3CMA1

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cma100
3CCLZ 1YJ9Z 1YJWZ 2OTJ1 3CC41 1VQO1 3CD61 3CCJZ 1VQOZ 1YJN1 1K9M1 1YIJZ 1VQ5Z 1YJNZ 2QEXZ 1Q812 1Q862 3CCR1 1KQSZ 1KD12 3CCRZ 1VQM1 1W2BY 3G71Z 3CC2Z 2OTL1 1VQ81 1VQP1 1KC81 3CC7Z 1S721 3CCU1 3G711 2OTLZ 1YHQZ 1QVGZ 1N8R1 3CCE1 3CCQ1 1Q7Y2 1VQPZ 3CC21 3CCM1 1VQ61 3G4SZ 1M1K2 2QA4Z 3CMEZ 1Q821 1VQMZ 1NJI1 3CXCY 2QA41 3CMAZ 1KD11 3G6E1 1KQSY 1YI21 1JJ2Z 1K8A2 1W2BZ 3I561 1K731 3CCSZ 1VQK1 1YITZ 1M901 1KC82 3CCS1 1VQN1 3OW2Z 3CPWZ 3CCUZ 3CME1 1VQLZ 3CC4Z 1JJ2Y 1YHQ1 3CCMZ 1VQ6Z 1K9M2 1VQKZ 1QVFZ 1Q7Y1 1Q861 1QVGY 3CCVZ 1VQ51 3CPWY 1VQL1 3CD6Z 1NJI2 3OW2Y 3I56Z 1VQ71 3CCEZ 3CCQZ 3CMA1 3I551 1YIJ1 3G6EZ 1K8A1 1K732 3CCL1 1YJ91 2OTJZ 1VQ41 3I55Z 1VQ4Z 1N8R2 1M1K1 1Q811 1VQ91 1YJW1 1VQNZ 3G4S1 1QVFY 3CC71 1S72Z 1Q822 3CXCZ 1YI2Z 1VQ9Z 1VQ8Z 3CCV1 3CCJ1 2QEX1 1YIT1 1M902 1VQ7Z
chains in the Genus database with same CATH superfamily
2VPZA 2OTJ1 1YJWZ 4Y7NI 1VQO1 5FLMI 3CCJZ 4BBSI 3GCFA 4A93I 1R9TI 2RHBA 4NBGA 1NP6A 3J80f 1X3ZA 1KQSZ 2P28A 3G71Z 3JAMb 5IT9f 4RVFA 5A2Qb 1KC81 3CC7Z 3CCU1 1QF8A 2PM9A 3IX0A 2GU2A 1N8R1 2E2HI 3CCE1 4MRIA 2QREB 1RQFA 3D6WA 4RVHA 1I6HI 1K83I 3PO3I 3RZOI 3VMIA 1RLYA 2VPXA 3S16I 4E2ZA 1TWAI 3CMAZ 1KD11 3FQMA 3CCSZ 1M901 1KC82 2AYDA 4RVDA 1JJ2Y 1RO0A 2OZKA 4E31A 4A3EI 4A3FI 3GTMS 3IFUA 4NB9A 4AYBA 1K9M2 1Q16A 1VQKZ 1Q861 1L1OC 5LL6f 3CCVZ 1DL6A 2IZ4A 5IP7I 4A3BI 3ESWA 3J81f 2E2II 3I551 1WCMI 4E33A 3J7A4 5T67A 4A3DI 3U50C 1Q811 4NOZA 4BXXI 2J6AA 1VQNZ 2V3VA 3GTPI 4E2YA 3HKZA 3GTOI 1P9NA 4E2XA 1VQ8Z 2YADA 4A3GI 3CCJ1 2QEX1 1ML8A 4NBCA 2JA5I 4TNUA 3CC41 3D2LA 3VMGA 3CD61 1SFOI 2VPYA 1K9M1 3MZKB 2RT9A 2JS4A 3IR7A 2VPWA 4A3MI 4EWCA 1YJNZ 2Q4ZA 2I3CA 1ZB9A 5IP9I 2M48A 3P5JB 2QEXZ 4E2WA 2ZAEB 1YUKA 3BG1B 3CCR1 3F3FC 2JNYA 2V8KA 2NVTI 3S2DI 2GTHA 2QR1B 5D1OA 1PFTA 1S721 2E9HA 2V45A 5D1OB 1Q7Y2 3NH5A 2IZ3A 2JIMA 1JWHC 1VQPZ 1USPA 1QXFA 2QA4Z 1TWCI 1NJI1 4E30A 3QWUA 3CXCY 2LIYA 4RVGA 3GTQI 3PO2I 4MD8A 1S7MA 3KIFA 3G6E1 3MZLB 1KQSY 3S15I 1W2BZ 4RV9A 5A2Qf 3GTLI 1VQK1 4MONA 3CCUZ 3NDJA 3CC4Z 4HGZA 2RPRA 3S1NI 2QRDB 2R6MA 1VQL1 1N2FA 1NJI2 4HGYA 3I4MI 3Q87A 3CCQZ 3CMA1 2JIRA 1Z03A 2P3YA 1K8A1 3VB9A 1ZH1A 1VQ41 1RNIA 1N8R2 2KI7B 2O4HA 3VTNA 1KRLA 3NDIA 1USPB 2JA7I 1QVFY 3CC71 2PMZA 4MD9A 3CXCZ 2VUMI 1VQ9Z 3J80b 3EERA 1YIT1 1VLAA 3MONA 1ZB8A 2DE5A 2QLVB 1WW9A 2HF1A 1YUAA 2LEXA 4BBRI 1VQOZ 1YIJZ 2Y0SA 1WZNA 1Q862 1KD12 3HOUI 1W2BY 1RO2A 1VQM1 2K3RA 3CC2Z 2GTIA 2VUGA 3H3VJ 4DGLA 1VQ81 1VQP1 1TWGI 1FDIA 2EGTA 5C44I 2M6NA 2OTLZ 1YHQZ 2DE6A 1QVGZ 3FKII 4BY1I 2HU9A 2V8IA 3CC21 4NBEA 2Q51A 3CCM1 1VQ61 5C3EI 3M4OI 3HOYI 4Y52I 1TFIA 3HOWI 1FDOA 1Q821 1VQMZ 5T64A 2JA8I 2NAPA 4MH4A 2F4OA 4A3JI 1JJ2Z 5AN9F 3PO3S 1YITZ 3CCS1 3K7AI 4S1TA 1VQN1 3CPWZ 3HOZI 1VQLZ 1WJ2A 3CCMZ 1VQ6Z 3S2HI 1NUIA 1TWHI 3KIHA 1QVFZ 4QTUA 2QRCB 3CPWY 1Y8CA 4NB8A 4DQYB 1Z01A 3H0GI 3CD6Z 3GTKI 4HH4A 1TWFI 1QYPA 3F3PC 3OW2Y 1Z02A 3NFZA 1VQ71 3CCEZ 2W03A 1X3WA 3G6EZ 2H85A 1X0TA 3GTJI 3TDHB 4XX2A 3CCL1 1YJ91 4RS4A 4MD7A 4NFRA 1VQ91 2W04A 4A3CI 2OOYB 1S72Z 2R92I 2QKDA 1Y1VI 1YI2Z 3JAMf 1Y1VS 3CCV1 4A3LI 1M902 4A3II 2KPIA 3CCLZ 1YJ9Z 1RO4A 2WAQA 2DE7A 3EEDA 2E2JI 1YJN1 2OOXB 2JIPA 3BG0B 1VQ5Z 1Y1WI 3GKQA 2NVQI 4NBHA 3LUSA 1I50I 1Q812 2PK7A 3CCRZ 3IF8A 2NVXI 1SIWA 2OTL1 2JUBA 3S14I 5C4XI 3I4NI 3G711 3TE5B 4NBBA 2R93I 3CCQ1 3S1MI 2O53A 3G4SZ 2JIQA 5C4JI 1M1K2 3I07A 3CMEZ 2RIQA 4NBDA 3GTGI 2JMOA 2QA41 2E7ZA 1AA6A 2WB1A 3J81b 4MXUA 1YI21 1K8A2 3I561 1K731 3CQZI 3NH4A 4A3KI 3RZDI 3FQQA 2JIOA 3D9XA 3OW2Z 3CME1 2B63I 1YHQ1 2YU9I 3S1RI 3NH8A 5FLXf 1Q7Y1 1QVGY 1VQ51 4NH1C 2LFUA 5IT9b 2VF1A 2BJOA 3HOXI 4DK1A 3GTMI 3I56Z 2G2KA 5T6BA 2K5RA 2NVYI 1YIJ1 1WIIA 3M3YI 4BY7I 3VMHA 4CL1A 5FLXb 1K732 2RBLA 2OTJZ 2V8JA 4X6AI 5D1PA 2IV2X 3I55Z 1VQ4Z 3S1QI 1M1K1 4NBFA 3T4NB 1YJW1 2R7ZI 1LQLA 3S17I 3G4S1 2JR6A 4E32A 2AKLA 4QTTA 1Q822 2F4MA 2JA6I 3HOVI 4NBAA 1I3QI 5CM2M 1VQ7Z
chains in the Genus database with same CATH topology
2OTJ1 1YJWZ 4Y7NI 1VQO1 5FLMI 3CCJZ 4BBSI 3GCFA 4A93I 1R9TI 2RHBA 4NBGA 1NP6A 3J80f 1X3ZA 1KQSZ 2P28A 3G71Z 3JAMb 5IT9f 4RVFA 5A2Qb 1KC81 3CC7Z 3CCU1 1QF8A 2PM9A 3IX0A 2GU2A 1N8R1 2E2HI 3CCE1 4MRIA 2QREB 1RQFA 3D6WA 4RVHA 1I6HI 1K83I 3PO3I 3RZOI 3VMIA 1RLYA 3S16I 4E2ZA 1TWAI 3CMAZ 1KD11 3FQMA 3CCSZ 1M901 1KC82 4RVDA 1JJ2Y 1RO0A 2OZKA 4E31A 4A3EI 4A3FI 3GTMS 3IFUA 4NB9A 4AYBA 1K9M2 1VQKZ 1Q861 1L1OC 5LL6f 3CCVZ 1DL6A 2IZ4A 5IP7I 4A3BI 3ESWA 3J81f 2E2II 4E33A 1WCMI 3I551 3J7A4 5T67A 4A3DI 3U50C 1Q811 4NOZA 4BXXI 2J6AA 1VQNZ 3GTPI 4E2YA 3HKZA 3GTOI 1P9NA 4E2XA 1VQ8Z 2YADA 4A3GI 3CCJ1 2QEX1 1ML8A 4NBCA 2JA5I 4TNUA 3CC41 3VMGA 3CD61 1SFOI 1K9M1 3MZKB 2RT9A 2JS4A 4A3MI 4EWCA 1YJNZ 2Q4ZA 2I3CA 1ZB9A 5IP9I 2M48A 3P5JB 2QEXZ 4E2WA 2ZAEB 1YUKA 3BG1B 3CCR1 3F3FC 2JNYA 2V8KA 2NVTI 3S2DI 2GTHA 2QR1B 5D1OA 1PFTA 1S721 2E9HA 5D1OB 1Q7Y2 3NH5A 2IZ3A 1JWHC 1VQPZ 1USPA 2QA4Z 1TWCI 1NJI1 4E30A 3QWUA 3CXCY 2LIYA 4RVGA 3GTQI 3PO2I 4MD8A 1S7MA 3KIFA 3G6E1 3MZLB 1KQSY 3S15I 1W2BZ 4RV9A 5A2Qf 3GTLI 1VQK1 4MONA 3CCUZ 3NDJA 3CC4Z 4HGZA 2RPRA 3S1NI 2QRDB 2R6MA 1VQL1 1N2FA 1NJI2 4HGYA 3I4MI 3Q87A 3CCQZ 3CMA1 1Z03A 2P3YA 1K8A1 3VB9A 1ZH1A 1VQ41 1RNIA 1N8R2 2KI7B 2O4HA 3VTNA 1KRLA 3NDIA 1USPB 2JA7I 1QVFY 3CC71 2PMZA 4MD9A 3CXCZ 2VUMI 1VQ9Z 3J80b 3EERA 1YIT1 1VLAA 3MONA 1ZB8A 2DE5A 2QLVB 1WW9A 2HF1A 1YUAA 4BBRI 1VQOZ 1YIJZ 2Y0SA 1Q862 1KD12 3HOUI 1W2BY 1RO2A 1VQM1 2K3RA 3CC2Z 2GTIA 2VUGA 3H3VJ 4DGLA 1VQ81 1VQP1 1TWGI 2EGTA 5C44I 2M6NA 2OTLZ 1YHQZ 2DE6A 1QVGZ 3FKII 4BY1I 2HU9A 2V8IA 3CC21 4NBEA 2Q51A 3CCM1 1VQ61 5C3EI 3M4OI 3HOYI 4Y52I 1TFIA 3HOWI 1Q821 2JA8I 1VQMZ 5T64A 4MH4A 2F4OA 4A3JI 1JJ2Z 5AN9F 3PO3S 1YITZ 3CCS1 3K7AI 4S1TA 1VQN1 3CPWZ 3HOZI 1VQLZ 3CCMZ 1VQ6Z 3S2HI 1NUIA 1TWHI 3KIHA 1QVFZ 4QTUA 2QRCB 3CPWY 4NB8A 4DQYB 1Z01A 3H0GI 3CD6Z 3GTKI 4HH4A 1TWFI 1QYPA 3F3PC 3OW2Y 1Z02A 3NFZA 1VQ71 3CCEZ 2W03A 1X3WA 3G6EZ 2H85A 1X0TA 3GTJI 3TDHB 4XX2A 3CCL1 1YJ91 4RS4A 4MD7A 4NFRA 1VQ91 2W04A 4A3CI 2OOYB 1S72Z 2R92I 2QKDA 1Y1VI 1YI2Z 3JAMf 1Y1VS 3CCV1 4A3LI 1M902 4A3II 2KPIA 3CCLZ 1YJ9Z 1RO4A 2WAQA 2DE7A 3EEDA 2E2JI 1YJN1 2OOXB 3BG0B 1VQ5Z 1Y1WI 3GKQA 2NVQI 4NBHA 3LUSA 1I50I 1Q812 2PK7A 3CCRZ 3IF8A 2NVXI 2OTL1 2JUBA 3S14I 5C4XI 3I4NI 3G711 3TE5B 4NBBA 2R93I 3CCQ1 3S1MI 2O53A 3G4SZ 5C4JI 1M1K2 3I07A 3CMEZ 2RIQA 4NBDA 3GTGI 2JMOA 2QA41 2WB1A 3J81b 4MXUA 1YI21 1K8A2 3I561 1K731 3CQZI 3NH4A 4A3KI 3RZDI 3FQQA 3D9XA 3OW2Z 3CME1 2B63I 1YHQ1 2YU9I 5FLXf 3NH8A 3S1RI 1Q7Y1 1QVGY 1VQ51 4NH1C 2LFUA 5IT9b 2VF1A 2BJOA 3HOXI 4DK1A 3GTMI 3I56Z 2G2KA 5T6BA 2K5RA 2NVYI 1YIJ1 1WIIA 3M3YI 4BY7I 3VMHA 4CL1A 5FLXb 1K732 2RBLA 2OTJZ 2V8JA 4X6AI 5D1PA 3I55Z 1VQ4Z 3S1QI 1M1K1 4NBFA 3T4NB 1YJW1 2R7ZI 1LQLA 3S17I 3G4S1 2JR6A 4E32A 2AKLA 4QTTA 1Q822 2F4MA 2JA6I 3HOVI 4NBAA 1I3QI 5CM2M 1VQ7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Z;  1YJ9 Z;  1YJW Z;  2OTJ 1;  3CC4 1;  1VQO 1;  3CD6 1;  3CCJ Z;  1VQO Z;  1YJN 1;  1K9M 1;  1YIJ Z;  1VQ5 Z;  1YJN Z;  2QEX Z;  1Q81 2;  1Q86 2;  3CCR 1;  1KQS Z;  1KD1 2;  3CCR Z;  1VQM 1;  1W2B Y;  3G71 Z;  3CC2 Z;  2OTL 1;  1VQ8 1;  1VQP 1;  1KC8 1;  3CC7 Z;  1S72 1;  3CCU 1;  3G71 1;  2OTL Z;  1YHQ Z;  1QVG Z;  1N8R 1;  3CCE 1;  3CCQ 1;  1Q7Y 2;  1VQP Z;  3CC2 1;  3CCM 1;  1VQ6 1;  3G4S Z;  1M1K 2;  2QA4 Z;  3CME Z;  1Q82 1;  1VQM Z;  1NJI 1;  3CXC Y;  2QA4 1;  3CMA Z;  1KD1 1;  3G6E 1;  1KQS Y;  1YI2 1;  1JJ2 Z;  1K8A 2;  1W2B Z;  3I56 1;  1K73 1;  3CCS Z;  1VQK 1;  1YIT Z;  1M90 1;  1KC8 2;  3CCS 1;  1VQN 1;  3OW2 Z;  3CPW Z;  3CCU Z;  3CME 1;  1VQL Z;  3CC4 Z;  1JJ2 Y;  1YHQ 1;  3CCM Z;  1VQ6 Z;  1K9M 2;  1VQK Z;  1QVF Z;  1Q7Y 1;  1Q86 1;  1QVG Y;  3CCV Z;  1VQ5 1;  3CPW Y;  1VQL 1;  3CD6 Z;  1NJI 2;  3OW2 Y;  3I56 Z;  1VQ7 1;  3CCE Z;  3CCQ Z;  3CMA 1;  3I55 1;  1YIJ 1;  3G6E Z;  1K8A 1;  1K73 2;  3CCL 1;  1YJ9 1;  2OTJ Z;  1VQ4 1;  3I55 Z;  1VQ4 Z;  1N8R 2;  1M1K 1;  1Q81 1;  1VQ9 1;  1YJW 1;  1VQN Z;  3G4S 1;  1QVF Y;  3CC7 1;  1S72 Z;  1Q82 2;  3CXC Z;  1YI2 Z;  1VQ9 Z;  1VQ8 Z;  3CCV 1;  3CCJ 1;  2QEX 1;  1YIT 1;  1M90 2;  1VQ7 Z; 
#chains in the Genus database with same CATH topology
 2VPZ A;  2OTJ 1;  1YJW Z;  4Y7N I;  1VQO 1;  5FLM I;  3CCJ Z;  4BBS I;  3GCF A;  4A93 I;  1R9T I;  2RHB A;  4NBG A;  1NP6 A;  3J80 f;  1X3Z A;  1KQS Z;  2P28 A;  3G71 Z;  3JAM b;  5IT9 f;  4RVF A;  5A2Q b;  1KC8 1;  3CC7 Z;  3CCU 1;  1QF8 A;  2PM9 A;  3IX0 A;  2GU2 A;  1N8R 1;  2E2H I;  3CCE 1;  4MRI A;  2QRE B;  1RQF A;  3D6W A;  4RVH A;  1I6H I;  1K83 I;  3PO3 I;  3RZO I;  3VMI A;  1RLY A;  2VPX A;  3S16 I;  4E2Z A;  1TWA I;  3CMA Z;  1KD1 1;  3FQM A;  3CCS Z;  1M90 1;  1KC8 2;  2AYD A;  4RVD A;  1JJ2 Y;  1RO0 A;  2OZK A;  4E31 A;  4A3E I;  4A3F I;  3GTM S;  3IFU A;  4NB9 A;  4AYB A;  1K9M 2;  1Q16 A;  1VQK Z;  1Q86 1;  1L1O C;  5LL6 f;  3CCV Z;  1DL6 A;  2IZ4 A;  5IP7 I;  4A3B I;  3ESW A;  3J81 f;  2E2I I;  3I55 1;  1WCM I;  4E33 A;  3J7A 4;  5T67 A;  4A3D I;  3U50 C;  1Q81 1;  4NOZ A;  4BXX I;  2J6A A;  1VQN Z;  2V3V A;  3GTP I;  4E2Y A;  3HKZ A;  3GTO I;  1P9N A;  4E2X A;  1VQ8 Z;  2YAD A;  4A3G I;  3CCJ 1;  2QEX 1;  1ML8 A;  4NBC A;  2JA5 I;  4TNU A;  3CC4 1;  3D2L A;  3VMG A;  3CD6 1;  1SFO I;  2VPY A;  1K9M 1;  3MZK B;  2RT9 A;  2JS4 A;  3IR7 A;  2VPW A;  4A3M I;  4EWC A;  1YJN Z;  2Q4Z A;  2I3C A;  1ZB9 A;  5IP9 I;  2M48 A;  3P5J B;  2QEX Z;  4E2W A;  2ZAE B;  1YUK A;  3BG1 B;  3CCR 1;  3F3F C;  2JNY A;  2V8K A;  2NVT I;  3S2D I;  2GTH A;  2QR1 B;  5D1O A;  1PFT A;  1S72 1;  2E9H A;  2V45 A;  5D1O B;  1Q7Y 2;  3NH5 A;  2IZ3 A;  2JIM A;  1JWH C;  1VQP Z;  1USP A;  1QXF A;  2QA4 Z;  1TWC I;  1NJI 1;  4E30 A;  3QWU A;  3CXC Y;  2LIY A;  4RVG A;  3GTQ I;  3PO2 I;  4MD8 A;  1S7M A;  3KIF A;  3G6E 1;  3MZL B;  1KQS Y;  3S15 I;  1W2B Z;  4RV9 A;  5A2Q f;  3GTL I;  1VQK 1;  4MON A;  3CCU Z;  3NDJ A;  3CC4 Z;  4HGZ A;  2RPR A;  3S1N I;  2QRD B;  2R6M A;  1VQL 1;  1N2F A;  1NJI 2;  4HGY A;  3I4M I;  3Q87 A;  3CCQ Z;  3CMA 1;  2JIR A;  1Z03 A;  2P3Y A;  1K8A 1;  3VB9 A;  1ZH1 A;  1VQ4 1;  1RNI A;  1N8R 2;  2KI7 B;  2O4H A;  3VTN A;  1KRL A;  3NDI A;  1USP B;  2JA7 I;  1QVF Y;  3CC7 1;  2PMZ A;  4MD9 A;  3CXC Z;  2VUM I;  1VQ9 Z;  3J80 b;  3EER A;  1YIT 1;  1VLA A;  3MON A;  1ZB8 A;  2DE5 A;  2QLV B;  1WW9 A;  2HF1 A;  1YUA A;  2LEX A;  4BBR I;  1VQO Z;  1YIJ Z;  2Y0S A;  1WZN A;  1Q86 2;  1KD1 2;  3HOU I;  1W2B Y;  1RO2 A;  1VQM 1;  2K3R A;  3CC2 Z;  2GTI A;  2VUG A;  3H3V J;  4DGL A;  1VQ8 1;  1VQP 1;  1TWG I;  1FDI A;  2EGT A;  5C44 I;  2M6N A;  2OTL Z;  1YHQ Z;  2DE6 A;  1QVG Z;  3FKI I;  4BY1 I;  2HU9 A;  2V8I A;  3CC2 1;  4NBE A;  2Q51 A;  3CCM 1;  1VQ6 1;  5C3E I;  3M4O I;  3HOY I;  4Y52 I;  1TFI A;  3HOW I;  1FDO A;  1Q82 1;  1VQM Z;  5T64 A;  2JA8 I;  2NAP A;  4MH4 A;  2F4O A;  4A3J I;  1JJ2 Z;  5AN9 F;  3PO3 S;  1YIT Z;  3CCS 1;  3K7A I;  4S1T A;  1VQN 1;  3CPW Z;  3HOZ I;  1VQL Z;  1WJ2 A;  3CCM Z;  1VQ6 Z;  3S2H I;  1NUI A;  1TWH I;  3KIH A;  1QVF Z;  4QTU A;  2QRC B;  3CPW Y;  1Y8C A;  4NB8 A;  4DQY B;  1Z01 A;  3H0G I;  3CD6 Z;  3GTK I;  4HH4 A;  1TWF I;  1QYP A;  3F3P C;  3OW2 Y;  1Z02 A;  3NFZ A;  1VQ7 1;  3CCE Z;  2W03 A;  1X3W A;  3G6E Z;  2H85 A;  1X0T A;  3GTJ I;  3TDH B;  4XX2 A;  3CCL 1;  1YJ9 1;  4RS4 A;  4MD7 A;  4NFR A;  1VQ9 1;  2W04 A;  4A3C I;  2OOY B;  1S72 Z;  2R92 I;  2QKD A;  1Y1V I;  1YI2 Z;  3JAM f;  1Y1V S;  3CCV 1;  4A3L I;  1M90 2;  4A3I I;  2KPI A;  3CCL Z;  1YJ9 Z;  1RO4 A;  2WAQ A;  2DE7 A;  3EED A;  2E2J I;  1YJN 1;  2OOX B;  2JIP A;  3BG0 B;  1VQ5 Z;  1Y1W I;  3GKQ A;  2NVQ I;  4NBH A;  3LUS A;  1I50 I;  1Q81 2;  2PK7 A;  3CCR Z;  3IF8 A;  2NVX I;  1SIW A;  2OTL 1;  2JUB A;  3S14 I;  5C4X I;  3I4N I;  3G71 1;  3TE5 B;  4NBB A;  2R93 I;  3CCQ 1;  3S1M I;  2O53 A;  3G4S Z;  2JIQ A;  5C4J I;  1M1K 2;  3I07 A;  3CME Z;  2RIQ A;  4NBD A;  3GTG I;  2JMO A;  2QA4 1;  2E7Z A;  1AA6 A;  2WB1 A;  3J81 b;  4MXU A;  1YI2 1;  1K8A 2;  3I56 1;  1K73 1;  3CQZ I;  3NH4 A;  4A3K I;  3RZD I;  3FQQ A;  2JIO A;  3D9X A;  3OW2 Z;  3CME 1;  2B63 I;  1YHQ 1;  2YU9 I;  3S1R I;  3NH8 A;  5FLX f;  1Q7Y 1;  1QVG Y;  1VQ5 1;  4NH1 C;  2LFU A;  5IT9 b;  2VF1 A;  2BJO A;  3HOX I;  4DK1 A;  3GTM I;  3I56 Z;  2G2K A;  5T6B A;  2K5R A;  2NVY I;  1YIJ 1;  1WII A;  3M3Y I;  4BY7 I;  3VMH A;  4CL1 A;  5FLX b;  1K73 2;  2RBL A;  2OTJ Z;  2V8J A;  4X6A I;  5D1P A;  2IV2 X;  3I55 Z;  1VQ4 Z;  3S1Q I;  1M1K 1;  4NBF A;  3T4N B;  1YJW 1;  2R7Z I;  1LQL A;  3S17 I;  3G4S 1;  2JR6 A;  4E32 A;  2AKL A;  4QTT A;  1Q82 2;  2F4M A;  2JA6 I;  3HOV I;  4NBA A;  1I3Q I;  5CM2 M;  1VQ7 Z; 
#chains in the Genus database with same CATH homology
 2OTJ 1;  1YJW Z;  4Y7N I;  1VQO 1;  5FLM I;  3CCJ Z;  4BBS I;  3GCF A;  4A93 I;  1R9T I;  2RHB A;  4NBG A;  1NP6 A;  3J80 f;  1X3Z A;  1KQS Z;  2P28 A;  3G71 Z;  3JAM b;  5IT9 f;  4RVF A;  5A2Q b;  1KC8 1;  3CC7 Z;  3CCU 1;  1QF8 A;  2PM9 A;  3IX0 A;  2GU2 A;  1N8R 1;  2E2H I;  3CCE 1;  4MRI A;  2QRE B;  1RQF A;  3D6W A;  4RVH A;  1I6H I;  1K83 I;  3PO3 I;  3RZO I;  3VMI A;  1RLY A;  3S16 I;  4E2Z A;  1TWA I;  3CMA Z;  1KD1 1;  3FQM A;  3CCS Z;  1M90 1;  1KC8 2;  4RVD A;  1JJ2 Y;  1RO0 A;  2OZK A;  4E31 A;  4A3E I;  4A3F I;  3GTM S;  3IFU A;  4NB9 A;  4AYB A;  1K9M 2;  1VQK Z;  1Q86 1;  1L1O C;  5LL6 f;  3CCV Z;  1DL6 A;  2IZ4 A;  5IP7 I;  4A3B I;  3ESW A;  3J81 f;  2E2I I;  4E33 A;  1WCM I;  3I55 1;  3J7A 4;  5T67 A;  4A3D I;  3U50 C;  1Q81 1;  4NOZ A;  4BXX I;  2J6A A;  1VQN Z;  3GTP I;  4E2Y A;  3HKZ A;  3GTO I;  1P9N A;  4E2X A;  1VQ8 Z;  2YAD A;  4A3G I;  3CCJ 1;  2QEX 1;  1ML8 A;  4NBC A;  2JA5 I;  4TNU A;  3CC4 1;  3VMG A;  3CD6 1;  1SFO I;  1K9M 1;  3MZK B;  2RT9 A;  2JS4 A;  4A3M I;  4EWC A;  1YJN Z;  2Q4Z A;  2I3C A;  1ZB9 A;  5IP9 I;  2M48 A;  3P5J B;  2QEX Z;  4E2W A;  2ZAE B;  1YUK A;  3BG1 B;  3CCR 1;  3F3F C;  2JNY A;  2V8K A;  2NVT I;  3S2D I;  2GTH A;  2QR1 B;  5D1O A;  1PFT A;  1S72 1;  2E9H A;  5D1O B;  1Q7Y 2;  3NH5 A;  2IZ3 A;  1JWH C;  1VQP Z;  1USP A;  2QA4 Z;  1TWC I;  1NJI 1;  4E30 A;  3QWU A;  3CXC Y;  2LIY A;  4RVG A;  3GTQ I;  3PO2 I;  4MD8 A;  1S7M A;  3KIF A;  3G6E 1;  3MZL B;  1KQS Y;  3S15 I;  1W2B Z;  4RV9 A;  5A2Q f;  3GTL I;  1VQK 1;  4MON A;  3CCU Z;  3NDJ A;  3CC4 Z;  4HGZ A;  2RPR A;  3S1N I;  2QRD B;  2R6M A;  1VQL 1;  1N2F A;  1NJI 2;  4HGY A;  3I4M I;  3Q87 A;  3CCQ Z;  3CMA 1;  1Z03 A;  2P3Y A;  1K8A 1;  3VB9 A;  1ZH1 A;  1VQ4 1;  1RNI A;  1N8R 2;  2KI7 B;  2O4H A;  3VTN A;  1KRL A;  3NDI A;  1USP B;  2JA7 I;  1QVF Y;  3CC7 1;  2PMZ A;  4MD9 A;  3CXC Z;  2VUM I;  1VQ9 Z;  3J80 b;  3EER A;  1YIT 1;  1VLA A;  3MON A;  1ZB8 A;  2DE5 A;  2QLV B;  1WW9 A;  2HF1 A;  1YUA A;  4BBR I;  1VQO Z;  1YIJ Z;  2Y0S A;  1Q86 2;  1KD1 2;  3HOU I;  1W2B Y;  1RO2 A;  1VQM 1;  2K3R A;  3CC2 Z;  2GTI A;  2VUG A;  3H3V J;  4DGL A;  1VQ8 1;  1VQP 1;  1TWG I;  2EGT A;  5C44 I;  2M6N A;  2OTL Z;  1YHQ Z;  2DE6 A;  1QVG Z;  3FKI I;  4BY1 I;  2HU9 A;  2V8I A;  3CC2 1;  4NBE A;  2Q51 A;  3CCM 1;  1VQ6 1;  5C3E I;  3M4O I;  3HOY I;  4Y52 I;  1TFI A;  3HOW I;  1Q82 1;  2JA8 I;  1VQM Z;  5T64 A;  4MH4 A;  2F4O A;  4A3J I;  1JJ2 Z;  5AN9 F;  3PO3 S;  1YIT Z;  3CCS 1;  3K7A I;  4S1T A;  1VQN 1;  3CPW Z;  3HOZ I;  1VQL Z;  3CCM Z;  1VQ6 Z;  3S2H I;  1NUI A;  1TWH I;  3KIH A;  1QVF Z;  4QTU A;  2QRC B;  3CPW Y;  4NB8 A;  4DQY B;  1Z01 A;  3H0G I;  3CD6 Z;  3GTK I;  4HH4 A;  1TWF I;  1QYP A;  3F3P C;  3OW2 Y;  1Z02 A;  3NFZ A;  1VQ7 1;  3CCE Z;  2W03 A;  1X3W A;  3G6E Z;  2H85 A;  1X0T A;  3GTJ I;  3TDH B;  4XX2 A;  3CCL 1;  1YJ9 1;  4RS4 A;  4MD7 A;  4NFR A;  1VQ9 1;  2W04 A;  4A3C I;  2OOY B;  1S72 Z;  2R92 I;  2QKD A;  1Y1V I;  1YI2 Z;  3JAM f;  1Y1V S;  3CCV 1;  4A3L I;  1M90 2;  4A3I I;  2KPI A;  3CCL Z;  1YJ9 Z;  1RO4 A;  2WAQ A;  2DE7 A;  3EED A;  2E2J I;  1YJN 1;  2OOX B;  3BG0 B;  1VQ5 Z;  1Y1W I;  3GKQ A;  2NVQ I;  4NBH A;  3LUS A;  1I50 I;  1Q81 2;  2PK7 A;  3CCR Z;  3IF8 A;  2NVX I;  2OTL 1;  2JUB A;  3S14 I;  5C4X I;  3I4N I;  3G71 1;  3TE5 B;  4NBB A;  2R93 I;  3CCQ 1;  3S1M I;  2O53 A;  3G4S Z;  5C4J I;  1M1K 2;  3I07 A;  3CME Z;  2RIQ A;  4NBD A;  3GTG I;  2JMO A;  2QA4 1;  2WB1 A;  3J81 b;  4MXU A;  1YI2 1;  1K8A 2;  3I56 1;  1K73 1;  3CQZ I;  3NH4 A;  4A3K I;  3RZD I;  3FQQ A;  3D9X A;  3OW2 Z;  3CME 1;  2B63 I;  1YHQ 1;  2YU9 I;  5FLX f;  3NH8 A;  3S1R I;  1Q7Y 1;  1QVG Y;  1VQ5 1;  4NH1 C;  2LFU A;  5IT9 b;  2VF1 A;  2BJO A;  3HOX I;  4DK1 A;  3GTM I;  3I56 Z;  2G2K A;  5T6B A;  2K5R A;  2NVY I;  1YIJ 1;  1WII A;  3M3Y I;  4BY7 I;  3VMH A;  4CL1 A;  5FLX b;  1K73 2;  2RBL A;  2OTJ Z;  2V8J A;  4X6A I;  5D1P A;  3I55 Z;  1VQ4 Z;  3S1Q I;  1M1K 1;  4NBF A;  3T4N B;  1YJW 1;  2R7Z I;  1LQL A;  3S17 I;  3G4S 1;  2JR6 A;  4E32 A;  2AKL A;  4QTT A;  1Q82 2;  2F4M A;  2JA6 I;  3HOV I;  4NBA A;  1I3Q I;  5CM2 M;  1VQ7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...