3J80 b;  2G2K A;  3CCR Z;  3H3V J;  3GTL I;  4A3D I;  2QRE B;  3CCL Z;  3Q87 A;  1YHQ 1;  3CCJ Z;  1NJI 1;  1K9M 1;  5D1P A;  3FQM A;  3CCM Z;  2E9H A;  1VQM Z;  2JA5 I;  1KD1 2;  5C44 I;  3CQZ I;  3GCF A;  1RO0 A;  1VQ7 Z;  1KQS Y;  3VTN A;  2YAD A;  3GTM S;  1S72 Z;  1YIT Z;  3I55 1;  2DE7 A;  2AKL A;  5C3E I;  3H0G I;  1P9N A;  4E2W A;  1M90 1;  3S17 I;  3D6W A;  1YHQ Z;  2WB1 A;  1ZH1 A;  4NB8 A;  4NBF A;  2GTH A;  2K3R A;  2WAQ A;  1L1O C;  1VLA A;  4RVF A;  1Z03 A;  3M4O I;  1RQF A;  1Q81 1;  1YJW 1;  3CPW Y;  4E30 A;  4BY1 I;  1YUK A;  4RVD A;  2OTJ 1;  3TE5 B;  4BBS I;  4Y7N I;  1Q86 1;  1W2B Y;  3I55 Z;  1Y1V I;  2W04 A;  2RHB A;  2OOX B;  2Q51 A;  1Q7Y 2;  5FLX f;  5A2Q f;  2QRC B;  1QYP A;  3QWU A;  4HH4 A;  1PFT A;  1I6H I;  3IFU A;  4DQY B;  3GTO I;  1I3Q I;  3ESW A;  2ZAE B;  3KIF A;  3T4N B;  1YJW Z;  1YI2 1;  3TDH B;  2OTJ Z;  1NUI A;  4QTU A;  3S2H I;  3NDJ A;  3S2D I;  1TWG I;  3EER A;  2JS4 A;  5CM2 M;  1Q7Y 1;  2R93 I;  3CCS 1;  3CC4 1;  4TNU A;  1WII A;  3P5J B;  2P28 A;  2RPR A;  4A3J I;  2VF1 A;  1USP B;  4HGY A;  1YI2 Z;  2M48 A;  3CME 1;  2JUB A;  3JAM f;  1NJI 2;  2F4O A;  1K9M 2;  4X6A I;  2M6N A;  3NH8 A;  4E33 A;  3S16 I;  4NBE A;  5C4J I;  3CCS Z;  3CC4 Z;  1Q82 1;  1K8A 1;  1RO2 A;  1DL6 A;  2PM9 A;  1X3W A;  1N8R 1;  3CC2 1;  4MRI A;  2H85 A;  2NVT I;  1M90 2;  3CME Z;  3VMH A;  1QF8 A;  2R7Z I;  4NBC A;  4E2Z A;  2VUG A;  1QVG Z;  4NBB A;  3CCU 1;  2O53 A;  4NFR A;  1R9T I;  1Q81 2;  4A3K I;  1VQ9 1;  3I56 1;  3CC2 Z;  3FQQ A;  2DE5 A;  1Q86 2;  3F3F C;  4AYB A;  1VQO 1;  5FLX b;  5A2Q b;  2KPI A;  2QA4 1;  2JA8 I;  3HOU I;  2RT9 A;  3S15 I;  2I3C A;  3MZL B;  5IP9 I;  3NH5 A;  1Y1V S;  1SFO I;  4A3B I;  4NOZ A;  5IT9 f;  5T64 A;  3OW2 Y;  3CCU Z;  2GTI A;  3M3Y I;  2HU9 A;  1USP A;  3KIH A;  1VQ9 Z;  1LQL A;  4RVH A;  3CCV 1;  3MZK B;  3I56 Z;  3G71 1;  1K83 I;  1YJN 1;  1RO4 A;  1YIJ 1;  4A3C I;  4BY7 I;  2OOY B;  1VQO Z;  3I07 A;  1VQN 1;  2QA4 Z;  1KRL A;  4MD8 A;  3RZD I;  2DE6 A;  3K7A I;  4EWC A;  2E2H I;  2NVX I;  4QTT A;  2EGT A;  1YUA A;  3JAM b;  1Z01 A;  4A3L I;  4E31 A;  3CCV Z;  2YU9 I;  1K73 2;  1YJN Z;  1YIJ Z;  4RS4 A;  1N2F A;  1TWC I;  1TWA I;  3D9X A;  1QVG Y;  2QRD B;  2V8K A;  1VQN Z;  4S1T A;  3CXC Z;  4E32 A;  5D1O A;  4MD9 A;  2VUM I;  1Q82 2;  1K8A 2;  1VQ4 1;  4MXU A;  2IZ4 A;  3CC7 1;  1N8R 2;  3GTP I;  3G4S 1;  1RNI A;  3PO3 I;  2P3Y A;  1TFI A;  1TWH I;  1ZB8 A;  3S1R I;  4NB9 A;  4A93 I;  1K73 1;  1VQP 1;  3GTK I;  2QKD A;  3J7A 4;  3VMI A;  2V8J A;  5T6B A;  1VQ5 1;  1Y1W I;  1VQ4 Z;  4BXX I;  3S1Q I;  3CC7 Z;  2JA6 I;  3G6E 1;  2PMZ A;  3CMA 1;  2LFU A;  3G4S Z;  3CCE 1;  1JJ2 Z;  4HGZ A;  2QEX 1;  1VQ6 1;  1X3Z A;  5AN9 F;  3NH4 A;  4A3I I;  3S1N I;  5IT9 b;  2J6A A;  1VQP Z;  2NVY I;  3RZO I;  4MON A;  2QLV B;  1VQ5 Z;  4NBG A;  1X0T A;  2PK7 A;  2Q4Z A;  2R6M A;  4RV9 A;  5D1O B;  3G6E Z;  3CMA Z;  3CCE Z;  1VQL 1;  2KI7 B;  4MD7 A;  1S7M A;  2JA7 I;  2QEX Z;  1VQ6 Z;  1NP6 A;  1WCM I;  3CXC Y;  4DGL A;  3VMG A;  1VQK 1;  2QR1 B;  5T67 A;  3BG1 B;  3HOV I;  1KC8 1;  3J81 f;  3NDI A;  2JMO A;  4NH1 C;  1M1K 1;  3FKI I;  4E2Y A;  4BBR I;  3I4N I;  4NBD A;  1VQL Z;  3HOX I;  2OZK A;  1QVF Z;  3HOW I;  4RVG A;  1TWF I;  2GU2 A;  3VB9 A;  1JWH C;  3BG0 B;  3LUS A;  3J80 f;  1VQK Z;  2W03 A;  4A3E I;  2F4M A;  3GTM I;  3CD6 1;  1KD1 1;  3GTJ I;  3U50 C;  1YJ9 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...