3CMA1

The structure of cca and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Peptidyl-CCA deacylation on the ribosome promoted by induced fit and the O3'-hydroxyl group of A76 of the unacylated A-site tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cma100
1W2BZ 3I561 3CCEZ 1VQ61 1M901 3CC4Z 3CCJZ 1VQO1 3CCUZ 1KQSY 3G4SZ 1W2BY 1VQNZ 2QEXZ 3I551 1NJI1 1YIJZ 3OW2Z 1KD12 1VQ71 3CCE1 3CCRZ 3CME1 1QVFZ 1YJ91 1YJWZ 2OTLZ 1K9M2 1VQK1 3OW2Y 2QEX1 3CMA1 1K731 1QVGZ 1YJNZ 1VQ9Z 3CD6Z 1VQPZ 1M902 2QA41 1JJ2Z 1YJW1 2OTL1 1QVGY 3CCSZ 1VQLZ 1JJ2Y 3CCMZ 1VQ91 1NJI2 3CCVZ 3CC41 3CCJ1 1YHQZ 1K8A1 3CCU1 1VQMZ 3G4S1 1VQN1 1Q861 2OTJZ 1N8R1 3CCS1 1QVFY 1VQ5Z 1YIJ1 3G71Z 1VQ8Z 3CC2Z 1K732 1N8R2 1S72Z 3CCR1 1Q821 1KC81 1YITZ 1VQ6Z 3CCQZ 1Q822 3CC7Z 1YJN1 1VQ51 3CD61 3I55Z 3G711 1YI2Z 1Q7Y1 3CXCZ 1VQP1 1VQ7Z 1YIT1 1Q7Y2 3CMEZ 3CCQ1 1YJ9Z 1VQ4Z 3CC71 1K8A2 3CCLZ 1VQKZ 1VQL1 3CXCY 1Q862 3G6EZ 3CMAZ 1KD11 3CCM1 3CCV1 3CPWZ 3I56Z 1YI21 1KC82 1YHQ1 1VQOZ 1K9M1 1VQ41 2QA4Z 1VQM1 1Q811 2OTJ1 3CPWY 3CCL1 1M1K1 3G6E1 1Q812 1VQ81 3CC21 1S721 1KQSZ 1M1K2
chains in the Genus database with same CATH superfamily
1AA6A 2IZ4A 4NOZA 1TWGI 2QKDA 3CC4Z 4RVDA 2R6MA 4BBSI 1W2BY 3GTJI 2JA5I 1VQNZ 2QEXZ 5C44I 4E2XA 3PO2I 3PO3I 3TE5B 1NJI1 2V45A 3OW2Z 4NBGA 4NBHA 4MRIA 1VQ71 4MD8A 3F3FC 2M48A 4MD9A 3BG0B 1WCMI 1TWCI 1QF8A 2P3YA 1ZH1A 4CL1A 2JR6A 1QVGY 3NH5A 1ML8A 4NB9A 1VQLZ 3D6WA 4A3MI 3CCMZ 1VQ91 3FQQA 4S1TA 3GTGI 2VF1A 4NH1C 1N8R1 2JA7I 2JS4A 1WIIA 5IT9f 3J81b 2PM9A 3U50C 3CCR1 4E2WA 3GTQI 3CCQZ 3J7A4 3D9XA 3IFUA 2DE5A 3KIHA 3CC7Z 3J80f 1NP6A 3T4NB 2QREB 2GU2A 3G711 2V3VA 2G2KA 1RNIA 3D2LA 1VQ7Z 2VPXA 2OZKA 2LIYA 2JA6I 3I07A 1K8A2 2LFUA 1I6HI 2DE6A 3G6EZ 3CCV1 3I56Z 4BY1I 4NBBA 1KC82 1WW9A 4EWCA 5AN9F 1YHQ1 2E9HA 2QRCB 1RLYA 3FKII 1K9M1 4A3EI 4RS4A 1VQ41 1Q811 1R9TI 3CPWY 1WJ2A 3S14I 2F4MA 4NBDA 1VQ81 2PK7A 1S721 2YU9I 1M1K2 1W2BZ 1M901 4RV9A 5D1OA 3QWUA 1P9NA 1RO2A 1KQSY 1Y8CA 2JUBA 3EERA 2K3RA 3JAMf 1Z02A 1L1OC 3HKZA 3CCE1 3CCRZ 4X6AI 1QVFZ 1DL6A 2OTLZ 4XX2A 3MONA 4HGYA 1TWAI 2V8JA 3VTNA 1QVGZ 5FLMI 2E2HI 3S2HI 1YJW1 4NB8A 4E31A 2QR1B 2PMZA 5C4JI 3CCSZ 3KIFA 3GTMI 2RPRA 3S15I 4NBCA 1JJ2Y 1TWHI 3CCVZ 2NVTI 3CQZI 3CCJ1 3RZDI 5T67A 1YHQZ 2JIMA 3CCU1 2M6NA 2Q4ZA 2BJOA 2W04A 1TWFI 1QVFY 3GTMS 1VQ8Z 1K732 3J80b 1N8R2 1S72Z 2RBLA 4A3GI 1YITZ 4A3KI 3IF8A 3NFZA 2VPYA 2GTHA 2ZAEB 3NH8A 4A3II 2O4HA 1VQ51 1VLAA 1YI2Z 1Q7Y1 5A2Qf 2VPZA 2W03A 4NBFA 1LQLA 1S7MA 1PFTA 3K7AI 3CCLZ 3HOWI 3CXCY 1Q862 2VPWA 1NUIA 3CPWZ 4MONA 5C3EI 4QTTA 1VQM1 1Y1VI 2E2II 1Q812 3P5JB 3CC21 3M3YI 2GTIA 1KQSZ 5IP9I 3H3VJ 1Z01A 3NH4A 3VMHA 5IP7I 1VQ61 3HOVI 3F3PC 2NVXI 3CCJZ 1VQO1 5C4XI 1USPB 4A3CI 3CCUZ 2JNYA 1Y1VS 3I4MI 3GTLI 3FQMA 3I551 2R92I 3TDHB 1Y1WI 1FDIA 1KD12 1X3ZA 1RQFA 5CM2M 2O53A 3RZOI 4A3DI 2WAQA 3I4NI 2NVQI 1SFOI 2QEX1 1VQ9Z 2JIRA 2QLVB 4DGLA 3NDIA 4E33A 1JJ2Z 1JWHC 3LUSA 2E2JI 3J81f 5T64A 3ESWA 4RVFA 1NJI2 2RHBA 2LEXA 5FLXf 1YUAA 4NBEA 2DE7A 2E7ZA 1I3QI 4DQYB 3S1RI 4A3FI 1K8A1 5LL6f 1VQMZ 3G4S1 3GTPI 2I3CA 4BBRI 1YIJ1 3G71Z 2V8KA 3CC2Z 1Q821 1KC81 3S17I 2R93I 3S1MI 2R7ZI 1VQ6Z 1YUKA 3IR7A 3NDJA 5A2Qb 2IV2X 2V8IA 1USPA 3HOZI 1YJN1 3CD61 3I55Z 2WB1A 3CXCZ 1VQP1 4QTUA 5IT9b 1Q7Y2 1VQ4Z 3CCQ1 2K5RA 1SIWA 3CC71 1QYPA 3S1QI 4RVHA 3VB9A 2QRDB 4MXUA 4A3BI 1N2FA 3GCFA 2VUGA 2H85A 3VMIA 4AYBA 2KI7B 2OTJ1 4HGZA 3G6E1 3GKQA 2JA8I 2RT9A 3I561 3CCEZ 2NAPA 4NFRA 2VUMI 3PO3S 3MZLB 3HOYI 1X0TA 5D1PA 1ZB9A 4E30A 1RO4A 3G4SZ 3VMGA 3HOXI 3GTOI 1YIJZ 2JIPA 4A93I 3CME1 1YJ91 1I50I 3S1NI 1YJWZ 4RVGA 1K9M2 5D1OB 2J6AA 1VQK1 4E2ZA 3OW2Y 2JIOA 3CMA1 1K731 2AKLA 2OOXB 3JAMb 1YJNZ 3H0GI 3CD6Z 4TNUA 4HH4A 1VQPZ 1M902 2QA41 4E32A 4A3LI 2RIQA 2YADA 2OTL1 5FLXb 2NVYI 2F4OA 3CC41 1RO0A 3HOUI 5T6BA 2Q51A 2HF1A 2JMOA 1VQN1 1Q861 2OTJZ 3CCS1 4A3JI 1VQ5Z 1Q16A 3IX0A 3MZKB 4Y52I 1Q822 1FDOA 4E2YA 2OOYB 4MH4A 1X3WA 3Q87A 1K83I 4DK1A 4BY7I 2JIQA 3EEDA 3M4OI 1YIT1 3CMEZ 1YJ9Z 2Y0SA 1Z03A 2IZ3A 4MD7A 2HU9A 4NBAA 1WZNA 1QXFA 1VQKZ 1KRLA 1ZB8A 1VQL1 3S2DI 2P28A 2EGTA 3CMAZ 1KD11 2AYDA 3CCM1 3S16I 1YI21 2B63I 2KPIA 1VQOZ 1TFIA 2QA4Z 3BG1B 4Y7NI 3CCL1 1M1K1 3GTKI 4BXXI
chains in the Genus database with same CATH topology
2IZ4A 4NOZA 1TWGI 2QKDA 3CC4Z 4RVDA 2R6MA 4BBSI 1W2BY 3GTJI 2JA5I 1VQNZ 2QEXZ 5C44I 4E2XA 3PO2I 3PO3I 3TE5B 1NJI1 3OW2Z 4NBGA 4NBHA 4MRIA 1VQ71 4MD8A 3F3FC 2M48A 4MD9A 3BG0B 1WCMI 1TWCI 1QF8A 2P3YA 1ZH1A 4CL1A 2JR6A 1QVGY 3NH5A 1ML8A 4NB9A 1VQLZ 3D6WA 4A3MI 3CCMZ 1VQ91 3FQQA 4S1TA 3GTGI 2VF1A 4NH1C 1N8R1 2JA7I 2JS4A 1WIIA 5IT9f 3J81b 2PM9A 3U50C 3CCR1 4E2WA 3GTQI 3CCQZ 3J7A4 3D9XA 3IFUA 2DE5A 3KIHA 3CC7Z 3J80f 1NP6A 3T4NB 2QREB 2GU2A 3G711 2G2KA 1RNIA 1VQ7Z 2OZKA 2LIYA 2JA6I 3I07A 1K8A2 2LFUA 1I6HI 2DE6A 3G6EZ 3CCV1 3I56Z 4BY1I 4NBBA 1KC82 1WW9A 4EWCA 5AN9F 1YHQ1 2E9HA 2QRCB 1RLYA 3FKII 1K9M1 4A3EI 4RS4A 1VQ41 1Q811 1R9TI 3CPWY 3S14I 2F4MA 4NBDA 1VQ81 2PK7A 1S721 2YU9I 1M1K2 1W2BZ 1M901 4RV9A 5D1OA 3QWUA 1P9NA 1RO2A 1KQSY 2JUBA 3EERA 2K3RA 3JAMf 1Z02A 1L1OC 3HKZA 3CCE1 3CCRZ 4X6AI 1QVFZ 1DL6A 2OTLZ 4XX2A 3MONA 4HGYA 1TWAI 2V8JA 3VTNA 1QVGZ 5FLMI 2E2HI 3S2HI 1YJW1 4NB8A 4E31A 2QR1B 2PMZA 5C4JI 3CCSZ 3KIFA 3GTMI 2RPRA 3S15I 4NBCA 1JJ2Y 1TWHI 3CCVZ 2NVTI 3CQZI 3CCJ1 3RZDI 5T67A 1YHQZ 3CCU1 2M6NA 2Q4ZA 2BJOA 2W04A 1TWFI 1QVFY 3GTMS 1VQ8Z 1K732 3J80b 1N8R2 1S72Z 2RBLA 4A3GI 1YITZ 4A3KI 3IF8A 3NFZA 2GTHA 2ZAEB 3NH8A 4A3II 2O4HA 1VQ51 1VLAA 1YI2Z 1Q7Y1 5A2Qf 2W03A 4NBFA 1LQLA 1S7MA 1PFTA 3K7AI 3CCLZ 3HOWI 3CXCY 1Q862 1NUIA 3CPWZ 4MONA 5C3EI 4QTTA 1VQM1 1Y1VI 2E2II 1Q812 3P5JB 3CC21 3M3YI 2GTIA 1KQSZ 5IP9I 3H3VJ 1Z01A 3NH4A 3VMHA 5IP7I 1VQ61 3HOVI 3F3PC 2NVXI 3CCJZ 1VQO1 5C4XI 1USPB 4A3CI 3CCUZ 2JNYA 1Y1VS 3I4MI 3GTLI 3FQMA 3I551 2R92I 3TDHB 1Y1WI 1KD12 1X3ZA 1RQFA 5CM2M 2O53A 3RZOI 4A3DI 2WAQA 3I4NI 2NVQI 1SFOI 2QEX1 1VQ9Z 2QLVB 4DGLA 3NDIA 4E33A 1JJ2Z 1JWHC 3LUSA 2E2JI 3J81f 5T64A 3ESWA 4RVFA 1NJI2 2RHBA 5FLXf 1YUAA 4NBEA 2DE7A 1I3QI 4DQYB 3S1RI 4A3FI 1K8A1 5LL6f 1VQMZ 3G4S1 3GTPI 2I3CA 4BBRI 1YIJ1 3G71Z 2V8KA 3CC2Z 1Q821 1KC81 3S17I 2R93I 3S1MI 2R7ZI 1VQ6Z 1YUKA 3NDJA 5A2Qb 2V8IA 1USPA 3HOZI 1YJN1 3CD61 3I55Z 2WB1A 3CXCZ 1VQP1 4QTUA 5IT9b 1Q7Y2 1VQ4Z 3CCQ1 2K5RA 3CC71 1QYPA 3S1QI 4RVHA 3VB9A 2QRDB 4MXUA 4A3BI 1N2FA 3GCFA 2VUGA 2H85A 3VMIA 4AYBA 2KI7B 2OTJ1 4HGZA 3G6E1 3GKQA 2JA8I 2RT9A 3I561 3CCEZ 3PO3S 4NFRA 2VUMI 3MZLB 3HOYI 1X0TA 5D1PA 1ZB9A 4E30A 1RO4A 3G4SZ 3VMGA 3HOXI 3GTOI 1YIJZ 4A93I 3CME1 1YJ91 1I50I 3S1NI 1YJWZ 4RVGA 1K9M2 5D1OB 2J6AA 1VQK1 4E2ZA 3OW2Y 3CMA1 1K731 2AKLA 2OOXB 3JAMb 1YJNZ 3H0GI 3CD6Z 4TNUA 4HH4A 1VQPZ 1M902 2QA41 4E32A 4A3LI 2RIQA 2YADA 2OTL1 5FLXb 2NVYI 2F4OA 3CC41 1RO0A 3HOUI 5T6BA 2Q51A 2HF1A 2JMOA 1VQN1 1Q861 2OTJZ 3CCS1 4A3JI 1VQ5Z 3IX0A 3MZKB 4Y52I 1Q822 4E2YA 2OOYB 4MH4A 1X3WA 3Q87A 1K83I 4DK1A 4BY7I 3EEDA 3M4OI 1YIT1 3CMEZ 1YJ9Z 2Y0SA 1Z03A 2IZ3A 4MD7A 2HU9A 4NBAA 1VQKZ 1KRLA 1ZB8A 1VQL1 3S2DI 2P28A 2EGTA 3CMAZ 1KD11 3CCM1 3S16I 1YI21 2B63I 2KPIA 1VQOZ 1TFIA 2QA4Z 3BG1B 4Y7NI 3CCL1 1M1K1 3GTKI 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B Z;  3I56 1;  3CCE Z;  1VQ6 1;  1M90 1;  3CC4 Z;  3CCJ Z;  1VQO 1;  3CCU Z;  1KQS Y;  3G4S Z;  1W2B Y;  1VQN Z;  2QEX Z;  3I55 1;  1NJI 1;  1YIJ Z;  3OW2 Z;  1KD1 2;  1VQ7 1;  3CCE 1;  3CCR Z;  3CME 1;  1QVF Z;  1YJ9 1;  1YJW Z;  2OTL Z;  1K9M 2;  1VQK 1;  3OW2 Y;  2QEX 1;  3CMA 1;  1K73 1;  1QVG Z;  1YJN Z;  1VQ9 Z;  3CD6 Z;  1VQP Z;  1M90 2;  2QA4 1;  1JJ2 Z;  1YJW 1;  2OTL 1;  1QVG Y;  3CCS Z;  1VQL Z;  1JJ2 Y;  3CCM Z;  1VQ9 1;  1NJI 2;  3CCV Z;  3CC4 1;  3CCJ 1;  1YHQ Z;  1K8A 1;  3CCU 1;  1VQM Z;  3G4S 1;  1VQN 1;  1Q86 1;  2OTJ Z;  1N8R 1;  3CCS 1;  1QVF Y;  1VQ5 Z;  1YIJ 1;  3G71 Z;  1VQ8 Z;  3CC2 Z;  1K73 2;  1N8R 2;  1S72 Z;  3CCR 1;  1Q82 1;  1KC8 1;  1YIT Z;  1VQ6 Z;  3CCQ Z;  1Q82 2;  3CC7 Z;  1YJN 1;  1VQ5 1;  3CD6 1;  3I55 Z;  3G71 1;  1YI2 Z;  1Q7Y 1;  3CXC Z;  1VQP 1;  1VQ7 Z;  1YIT 1;  1Q7Y 2;  3CME Z;  3CCQ 1;  1YJ9 Z;  1VQ4 Z;  3CC7 1;  1K8A 2;  3CCL Z;  1VQK Z;  1VQL 1;  3CXC Y;  1Q86 2;  3G6E Z;  3CMA Z;  1KD1 1;  3CCM 1;  3CCV 1;  3CPW Z;  3I56 Z;  1YI2 1;  1KC8 2;  1YHQ 1;  1VQO Z;  1K9M 1;  1VQ4 1;  2QA4 Z;  1VQM 1;  1Q81 1;  2OTJ 1;  3CPW Y;  3CCL 1;  1M1K 1;  3G6E 1;  1Q81 2;  1VQ8 1;  3CC2 1;  1S72 1;  1KQS Z;  1M1K 2; 
#chains in the Genus database with same CATH topology
 1AA6 A;  2IZ4 A;  4NOZ A;  1TWG I;  2QKD A;  3CC4 Z;  4RVD A;  2R6M A;  4BBS I;  1W2B Y;  3GTJ I;  2JA5 I;  1VQN Z;  2QEX Z;  5C44 I;  4E2X A;  3PO2 I;  3PO3 I;  3TE5 B;  1NJI 1;  2V45 A;  3OW2 Z;  4NBG A;  4NBH A;  4MRI A;  1VQ7 1;  4MD8 A;  3F3F C;  2M48 A;  4MD9 A;  3BG0 B;  1WCM I;  1TWC I;  1QF8 A;  2P3Y A;  1ZH1 A;  4CL1 A;  2JR6 A;  1QVG Y;  3NH5 A;  1ML8 A;  4NB9 A;  1VQL Z;  3D6W A;  4A3M I;  3CCM Z;  1VQ9 1;  3FQQ A;  4S1T A;  3GTG I;  2VF1 A;  4NH1 C;  1N8R 1;  2JA7 I;  2JS4 A;  1WII A;  5IT9 f;  3J81 b;  2PM9 A;  3U50 C;  3CCR 1;  4E2W A;  3GTQ I;  3CCQ Z;  3J7A 4;  3D9X A;  3IFU A;  2DE5 A;  3KIH A;  3CC7 Z;  3J80 f;  1NP6 A;  3T4N B;  2QRE B;  2GU2 A;  3G71 1;  2V3V A;  2G2K A;  1RNI A;  3D2L A;  1VQ7 Z;  2VPX A;  2OZK A;  2LIY A;  2JA6 I;  3I07 A;  1K8A 2;  2LFU A;  1I6H I;  2DE6 A;  3G6E Z;  3CCV 1;  3I56 Z;  4BY1 I;  4NBB A;  1KC8 2;  1WW9 A;  4EWC A;  5AN9 F;  1YHQ 1;  2E9H A;  2QRC B;  1RLY A;  3FKI I;  1K9M 1;  4A3E I;  4RS4 A;  1VQ4 1;  1Q81 1;  1R9T I;  3CPW Y;  1WJ2 A;  3S14 I;  2F4M A;  4NBD A;  1VQ8 1;  2PK7 A;  1S72 1;  2YU9 I;  1M1K 2;  1W2B Z;  1M90 1;  4RV9 A;  5D1O A;  3QWU A;  1P9N A;  1RO2 A;  1KQS Y;  1Y8C A;  2JUB A;  3EER A;  2K3R A;  3JAM f;  1Z02 A;  1L1O C;  3HKZ A;  3CCE 1;  3CCR Z;  4X6A I;  1QVF Z;  1DL6 A;  2OTL Z;  4XX2 A;  3MON A;  4HGY A;  1TWA I;  2V8J A;  3VTN A;  1QVG Z;  5FLM I;  2E2H I;  3S2H I;  1YJW 1;  4NB8 A;  4E31 A;  2QR1 B;  2PMZ A;  5C4J I;  3CCS Z;  3KIF A;  3GTM I;  2RPR A;  3S15 I;  4NBC A;  1JJ2 Y;  1TWH I;  3CCV Z;  2NVT I;  3CQZ I;  3CCJ 1;  3RZD I;  5T67 A;  1YHQ Z;  2JIM A;  3CCU 1;  2M6N A;  2Q4Z A;  2BJO A;  2W04 A;  1TWF I;  1QVF Y;  3GTM S;  1VQ8 Z;  1K73 2;  3J80 b;  1N8R 2;  1S72 Z;  2RBL A;  4A3G I;  1YIT Z;  4A3K I;  3IF8 A;  3NFZ A;  2VPY A;  2GTH A;  2ZAE B;  3NH8 A;  4A3I I;  2O4H A;  1VQ5 1;  1VLA A;  1YI2 Z;  1Q7Y 1;  5A2Q f;  2VPZ A;  2W03 A;  4NBF A;  1LQL A;  1S7M A;  1PFT A;  3K7A I;  3CCL Z;  3HOW I;  3CXC Y;  1Q86 2;  2VPW A;  1NUI A;  3CPW Z;  4MON A;  5C3E I;  4QTT A;  1VQM 1;  1Y1V I;  2E2I I;  1Q81 2;  3P5J B;  3CC2 1;  3M3Y I;  2GTI A;  1KQS Z;  5IP9 I;  3H3V J;  1Z01 A;  3NH4 A;  3VMH A;  5IP7 I;  1VQ6 1;  3HOV I;  3F3P C;  2NVX I;  3CCJ Z;  1VQO 1;  5C4X I;  1USP B;  4A3C I;  3CCU Z;  2JNY A;  1Y1V S;  3I4M I;  3GTL I;  3FQM A;  3I55 1;  2R92 I;  3TDH B;  1Y1W I;  1FDI A;  1KD1 2;  1X3Z A;  1RQF A;  5CM2 M;  2O53 A;  3RZO I;  4A3D I;  2WAQ A;  3I4N I;  2NVQ I;  1SFO I;  2QEX 1;  1VQ9 Z;  2JIR A;  2QLV B;  4DGL A;  3NDI A;  4E33 A;  1JJ2 Z;  1JWH C;  3LUS A;  2E2J I;  3J81 f;  5T64 A;  3ESW A;  4RVF A;  1NJI 2;  2RHB A;  2LEX A;  5FLX f;  1YUA A;  4NBE A;  2DE7 A;  2E7Z A;  1I3Q I;  4DQY B;  3S1R I;  4A3F I;  1K8A 1;  5LL6 f;  1VQM Z;  3G4S 1;  3GTP I;  2I3C A;  4BBR I;  1YIJ 1;  3G71 Z;  2V8K A;  3CC2 Z;  1Q82 1;  1KC8 1;  3S17 I;  2R93 I;  3S1M I;  2R7Z I;  1VQ6 Z;  1YUK A;  3IR7 A;  3NDJ A;  5A2Q b;  2IV2 X;  2V8I A;  1USP A;  3HOZ I;  1YJN 1;  3CD6 1;  3I55 Z;  2WB1 A;  3CXC Z;  1VQP 1;  4QTU A;  5IT9 b;  1Q7Y 2;  1VQ4 Z;  3CCQ 1;  2K5R A;  1SIW A;  3CC7 1;  1QYP A;  3S1Q I;  4RVH A;  3VB9 A;  2QRD B;  4MXU A;  4A3B I;  1N2F A;  3GCF A;  2VUG A;  2H85 A;  3VMI A;  4AYB A;  2KI7 B;  2OTJ 1;  4HGZ A;  3G6E 1;  3GKQ A;  2JA8 I;  2RT9 A;  3I56 1;  3CCE Z;  2NAP A;  4NFR A;  2VUM I;  3PO3 S;  3MZL B;  3HOY I;  1X0T A;  5D1P A;  1ZB9 A;  4E30 A;  1RO4 A;  3G4S Z;  3VMG A;  3HOX I;  3GTO I;  1YIJ Z;  2JIP A;  4A93 I;  3CME 1;  1YJ9 1;  1I50 I;  3S1N I;  1YJW Z;  4RVG A;  1K9M 2;  5D1O B;  2J6A A;  1VQK 1;  4E2Z A;  3OW2 Y;  2JIO A;  3CMA 1;  1K73 1;  2AKL A;  2OOX B;  3JAM b;  1YJN Z;  3H0G I;  3CD6 Z;  4TNU A;  4HH4 A;  1VQP Z;  1M90 2;  2QA4 1;  4E32 A;  4A3L I;  2RIQ A;  2YAD A;  2OTL 1;  5FLX b;  2NVY I;  2F4O A;  3CC4 1;  1RO0 A;  3HOU I;  5T6B A;  2Q51 A;  2HF1 A;  2JMO A;  1VQN 1;  1Q86 1;  2OTJ Z;  3CCS 1;  4A3J I;  1VQ5 Z;  1Q16 A;  3IX0 A;  3MZK B;  4Y52 I;  1Q82 2;  1FDO A;  4E2Y A;  2OOY B;  4MH4 A;  1X3W A;  3Q87 A;  1K83 I;  4DK1 A;  4BY7 I;  2JIQ A;  3EED A;  3M4O I;  1YIT 1;  3CME Z;  1YJ9 Z;  2Y0S A;  1Z03 A;  2IZ3 A;  4MD7 A;  2HU9 A;  4NBA A;  1WZN A;  1QXF A;  1VQK Z;  1KRL A;  1ZB8 A;  1VQL 1;  3S2D I;  2P28 A;  2EGT A;  3CMA Z;  1KD1 1;  2AYD A;  3CCM 1;  3S16 I;  1YI2 1;  2B63 I;  2KPI A;  1VQO Z;  1TFI A;  2QA4 Z;  3BG1 B;  4Y7N I;  3CCL 1;  1M1K 1;  3GTK I;  4BXX I; 
#chains in the Genus database with same CATH homology
 2IZ4 A;  4NOZ A;  1TWG I;  2QKD A;  3CC4 Z;  4RVD A;  2R6M A;  4BBS I;  1W2B Y;  3GTJ I;  2JA5 I;  1VQN Z;  2QEX Z;  5C44 I;  4E2X A;  3PO2 I;  3PO3 I;  3TE5 B;  1NJI 1;  3OW2 Z;  4NBG A;  4NBH A;  4MRI A;  1VQ7 1;  4MD8 A;  3F3F C;  2M48 A;  4MD9 A;  3BG0 B;  1WCM I;  1TWC I;  1QF8 A;  2P3Y A;  1ZH1 A;  4CL1 A;  2JR6 A;  1QVG Y;  3NH5 A;  1ML8 A;  4NB9 A;  1VQL Z;  3D6W A;  4A3M I;  3CCM Z;  1VQ9 1;  3FQQ A;  4S1T A;  3GTG I;  2VF1 A;  4NH1 C;  1N8R 1;  2JA7 I;  2JS4 A;  1WII A;  5IT9 f;  3J81 b;  2PM9 A;  3U50 C;  3CCR 1;  4E2W A;  3GTQ I;  3CCQ Z;  3J7A 4;  3D9X A;  3IFU A;  2DE5 A;  3KIH A;  3CC7 Z;  3J80 f;  1NP6 A;  3T4N B;  2QRE B;  2GU2 A;  3G71 1;  2G2K A;  1RNI A;  1VQ7 Z;  2OZK A;  2LIY A;  2JA6 I;  3I07 A;  1K8A 2;  2LFU A;  1I6H I;  2DE6 A;  3G6E Z;  3CCV 1;  3I56 Z;  4BY1 I;  4NBB A;  1KC8 2;  1WW9 A;  4EWC A;  5AN9 F;  1YHQ 1;  2E9H A;  2QRC B;  1RLY A;  3FKI I;  1K9M 1;  4A3E I;  4RS4 A;  1VQ4 1;  1Q81 1;  1R9T I;  3CPW Y;  3S14 I;  2F4M A;  4NBD A;  1VQ8 1;  2PK7 A;  1S72 1;  2YU9 I;  1M1K 2;  1W2B Z;  1M90 1;  4RV9 A;  5D1O A;  3QWU A;  1P9N A;  1RO2 A;  1KQS Y;  2JUB A;  3EER A;  2K3R A;  3JAM f;  1Z02 A;  1L1O C;  3HKZ A;  3CCE 1;  3CCR Z;  4X6A I;  1QVF Z;  1DL6 A;  2OTL Z;  4XX2 A;  3MON A;  4HGY A;  1TWA I;  2V8J A;  3VTN A;  1QVG Z;  5FLM I;  2E2H I;  3S2H I;  1YJW 1;  4NB8 A;  4E31 A;  2QR1 B;  2PMZ A;  5C4J I;  3CCS Z;  3KIF A;  3GTM I;  2RPR A;  3S15 I;  4NBC A;  1JJ2 Y;  1TWH I;  3CCV Z;  2NVT I;  3CQZ I;  3CCJ 1;  3RZD I;  5T67 A;  1YHQ Z;  3CCU 1;  2M6N A;  2Q4Z A;  2BJO A;  2W04 A;  1TWF I;  1QVF Y;  3GTM S;  1VQ8 Z;  1K73 2;  3J80 b;  1N8R 2;  1S72 Z;  2RBL A;  4A3G I;  1YIT Z;  4A3K I;  3IF8 A;  3NFZ A;  2GTH A;  2ZAE B;  3NH8 A;  4A3I I;  2O4H A;  1VQ5 1;  1VLA A;  1YI2 Z;  1Q7Y 1;  5A2Q f;  2W03 A;  4NBF A;  1LQL A;  1S7M A;  1PFT A;  3K7A I;  3CCL Z;  3HOW I;  3CXC Y;  1Q86 2;  1NUI A;  3CPW Z;  4MON A;  5C3E I;  4QTT A;  1VQM 1;  1Y1V I;  2E2I I;  1Q81 2;  3P5J B;  3CC2 1;  3M3Y I;  2GTI A;  1KQS Z;  5IP9 I;  3H3V J;  1Z01 A;  3NH4 A;  3VMH A;  5IP7 I;  1VQ6 1;  3HOV I;  3F3P C;  2NVX I;  3CCJ Z;  1VQO 1;  5C4X I;  1USP B;  4A3C I;  3CCU Z;  2JNY A;  1Y1V S;  3I4M I;  3GTL I;  3FQM A;  3I55 1;  2R92 I;  3TDH B;  1Y1W I;  1KD1 2;  1X3Z A;  1RQF A;  5CM2 M;  2O53 A;  3RZO I;  4A3D I;  2WAQ A;  3I4N I;  2NVQ I;  1SFO I;  2QEX 1;  1VQ9 Z;  2QLV B;  4DGL A;  3NDI A;  4E33 A;  1JJ2 Z;  1JWH C;  3LUS A;  2E2J I;  3J81 f;  5T64 A;  3ESW A;  4RVF A;  1NJI 2;  2RHB A;  5FLX f;  1YUA A;  4NBE A;  2DE7 A;  1I3Q I;  4DQY B;  3S1R I;  4A3F I;  1K8A 1;  5LL6 f;  1VQM Z;  3G4S 1;  3GTP I;  2I3C A;  4BBR I;  1YIJ 1;  3G71 Z;  2V8K A;  3CC2 Z;  1Q82 1;  1KC8 1;  3S17 I;  2R93 I;  3S1M I;  2R7Z I;  1VQ6 Z;  1YUK A;  3NDJ A;  5A2Q b;  2V8I A;  1USP A;  3HOZ I;  1YJN 1;  3CD6 1;  3I55 Z;  2WB1 A;  3CXC Z;  1VQP 1;  4QTU A;  5IT9 b;  1Q7Y 2;  1VQ4 Z;  3CCQ 1;  2K5R A;  3CC7 1;  1QYP A;  3S1Q I;  4RVH A;  3VB9 A;  2QRD B;  4MXU A;  4A3B I;  1N2F A;  3GCF A;  2VUG A;  2H85 A;  3VMI A;  4AYB A;  2KI7 B;  2OTJ 1;  4HGZ A;  3G6E 1;  3GKQ A;  2JA8 I;  2RT9 A;  3I56 1;  3CCE Z;  3PO3 S;  4NFR A;  2VUM I;  3MZL B;  3HOY I;  1X0T A;  5D1P A;  1ZB9 A;  4E30 A;  1RO4 A;  3G4S Z;  3VMG A;  3HOX I;  3GTO I;  1YIJ Z;  4A93 I;  3CME 1;  1YJ9 1;  1I50 I;  3S1N I;  1YJW Z;  4RVG A;  1K9M 2;  5D1O B;  2J6A A;  1VQK 1;  4E2Z A;  3OW2 Y;  3CMA 1;  1K73 1;  2AKL A;  2OOX B;  3JAM b;  1YJN Z;  3H0G I;  3CD6 Z;  4TNU A;  4HH4 A;  1VQP Z;  1M90 2;  2QA4 1;  4E32 A;  4A3L I;  2RIQ A;  2YAD A;  2OTL 1;  5FLX b;  2NVY I;  2F4O A;  3CC4 1;  1RO0 A;  3HOU I;  5T6B A;  2Q51 A;  2HF1 A;  2JMO A;  1VQN 1;  1Q86 1;  2OTJ Z;  3CCS 1;  4A3J I;  1VQ5 Z;  3IX0 A;  3MZK B;  4Y52 I;  1Q82 2;  4E2Y A;  2OOY B;  4MH4 A;  1X3W A;  3Q87 A;  1K83 I;  4DK1 A;  4BY7 I;  3EED A;  3M4O I;  1YIT 1;  3CME Z;  1YJ9 Z;  2Y0S A;  1Z03 A;  2IZ3 A;  4MD7 A;  2HU9 A;  4NBA A;  1VQK Z;  1KRL A;  1ZB8 A;  1VQL 1;  3S2D I;  2P28 A;  2EGT A;  3CMA Z;  1KD1 1;  3CCM 1;  3S16 I;  1YI2 1;  2B63 I;  2KPI A;  1VQO Z;  1TFI A;  2QA4 Z;  3BG1 B;  4Y7N I;  3CCL 1;  1M1K 1;  3GTK I;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...