3CMA1

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cma100
1N8R2 1VQLZ 1VQKZ 1KC81 3CCMZ 3CCEZ 1N8R1 1Q7Y2 3CME1 3CCSZ 1VQN1 1VQ5Z 1VQ6Z 1QVGY 3I55Z 1YHQZ 1Q821 1KD12 3CC21 1VQL1 1VQP1 1YJN1 1VQK1 3CMAZ 2OTJZ 1YJWZ 3OW2Y 1K9M1 1KQSZ 1Q861 3CCL1 1YIT1 2OTLZ 3CC4Z 3G6EZ 1YJ9Z 1K731 1VQO1 3CCQ1 1Q822 1YI2Z 1VQ71 2QA41 2OTL1 1W2BZ 3CCU1 3CD6Z 1S721 1W2BY 2QEX1 3G71Z 1YIJZ 1K9M2 1Q862 1VQ4Z 1JJ2Z 3G4SZ 1JJ2Y 3CCJZ 3CCM1 3CCE1 3CCS1 1VQ51 3CXCZ 1VQ61 3CC7Z 1KQSY 3CXCY 3I551 3CCVZ 1YHQ1 1K732 3I56Z 3CMA1 1VQ8Z 2OTJ1 1YJW1 1VQMZ 1QVFZ 3CC41 3CCRZ 1VQ9Z 1M901 3G6E1 1YJ91 1M1K1 1YI21 1VQNZ 3CD61 1Q811 3G711 1YIJ1 3CC2Z 1VQ41 1VQPZ 1YJNZ 1K8A1 3G4S1 1NJI1 3CCJ1 1QVGZ 3CCLZ 3CC71 1M902 3CCV1 1YITZ 1QVFY 3I561 1Q7Y1 3OW2Z 1M1K2 1VQ81 1KD11 1Q812 1VQOZ 1VQM1 3CCQZ 3CPWZ 1VQ7Z 2QA4Z 3CPWY 1K8A2 3CCUZ 3CMEZ 1KC82 3CCR1 1VQ91 1S72Z 1NJI2 2QEXZ
chains in the Genus database with same CATH superfamily
4NBBA 4RVGA 1N8R2 1VQLZ 3D2LA 5C44I 2B63I 1Y1WI 1Q7Y2 3CME1 1SIWA 2QRDB 5IT9b 3HOZI 2VUMI 3JAMf 1VQK1 2V8IA 2JIQA 2OTJZ 3GTOI 1YJWZ 4NBAA 2RT9A 3CCL1 3I4MI 1RLYA 4E2ZA 1YIT1 2RHBA 3P5JB 2EGTA 1TWHI 3JAMb 2KPIA 1TWFI 1RO4A 1QF8A 5CM2M 3CCQ1 2KI7B 1VQ71 2OTL1 4MONA 3CD6Z 1S721 1USPB 3S2HI 1Z02A 3IF8A 2F4MA 4A3BI 3HOYI 5D1PA 2NVQI 2VF1A 3S17I 4MD8A 3S14I 3CXCZ 4S1TA 3FQQA 1KQSY 3VMIA 3CXCY 1N2FA 1X0TA 2OTJ1 3NFZA 1YJW1 2RIQA 2I3CA 4E30A 3TE5B 2PMZA 4CL1A 3NH8A 2V45A 2OOYB 2IZ3A 2IV2X 1M901 4A3CI 1LQLA 1TWCI 1K83I 3CD61 2AKLA 4E2WA 2HF1A 4MRIA 4A3JI 3NH4A 3PO2I 4EWCA 4XX2A 3VMGA 4NFRA 1RO0A 4TNUA 4NBCA 4BBSI 3ESWA 3IFUA 1QVFY 1Q7Y1 2E2JI 1M1K2 2JIOA 4RVDA 1Y8CA 2QA4Z 1K8A2 2H85A 3CMEZ 1KC82 4QTTA 2QEXZ 3FQMA 1VQKZ 2RBLA 1WW9A 3H3VJ 3QWUA 5C4XI 3GKQA 1USPA 1QVGY 3S1NI 2P3YA 2W03A 1YHQZ 3BG1B 3GTKI 3F3FC 3S16I 3OW2Y 4A3GI 4X6AI 1VLAA 2OTLZ 4Y7NI 1Y1VS 2IZ4A 1I6HI 3G6EZ 1YJ9Z 3KIFA 4MD7A 1RNIA 3HOVI 4NBEA 3J7A4 2M6NA 2VPYA 2QA41 2E7ZA 2GTHA 4NBDA 4A3II 5IP7I 2QEX1 4A3KI 4A3LI 1Q862 1VQ4Z 3HOXI 2ZAEB 2VPZA 3CCJZ 2QREB 4RS4A 3CC7Z 1WJ2A 3CCVZ 1YHQ1 3FKII 3GCFA 3HKZA 1Y1VI 4DQYB 1VQMZ 2O53A 2WAQA 1S7MA 1PFTA 4NOZA 3S1MI 2PM9A 3G6E1 2J6AA 1YJ91 2K5RA 1NUIA 3CQZI 4NB9A 2JA5I 4HGZA 1L1OC 2JIMA 1M1K1 4A3DI 2BJOA 2JUBA 2NAPA 3MZKB 4RVHA 1NP6A 1VQ41 1VQPZ 1K8A1 3Q87A 1ZB8A 5D1OA 3GTLI 3CCJ1 3S1RI 2JS4A 3GTGI 1I3QI 3CC71 4MD9A 3CCV1 4A3EI 4DGLA 2V8JA 1VQOZ 1VQM1 3F3PC 1WCMI 1NJI2 2V8KA 2YU9I 3D9XA 1DL6A 2PK7A 4NH1C 1RQFA 4HH4A 3CCMZ 3CCEZ 1N8R1 1VQ5Z 3GTMS 3I55Z 1KD12 5C3EI 1VQP1 3CMAZ 3NH5A 5T64A 3J80f 1Q861 4NB8A 4RV9A 1P9NA 2VPXA 3CC4Z 2VUGA 4HGYA 2QLVB 4BY7I 3BG0B 1Q16A 4E32A 3J80b 1VQO1 3NDIA 1Q822 3IR7A 3G71Z 1KRLA 2HU9A 4A3MI 1K9M2 3GTMI 1JJ2Z 2O4HA 3VTNA 2WB1A 1JJ2Y 2E9HA 3VB9A 3CCM1 3CCE1 3VMHA 1VQ51 2JR6A 1X3ZA 3I551 5T6BA 1K732 3I56Z 3TDHB 1VQ8Z 3CMA1 4MXUA 1FDIA 3S1QI 3GTQI 5IP9I 3M3YI 2JIPA 1TWAI 4BXXI 3CC41 1FDOA 4NBHA 1ML8A 3RZOI 4BY1I 2Q51A 1VQNZ 2E2II 3G711 2QR1B 3CC2Z 4DK1A 1YJNZ 1NJI1 2NVTI 1WIIA 3EERA 2OZKA 2GU2A 3I561 1Z01A 1VQ81 2DE5A 4NBGA 3U50C 1TFIA 3D6WA 1KD11 2LIYA 2P28A 1Q812 4MH4A 5AN9F 3CCUZ 2JA8I 4RVFA 3EEDA 3GTPI 1KC81 5T67A 2E2HI 1VQN1 3KIHA 3CCSZ 1VQ6Z 2GTIA 3I4NI 1SFOI 1Q821 1TWGI 1ZH1A 3J81f 1QYPA 3CC21 2RPRA 2G2KA 1YJN1 2AYDA 1VQL1 1I50I 2R92I 3MONA 4QTUA 1K9M1 1KQSZ 5C4JI 3NDJA 2JNYA 4AYBA 3J81b 2R93I 2YADA 2DE6A 2QKDA 3IX0A 5LL6f 1RO2A 1WZNA 1K731 1YI2Z 2JA6I 1X3WA 5FLXf 1JWHC 3CCU1 2LEXA 1W2BZ 1W2BY 1Z03A 3MZLB 1YIJZ 2LFUA 3G4SZ 2JMOA 4A3FI 3S2DI 4E2YA 3PO3S 3CCS1 1VQ61 5FLXb 2NVYI 2DE7A 4E2XA 5A2Qf 1YUAA 3GTJI 2JIRA 2QRCB 1QVFZ 1R9TI 2OOXB 3CCRZ 1VQ9Z 2M48A 3I07A 2Y0SA 5A2Qb 3M4OI 5FLMI 1QXFA 1ZB9A 2V3VA 1AA6A 1YI21 2R7ZI 2NVXI 4Y52I 3HOWI 3PO3I 1Q811 4A93I 4NBFA 2W04A 1YIJ1 3T4NB 4E31A 3G4S1 5D1OB 2JA7I 3K7AI 2R6MA 1QVGZ 3CCLZ 1M902 1YITZ 3H0GI 3OW2Z 2F4OA 4BBRI 2VPWA 4E33A 3LUSA 3S15I 2Q4ZA 3CCQZ 3CPWZ 3HOUI 1VQ7Z 1YUKA 3CPWY 5IT9f 3RZDI 3CCR1 1VQ91 1S72Z 2K3RA
chains in the Genus database with same CATH topology
4NBBA 4RVGA 1N8R2 1VQLZ 5C44I 2B63I 1Y1WI 1Q7Y2 3CME1 2QRDB 5IT9b 3HOZI 2VUMI 3JAMf 1VQK1 2V8IA 2OTJZ 3GTOI 1YJWZ 4NBAA 2RT9A 3CCL1 3I4MI 1RLYA 4E2ZA 1YIT1 2RHBA 3P5JB 2EGTA 1TWHI 3JAMb 2KPIA 1TWFI 1RO4A 1QF8A 5CM2M 3CCQ1 2KI7B 1VQ71 2OTL1 4MONA 3CD6Z 1S721 1USPB 3S2HI 1Z02A 3IF8A 2F4MA 4A3BI 3HOYI 5D1PA 2NVQI 2VF1A 3S17I 4MD8A 3S14I 3CXCZ 4S1TA 3FQQA 1KQSY 3VMIA 3CXCY 1N2FA 1X0TA 2OTJ1 3NFZA 1YJW1 2RIQA 2I3CA 4E30A 3TE5B 2PMZA 4CL1A 3NH8A 2OOYB 2IZ3A 1M901 4A3CI 1LQLA 1TWCI 1K83I 3CD61 2AKLA 4E2WA 2HF1A 4MRIA 4A3JI 3NH4A 3PO2I 4EWCA 4XX2A 3VMGA 4NFRA 1RO0A 4TNUA 4NBCA 4BBSI 3ESWA 3IFUA 1QVFY 1Q7Y1 2E2JI 1M1K2 4RVDA 2QA4Z 1K8A2 2H85A 3CMEZ 1KC82 4QTTA 2QEXZ 3FQMA 1VQKZ 2RBLA 1WW9A 3H3VJ 3QWUA 5C4XI 3GKQA 1USPA 1QVGY 3S1NI 2P3YA 2W03A 1YHQZ 3BG1B 3GTKI 3F3FC 3S16I 3OW2Y 4A3GI 4X6AI 1VLAA 2OTLZ 4Y7NI 1Y1VS 2IZ4A 1I6HI 3G6EZ 1YJ9Z 3KIFA 4MD7A 1RNIA 3HOVI 4NBEA 3J7A4 2M6NA 2QA41 2GTHA 4NBDA 4A3II 5IP7I 2QEX1 4A3KI 4A3LI 1Q862 1VQ4Z 3HOXI 2ZAEB 3CCJZ 2QREB 4RS4A 3CC7Z 3CCVZ 1YHQ1 3FKII 3GCFA 3HKZA 1Y1VI 4DQYB 1VQMZ 2O53A 2WAQA 1S7MA 1PFTA 4NOZA 3S1MI 2PM9A 3G6E1 2J6AA 1YJ91 2K5RA 1NUIA 3CQZI 4NB9A 2JA5I 4HGZA 1L1OC 1M1K1 4A3DI 2BJOA 2JUBA 3MZKB 4RVHA 1NP6A 1VQ41 1VQPZ 1K8A1 3Q87A 1ZB8A 5D1OA 3GTLI 3CCJ1 3S1RI 2JS4A 3GTGI 1I3QI 3CC71 4MD9A 3CCV1 4A3EI 4DGLA 2V8JA 1VQOZ 1VQM1 3F3PC 1WCMI 1NJI2 2V8KA 2YU9I 3D9XA 1DL6A 2PK7A 4NH1C 1RQFA 4HH4A 3CCMZ 3CCEZ 1N8R1 1VQ5Z 3GTMS 3I55Z 1KD12 5C3EI 1VQP1 3CMAZ 3NH5A 5T64A 3J80f 1Q861 4NB8A 4RV9A 1P9NA 3CC4Z 2VUGA 4HGYA 2QLVB 4BY7I 3BG0B 4E32A 3J80b 1VQO1 3NDIA 1Q822 3G71Z 1KRLA 2HU9A 4A3MI 1K9M2 3GTMI 1JJ2Z 2O4HA 3VTNA 2WB1A 1JJ2Y 2E9HA 3VB9A 3CCM1 3CCE1 3VMHA 1VQ51 2JR6A 1X3ZA 3I551 5T6BA 1K732 3I56Z 3TDHB 1VQ8Z 3CMA1 4MXUA 3S1QI 3GTQI 5IP9I 3M3YI 1TWAI 4BXXI 3CC41 4NBHA 1ML8A 3RZOI 4BY1I 2Q51A 1VQNZ 2E2II 3G711 2QR1B 3CC2Z 4DK1A 1YJNZ 1NJI1 2NVTI 1WIIA 3EERA 2OZKA 2GU2A 3I561 1Z01A 1VQ81 2DE5A 4NBGA 3U50C 1TFIA 3D6WA 1KD11 2LIYA 2P28A 1Q812 4MH4A 5AN9F 3CCUZ 2JA8I 4RVFA 3EEDA 3GTPI 1KC81 5T67A 2E2HI 1VQN1 3KIHA 3CCSZ 1VQ6Z 2GTIA 3I4NI 1SFOI 1Q821 1TWGI 1ZH1A 3J81f 1QYPA 3CC21 2RPRA 2G2KA 1YJN1 1VQL1 1I50I 2R92I 3MONA 4QTUA 1K9M1 1KQSZ 5C4JI 3NDJA 2JNYA 4AYBA 3J81b 2R93I 2YADA 2DE6A 2QKDA 3IX0A 5LL6f 1RO2A 1K731 1YI2Z 2JA6I 1X3WA 5FLXf 1JWHC 3CCU1 1W2BZ 1W2BY 1Z03A 3MZLB 1YIJZ 2LFUA 3G4SZ 2JMOA 4A3FI 3S2DI 4E2YA 3PO3S 3CCS1 1VQ61 5FLXb 2NVYI 2DE7A 4E2XA 5A2Qf 1YUAA 3GTJI 2QRCB 1QVFZ 1R9TI 2OOXB 3CCRZ 1VQ9Z 2M48A 3I07A 2Y0SA 5A2Qb 3M4OI 5FLMI 1ZB9A 1YI21 2R7ZI 2NVXI 4Y52I 3HOWI 3PO3I 1Q811 4A93I 4NBFA 2W04A 1YIJ1 3T4NB 4E31A 3G4S1 5D1OB 2JA7I 3K7AI 2R6MA 1QVGZ 3CCLZ 1M902 1YITZ 3H0GI 3OW2Z 2F4OA 4BBRI 4E33A 3LUSA 3S15I 2Q4ZA 3CCQZ 3CPWZ 3HOUI 1VQ7Z 1YUKA 3CPWY 5IT9f 3RZDI 3CCR1 1VQ91 1S72Z 2K3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 2;  1VQL Z;  1VQK Z;  1KC8 1;  3CCM Z;  3CCE Z;  1N8R 1;  1Q7Y 2;  3CME 1;  3CCS Z;  1VQN 1;  1VQ5 Z;  1VQ6 Z;  1QVG Y;  3I55 Z;  1YHQ Z;  1Q82 1;  1KD1 2;  3CC2 1;  1VQL 1;  1VQP 1;  1YJN 1;  1VQK 1;  3CMA Z;  2OTJ Z;  1YJW Z;  3OW2 Y;  1K9M 1;  1KQS Z;  1Q86 1;  3CCL 1;  1YIT 1;  2OTL Z;  3CC4 Z;  3G6E Z;  1YJ9 Z;  1K73 1;  1VQO 1;  3CCQ 1;  1Q82 2;  1YI2 Z;  1VQ7 1;  2QA4 1;  2OTL 1;  1W2B Z;  3CCU 1;  3CD6 Z;  1S72 1;  1W2B Y;  2QEX 1;  3G71 Z;  1YIJ Z;  1K9M 2;  1Q86 2;  1VQ4 Z;  1JJ2 Z;  3G4S Z;  1JJ2 Y;  3CCJ Z;  3CCM 1;  3CCE 1;  3CCS 1;  1VQ5 1;  3CXC Z;  1VQ6 1;  3CC7 Z;  1KQS Y;  3CXC Y;  3I55 1;  3CCV Z;  1YHQ 1;  1K73 2;  3I56 Z;  3CMA 1;  1VQ8 Z;  2OTJ 1;  1YJW 1;  1VQM Z;  1QVF Z;  3CC4 1;  3CCR Z;  1VQ9 Z;  1M90 1;  3G6E 1;  1YJ9 1;  1M1K 1;  1YI2 1;  1VQN Z;  3CD6 1;  1Q81 1;  3G71 1;  1YIJ 1;  3CC2 Z;  1VQ4 1;  1VQP Z;  1YJN Z;  1K8A 1;  3G4S 1;  1NJI 1;  3CCJ 1;  1QVG Z;  3CCL Z;  3CC7 1;  1M90 2;  3CCV 1;  1YIT Z;  1QVF Y;  3I56 1;  1Q7Y 1;  3OW2 Z;  1M1K 2;  1VQ8 1;  1KD1 1;  1Q81 2;  1VQO Z;  1VQM 1;  3CCQ Z;  3CPW Z;  1VQ7 Z;  2QA4 Z;  3CPW Y;  1K8A 2;  3CCU Z;  3CME Z;  1KC8 2;  3CCR 1;  1VQ9 1;  1S72 Z;  1NJI 2;  2QEX Z; 
#chains in the Genus database with same CATH topology
 4NBB A;  4RVG A;  1N8R 2;  1VQL Z;  3D2L A;  5C44 I;  2B63 I;  1Y1W I;  1Q7Y 2;  3CME 1;  1SIW A;  2QRD B;  5IT9 b;  3HOZ I;  2VUM I;  3JAM f;  1VQK 1;  2V8I A;  2JIQ A;  2OTJ Z;  3GTO I;  1YJW Z;  4NBA A;  2RT9 A;  3CCL 1;  3I4M I;  1RLY A;  4E2Z A;  1YIT 1;  2RHB A;  3P5J B;  2EGT A;  1TWH I;  3JAM b;  2KPI A;  1TWF I;  1RO4 A;  1QF8 A;  5CM2 M;  3CCQ 1;  2KI7 B;  1VQ7 1;  2OTL 1;  4MON A;  3CD6 Z;  1S72 1;  1USP B;  3S2H I;  1Z02 A;  3IF8 A;  2F4M A;  4A3B I;  3HOY I;  5D1P A;  2NVQ I;  2VF1 A;  3S17 I;  4MD8 A;  3S14 I;  3CXC Z;  4S1T A;  3FQQ A;  1KQS Y;  3VMI A;  3CXC Y;  1N2F A;  1X0T A;  2OTJ 1;  3NFZ A;  1YJW 1;  2RIQ A;  2I3C A;  4E30 A;  3TE5 B;  2PMZ A;  4CL1 A;  3NH8 A;  2V45 A;  2OOY B;  2IZ3 A;  2IV2 X;  1M90 1;  4A3C I;  1LQL A;  1TWC I;  1K83 I;  3CD6 1;  2AKL A;  4E2W A;  2HF1 A;  4MRI A;  4A3J I;  3NH4 A;  3PO2 I;  4EWC A;  4XX2 A;  3VMG A;  4NFR A;  1RO0 A;  4TNU A;  4NBC A;  4BBS I;  3ESW A;  3IFU A;  1QVF Y;  1Q7Y 1;  2E2J I;  1M1K 2;  2JIO A;  4RVD A;  1Y8C A;  2QA4 Z;  1K8A 2;  2H85 A;  3CME Z;  1KC8 2;  4QTT A;  2QEX Z;  3FQM A;  1VQK Z;  2RBL A;  1WW9 A;  3H3V J;  3QWU A;  5C4X I;  3GKQ A;  1USP A;  1QVG Y;  3S1N I;  2P3Y A;  2W03 A;  1YHQ Z;  3BG1 B;  3GTK I;  3F3F C;  3S16 I;  3OW2 Y;  4A3G I;  4X6A I;  1VLA A;  2OTL Z;  4Y7N I;  1Y1V S;  2IZ4 A;  1I6H I;  3G6E Z;  1YJ9 Z;  3KIF A;  4MD7 A;  1RNI A;  3HOV I;  4NBE A;  3J7A 4;  2M6N A;  2VPY A;  2QA4 1;  2E7Z A;  2GTH A;  4NBD A;  4A3I I;  5IP7 I;  2QEX 1;  4A3K I;  4A3L I;  1Q86 2;  1VQ4 Z;  3HOX I;  2ZAE B;  2VPZ A;  3CCJ Z;  2QRE B;  4RS4 A;  3CC7 Z;  1WJ2 A;  3CCV Z;  1YHQ 1;  3FKI I;  3GCF A;  3HKZ A;  1Y1V I;  4DQY B;  1VQM Z;  2O53 A;  2WAQ A;  1S7M A;  1PFT A;  4NOZ A;  3S1M I;  2PM9 A;  3G6E 1;  2J6A A;  1YJ9 1;  2K5R A;  1NUI A;  3CQZ I;  4NB9 A;  2JA5 I;  4HGZ A;  1L1O C;  2JIM A;  1M1K 1;  4A3D I;  2BJO A;  2JUB A;  2NAP A;  3MZK B;  4RVH A;  1NP6 A;  1VQ4 1;  1VQP Z;  1K8A 1;  3Q87 A;  1ZB8 A;  5D1O A;  3GTL I;  3CCJ 1;  3S1R I;  2JS4 A;  3GTG I;  1I3Q I;  3CC7 1;  4MD9 A;  3CCV 1;  4A3E I;  4DGL A;  2V8J A;  1VQO Z;  1VQM 1;  3F3P C;  1WCM I;  1NJI 2;  2V8K A;  2YU9 I;  3D9X A;  1DL6 A;  2PK7 A;  4NH1 C;  1RQF A;  4HH4 A;  3CCM Z;  3CCE Z;  1N8R 1;  1VQ5 Z;  3GTM S;  3I55 Z;  1KD1 2;  5C3E I;  1VQP 1;  3CMA Z;  3NH5 A;  5T64 A;  3J80 f;  1Q86 1;  4NB8 A;  4RV9 A;  1P9N A;  2VPX A;  3CC4 Z;  2VUG A;  4HGY A;  2QLV B;  4BY7 I;  3BG0 B;  1Q16 A;  4E32 A;  3J80 b;  1VQO 1;  3NDI A;  1Q82 2;  3IR7 A;  3G71 Z;  1KRL A;  2HU9 A;  4A3M I;  1K9M 2;  3GTM I;  1JJ2 Z;  2O4H A;  3VTN A;  2WB1 A;  1JJ2 Y;  2E9H A;  3VB9 A;  3CCM 1;  3CCE 1;  3VMH A;  1VQ5 1;  2JR6 A;  1X3Z A;  3I55 1;  5T6B A;  1K73 2;  3I56 Z;  3TDH B;  1VQ8 Z;  3CMA 1;  4MXU A;  1FDI A;  3S1Q I;  3GTQ I;  5IP9 I;  3M3Y I;  2JIP A;  1TWA I;  4BXX I;  3CC4 1;  1FDO A;  4NBH A;  1ML8 A;  3RZO I;  4BY1 I;  2Q51 A;  1VQN Z;  2E2I I;  3G71 1;  2QR1 B;  3CC2 Z;  4DK1 A;  1YJN Z;  1NJI 1;  2NVT I;  1WII A;  3EER A;  2OZK A;  2GU2 A;  3I56 1;  1Z01 A;  1VQ8 1;  2DE5 A;  4NBG A;  3U50 C;  1TFI A;  3D6W A;  1KD1 1;  2LIY A;  2P28 A;  1Q81 2;  4MH4 A;  5AN9 F;  3CCU Z;  2JA8 I;  4RVF A;  3EED A;  3GTP I;  1KC8 1;  5T67 A;  2E2H I;  1VQN 1;  3KIH A;  3CCS Z;  1VQ6 Z;  2GTI A;  3I4N I;  1SFO I;  1Q82 1;  1TWG I;  1ZH1 A;  3J81 f;  1QYP A;  3CC2 1;  2RPR A;  2G2K A;  1YJN 1;  2AYD A;  1VQL 1;  1I50 I;  2R92 I;  3MON A;  4QTU A;  1K9M 1;  1KQS Z;  5C4J I;  3NDJ A;  2JNY A;  4AYB A;  3J81 b;  2R93 I;  2YAD A;  2DE6 A;  2QKD A;  3IX0 A;  5LL6 f;  1RO2 A;  1WZN A;  1K73 1;  1YI2 Z;  2JA6 I;  1X3W A;  5FLX f;  1JWH C;  3CCU 1;  2LEX A;  1W2B Z;  1W2B Y;  1Z03 A;  3MZL B;  1YIJ Z;  2LFU A;  3G4S Z;  2JMO A;  4A3F I;  3S2D I;  4E2Y A;  3PO3 S;  3CCS 1;  1VQ6 1;  5FLX b;  2NVY I;  2DE7 A;  4E2X A;  5A2Q f;  1YUA A;  3GTJ I;  2JIR A;  2QRC B;  1QVF Z;  1R9T I;  2OOX B;  3CCR Z;  1VQ9 Z;  2M48 A;  3I07 A;  2Y0S A;  5A2Q b;  3M4O I;  5FLM I;  1QXF A;  1ZB9 A;  2V3V A;  1AA6 A;  1YI2 1;  2R7Z I;  2NVX I;  4Y52 I;  3HOW I;  3PO3 I;  1Q81 1;  4A93 I;  4NBF A;  2W04 A;  1YIJ 1;  3T4N B;  4E31 A;  3G4S 1;  5D1O B;  2JA7 I;  3K7A I;  2R6M A;  1QVG Z;  3CCL Z;  1M90 2;  1YIT Z;  3H0G I;  3OW2 Z;  2F4O A;  4BBR I;  2VPW A;  4E33 A;  3LUS A;  3S15 I;  2Q4Z A;  3CCQ Z;  3CPW Z;  3HOU I;  1VQ7 Z;  1YUK A;  3CPW Y;  5IT9 f;  3RZD I;  3CCR 1;  1VQ9 1;  1S72 Z;  2K3R A; 
#chains in the Genus database with same CATH homology
 4NBB A;  4RVG A;  1N8R 2;  1VQL Z;  5C44 I;  2B63 I;  1Y1W I;  1Q7Y 2;  3CME 1;  2QRD B;  5IT9 b;  3HOZ I;  2VUM I;  3JAM f;  1VQK 1;  2V8I A;  2OTJ Z;  3GTO I;  1YJW Z;  4NBA A;  2RT9 A;  3CCL 1;  3I4M I;  1RLY A;  4E2Z A;  1YIT 1;  2RHB A;  3P5J B;  2EGT A;  1TWH I;  3JAM b;  2KPI A;  1TWF I;  1RO4 A;  1QF8 A;  5CM2 M;  3CCQ 1;  2KI7 B;  1VQ7 1;  2OTL 1;  4MON A;  3CD6 Z;  1S72 1;  1USP B;  3S2H I;  1Z02 A;  3IF8 A;  2F4M A;  4A3B I;  3HOY I;  5D1P A;  2NVQ I;  2VF1 A;  3S17 I;  4MD8 A;  3S14 I;  3CXC Z;  4S1T A;  3FQQ A;  1KQS Y;  3VMI A;  3CXC Y;  1N2F A;  1X0T A;  2OTJ 1;  3NFZ A;  1YJW 1;  2RIQ A;  2I3C A;  4E30 A;  3TE5 B;  2PMZ A;  4CL1 A;  3NH8 A;  2OOY B;  2IZ3 A;  1M90 1;  4A3C I;  1LQL A;  1TWC I;  1K83 I;  3CD6 1;  2AKL A;  4E2W A;  2HF1 A;  4MRI A;  4A3J I;  3NH4 A;  3PO2 I;  4EWC A;  4XX2 A;  3VMG A;  4NFR A;  1RO0 A;  4TNU A;  4NBC A;  4BBS I;  3ESW A;  3IFU A;  1QVF Y;  1Q7Y 1;  2E2J I;  1M1K 2;  4RVD A;  2QA4 Z;  1K8A 2;  2H85 A;  3CME Z;  1KC8 2;  4QTT A;  2QEX Z;  3FQM A;  1VQK Z;  2RBL A;  1WW9 A;  3H3V J;  3QWU A;  5C4X I;  3GKQ A;  1USP A;  1QVG Y;  3S1N I;  2P3Y A;  2W03 A;  1YHQ Z;  3BG1 B;  3GTK I;  3F3F C;  3S16 I;  3OW2 Y;  4A3G I;  4X6A I;  1VLA A;  2OTL Z;  4Y7N I;  1Y1V S;  2IZ4 A;  1I6H I;  3G6E Z;  1YJ9 Z;  3KIF A;  4MD7 A;  1RNI A;  3HOV I;  4NBE A;  3J7A 4;  2M6N A;  2QA4 1;  2GTH A;  4NBD A;  4A3I I;  5IP7 I;  2QEX 1;  4A3K I;  4A3L I;  1Q86 2;  1VQ4 Z;  3HOX I;  2ZAE B;  3CCJ Z;  2QRE B;  4RS4 A;  3CC7 Z;  3CCV Z;  1YHQ 1;  3FKI I;  3GCF A;  3HKZ A;  1Y1V I;  4DQY B;  1VQM Z;  2O53 A;  2WAQ A;  1S7M A;  1PFT A;  4NOZ A;  3S1M I;  2PM9 A;  3G6E 1;  2J6A A;  1YJ9 1;  2K5R A;  1NUI A;  3CQZ I;  4NB9 A;  2JA5 I;  4HGZ A;  1L1O C;  1M1K 1;  4A3D I;  2BJO A;  2JUB A;  3MZK B;  4RVH A;  1NP6 A;  1VQ4 1;  1VQP Z;  1K8A 1;  3Q87 A;  1ZB8 A;  5D1O A;  3GTL I;  3CCJ 1;  3S1R I;  2JS4 A;  3GTG I;  1I3Q I;  3CC7 1;  4MD9 A;  3CCV 1;  4A3E I;  4DGL A;  2V8J A;  1VQO Z;  1VQM 1;  3F3P C;  1WCM I;  1NJI 2;  2V8K A;  2YU9 I;  3D9X A;  1DL6 A;  2PK7 A;  4NH1 C;  1RQF A;  4HH4 A;  3CCM Z;  3CCE Z;  1N8R 1;  1VQ5 Z;  3GTM S;  3I55 Z;  1KD1 2;  5C3E I;  1VQP 1;  3CMA Z;  3NH5 A;  5T64 A;  3J80 f;  1Q86 1;  4NB8 A;  4RV9 A;  1P9N A;  3CC4 Z;  2VUG A;  4HGY A;  2QLV B;  4BY7 I;  3BG0 B;  4E32 A;  3J80 b;  1VQO 1;  3NDI A;  1Q82 2;  3G71 Z;  1KRL A;  2HU9 A;  4A3M I;  1K9M 2;  3GTM I;  1JJ2 Z;  2O4H A;  3VTN A;  2WB1 A;  1JJ2 Y;  2E9H A;  3VB9 A;  3CCM 1;  3CCE 1;  3VMH A;  1VQ5 1;  2JR6 A;  1X3Z A;  3I55 1;  5T6B A;  1K73 2;  3I56 Z;  3TDH B;  1VQ8 Z;  3CMA 1;  4MXU A;  3S1Q I;  3GTQ I;  5IP9 I;  3M3Y I;  1TWA I;  4BXX I;  3CC4 1;  4NBH A;  1ML8 A;  3RZO I;  4BY1 I;  2Q51 A;  1VQN Z;  2E2I I;  3G71 1;  2QR1 B;  3CC2 Z;  4DK1 A;  1YJN Z;  1NJI 1;  2NVT I;  1WII A;  3EER A;  2OZK A;  2GU2 A;  3I56 1;  1Z01 A;  1VQ8 1;  2DE5 A;  4NBG A;  3U50 C;  1TFI A;  3D6W A;  1KD1 1;  2LIY A;  2P28 A;  1Q81 2;  4MH4 A;  5AN9 F;  3CCU Z;  2JA8 I;  4RVF A;  3EED A;  3GTP I;  1KC8 1;  5T67 A;  2E2H I;  1VQN 1;  3KIH A;  3CCS Z;  1VQ6 Z;  2GTI A;  3I4N I;  1SFO I;  1Q82 1;  1TWG I;  1ZH1 A;  3J81 f;  1QYP A;  3CC2 1;  2RPR A;  2G2K A;  1YJN 1;  1VQL 1;  1I50 I;  2R92 I;  3MON A;  4QTU A;  1K9M 1;  1KQS Z;  5C4J I;  3NDJ A;  2JNY A;  4AYB A;  3J81 b;  2R93 I;  2YAD A;  2DE6 A;  2QKD A;  3IX0 A;  5LL6 f;  1RO2 A;  1K73 1;  1YI2 Z;  2JA6 I;  1X3W A;  5FLX f;  1JWH C;  3CCU 1;  1W2B Z;  1W2B Y;  1Z03 A;  3MZL B;  1YIJ Z;  2LFU A;  3G4S Z;  2JMO A;  4A3F I;  3S2D I;  4E2Y A;  3PO3 S;  3CCS 1;  1VQ6 1;  5FLX b;  2NVY I;  2DE7 A;  4E2X A;  5A2Q f;  1YUA A;  3GTJ I;  2QRC B;  1QVF Z;  1R9T I;  2OOX B;  3CCR Z;  1VQ9 Z;  2M48 A;  3I07 A;  2Y0S A;  5A2Q b;  3M4O I;  5FLM I;  1ZB9 A;  1YI2 1;  2R7Z I;  2NVX I;  4Y52 I;  3HOW I;  3PO3 I;  1Q81 1;  4A93 I;  4NBF A;  2W04 A;  1YIJ 1;  3T4N B;  4E31 A;  3G4S 1;  5D1O B;  2JA7 I;  3K7A I;  2R6M A;  1QVG Z;  3CCL Z;  1M90 2;  1YIT Z;  3H0G I;  3OW2 Z;  2F4O A;  4BBR I;  4E33 A;  3LUS A;  3S15 I;  2Q4Z A;  3CCQ Z;  3CPW Z;  3HOU I;  1VQ7 Z;  1YUK A;  3CPW Y;  5IT9 f;  3RZD I;  3CCR 1;  1VQ9 1;  1S72 Z;  2K3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...