4A3EI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI02
3LUSA 3VMHA 1USPB 4NBAA 1Y1VI 2YU9I 5C4JI 2R93I 3VB9A 1K83I 3PO2I 3HOZI 1TWFI 2KPIA 4NB9A 3GTQI 3S17I 3S1RI 2R7ZI 2B63I 4NOZA 2F4OA 4BXXI 1RO4A 4XX2A 3Q87A 4Y7NI 1I50I 2DE5A 1Y1VS 1YUAA 4A93I 4NB8A 3GTOI 3S15I 1TWCI 4BY1I 3GTPI 4A3MI 3RZOI 1WCMI 2JS4A 2J6AA 4NBCA 3GKQA 4NBBA 1WW9A 5C4XI 2NVQI 4A3BI 3HOVI 2F4MA 2JR6A 1TWGI 3HOUI 4A3CI 2JA6I 2R92I 2E2JI 2E2HI 1L1OC 1VLAA 3M4OI 3S2DI 1NUIA 5IP7I 3I4MI 4NBFA 3K7AI 3GTJI 3PO3I 2DE7A 3I4NI 4NBHA 3S1NI 1X3WA 4A3KI 2RBLA 3S2HI 2P3YA 1QYPA 5C44I 2VUMI 4BBSI 2NVYI 2JA7I 1N2FA 1PFTA 2HF1A 2PK7A 1RLYA 1SFOI 5CM2M 3CQZI 1I3QI 3GTKI 5FLMI 1TWHI 1LQLA 3GTMI 1ZB8A 1USPA 3D6WA 4BBRI 3U50C 3I07A 3H3VJ 4Y52I 3GCFA 1I6HI 3PO3S 1TFIA 2DE6A 4MH4A 4NBDA 4A3II 3ESWA 3RZDI 3HOWI 4A3DI 1X3ZA 4NBEA 3VMIA 3S1QI 3M3YI 3FKII 5C3EI 3GTLI 4BY7I 4X6AI 1Y1WI 2K5RA 1ML8A 2NVXI 4A3GI 3HOXI 3H0GI 3GTGI 3S14I 2BJOA 3EERA 2JA5I 4A3EI 3S16I 5IP9I 3GTMS 2E2II 2JA8I 3VMGA 4A3FI 4A3JI 1TWAI 4QTTA 1ZB9A 1R9TI 2AKLA 4QTUA 4A3LI 3S1MI 4NBGA 2NVTI 3HOYI 2JNYA 1DL6A
chains in the Genus database with same CATH superfamily
2VPYA 3VMHA 5A2Qf 4NBAA 1M901 1YIJZ 5AN9F 1W2BZ 3VB9A 1K83I 2JMOA 3JAMb 3CC41 1K9M2 3EEDA 3CCM1 1TWFI 3CC71 3S17I 3CCE1 1P9NA 1VQO1 4NOZA 2V8JA 1W2BY 1Q862 4XX2A 3Q87A 2IZ3A 1I50I 2DE5A 1YUAA 3CCQZ 3S15I 1VQ51 3CCMZ 2V3VA 2PMZA 3CC7Z 3CCEZ 1RQFA 1K8A2 2M6NA 4RVGA 1VQOZ 2QRCB 2J6AA 4HGZA 3TDHB 1QVGY 1VQ7Z 1K732 3CCJ1 2OOXB 1VQ5Z 2E7ZA 1VLAA 3D2LA 3PO3I 3I4NI 2QLVB 2GTIA 2VUGA 2W04A 1VQN1 1QYPA 2VUMI 4AYBA 3NFZA 1AA6A 4RV9A 2G2KA 1RLYA 1SFOI 3CQZI 1KQSY 2JIQA 3D6WA 3I07A 1KC82 1VQNZ 3GCFA 4RVHA 3PO3S 1YIT1 1YI21 2RIQA 3RZDI 3BG0B 3CCRZ 3HOWI 4A3DI 1X3ZA 1Q7Y2 3CC21 3NH5A 1FDIA 2WAQA 3JAMf 1S7MA 4BY7I 4X6AI 2NVXI 3S14I 3EERA 3CPWY 2AYDA 1YITZ 1YI2Z 5IP9I 3CMA1 3J80b 3CC2Z 3FQMA 1QVFY 4TNUA 1VQ61 4A3JI 3OW2Z 2EGTA 4A3LI 4NBGA 3CMAZ 3HOYI 2W03A 2V45A 3IF8A 1Y8CA 1VQ6Z 4E2ZA 1YHQ1 1VQPZ 3NH4A 3CME1 4E32A 4MONA 2QREB 4NB9A 1QXFA 3J81b 4E30A 2F4OA 1N8R2 4BXXI 1YHQZ 3CMEZ 3CCV1 3CCS1 4E31A 3RZOI 1Z01A 3CCL1 2JS4A 1YJN1 4NBCA 3GKQA 2NVQI 4A3BI 2LEXA 1NJI1 2F4MA 3CCVZ 3CCSZ 2JR6A 5D1PA 1SIWA 1WIIA 2R92I 3IFUA 1L1OC 3S2DI 3CCLZ 1YJNZ 3I4MI 4NBFA 3J80f 3K7AI 2VPZA 3CC4Z 1Q812 1X3WA 2RBLA 5C44I 4BBSI 1ZH1A 1VQL1 2NVYI 2HF1A 4DGLA 2PK7A 3CD61 2IZ4A 3GTKI 5FLMI 1TWHI 1LQLA 1KD11 3H3VJ 3U50C 2Q4ZA 2OTJ1 1JWHC 3I561 4NBDA 5IT9f 1VQLZ 2JIMA 3VMIA 3CCJZ 2JIOA 3KIHA 2V8IA 2BJOA 3I56Z 5T64A 2Y0SA 2E2II 2JA8I 3D9XA 2Q51A 3TE5B 3IR7A 1YJW1 1TWAI 1R9TI 3MZKB 1S721 4QTUA 2M48A 2JUBA 2OZKA 1YUKA 2LIYA 1WJ2A 1Y1VI 4S1TA 2O53A 1S72Z 1Q821 1K8A1 3PO2I 3KIFA 5T67A 3HOZI 5A2Qb 1WZNA 3GTQI 1K731 2B63I 3IX0A 4Y7NI 3CXCZ 4MRIA 3J7A4 2YADA 1Y1VS 4A93I 2LFUA 1M902 4NB8A 3GTOI 1QF8A 2QRDB 4BY1I 4A3MI 1WCMI 4RVFA 3CXCY 3OW2Y 2K3RA 5C4XI 2RT9A 3BG1B 2WB1A 1TWGI 3HOUI 2JA6I 2E2JI 1Q16A 1RNIA 2OTL1 2HU9A 3I551 5IP7I 4MD9A 1KC81 3MONA 3GTJI 3G711 2VPWA 2JIPA 2DE7A 2V8KA 3G6E1 2VF1A 1Q7Y1 3S2HI 2P3YA 1VQ91 2OTLZ 4NH1C 4CL1A 1M1K1 2JA7I 2QKDA 1PFTA 5FLXb 3G71Z 4HGYA 1I3QI 3NH8A 4BBRI 3T4NB 4Y52I 1TFIA 4MH4A 3ESWA 2QA41 3M3YI 3FKII 4RVDA 3GTLI 4HH4A 3VTNA 1ML8A 4E2XA 4A3GI 3F3PC 3H0GI 3GTGI 3F3FC 2JA5I 3S16I 3CCQ1 2I3CA 2QR1B 2PM9A 2QA4Z 1X0TA 2RHBA 1Z02A 4QTTA 2GTHA 1VQ71 2QEX1 1QVGZ 4E33A 2AKLA 3HKZA 3S1MI 4DK1A 4EWCA 1FDOA 3G4S1 2JNYA 1N8R1 3LUSA 1RO2A 1USPB 5T6BA 1Q822 3CD6Z 3J81f 2YU9I 2NAPA 2OTJZ 5C4JI 2R93I 2QEXZ 3G4SZ 2KPIA 3S1RI 1K9M1 4RS4A 2R7ZI 2R6MA 3P5JB 1RO4A 1VQ81 3CCU1 1Z03A 5FLXf 1KQSZ 1Q861 2H85A 4MXUA 2IV2X 1TWCI 4NFRA 5LL6f 3CCR1 3GTPI 1YJWZ 1Q811 5D1OB 2JIRA 4NBBA 1WW9A 4E2YA 3NDIA 1VQ8Z 3HOVI 3CCUZ 1KRLA 3NDJA 4A3CI 1VQM1 2E2HI 3CPWZ 3M4OI 1NUIA 3QWUA 4E2WA 1QVFZ 4NBHA 3S1NI 4A3KI 1M1K2 1VQMZ 1JJ2Z 2GU2A 1NJI2 1NP6A 1N2FA 4MD7A 2ZAEB 5CM2M 3GTMI 1ZB8A 1USPA 1JJ2Y 2O4HA 1I6HI 2DE6A 1VQP1 4A3II 2OOYB 1VQ41 2P28A 4NBEA 3S1QI 4DQYB 5C3EI 1Y1WI 2K5RA 3HOXI 1YJ91 5IT9b 2RPRA 1VQK1 2KI7B 4A3EI 3I55Z 3GTMS 1VQ4Z 1KD12 3VMGA 3G6EZ 4A3FI 2VPXA 1YIJ1 1ZB9A 3FQQA 4MD8A 1YJ9Z 1VQKZ 1VQ9Z 5D1OA 3MZLB 2NVTI 2E9HA 1RO0A 1DL6A
chains in the Genus database with same CATH topology
3VMHA 5A2Qf 4NBAA 1M901 1YIJZ 5AN9F 1W2BZ 3VB9A 1K83I 2JMOA 3JAMb 3CC41 1K9M2 3EEDA 3CCM1 1TWFI 3CC71 3S17I 3CCE1 1P9NA 1VQO1 4NOZA 2V8JA 1W2BY 1Q862 4XX2A 3Q87A 2IZ3A 1I50I 2DE5A 1YUAA 3CCQZ 3S15I 1VQ51 3CCMZ 2PMZA 3CC7Z 3CCEZ 1RQFA 1K8A2 2M6NA 4RVGA 1VQOZ 2QRCB 2J6AA 4HGZA 3TDHB 1QVGY 1VQ7Z 1K732 3CCJ1 2OOXB 1VQ5Z 1VLAA 3PO3I 3I4NI 2QLVB 2GTIA 2VUGA 2W04A 1VQN1 1QYPA 2VUMI 4AYBA 3NFZA 4RV9A 2G2KA 1RLYA 1SFOI 3CQZI 1KQSY 3D6WA 3I07A 1KC82 1VQNZ 3GCFA 4RVHA 3PO3S 1YIT1 1YI21 2RIQA 3RZDI 3BG0B 3CCRZ 3HOWI 4A3DI 1X3ZA 1Q7Y2 3CC21 3NH5A 2WAQA 3JAMf 1S7MA 4BY7I 4X6AI 2NVXI 3S14I 3EERA 3CPWY 1YITZ 1YI2Z 5IP9I 3CMA1 3J80b 3CC2Z 3FQMA 1QVFY 4TNUA 1VQ61 4A3JI 3OW2Z 2EGTA 4A3LI 4NBGA 3CMAZ 3HOYI 2W03A 3IF8A 1VQ6Z 4E2ZA 1YHQ1 1VQPZ 3NH4A 3CME1 4E32A 4MONA 2QREB 4NB9A 3J81b 4E30A 2F4OA 1N8R2 4BXXI 1YHQZ 3CMEZ 3CCV1 3CCS1 4E31A 3RZOI 1Z01A 3CCL1 2JS4A 1YJN1 4NBCA 3GKQA 2NVQI 4A3BI 1NJI1 2F4MA 3CCVZ 3CCSZ 2JR6A 5D1PA 1WIIA 2R92I 3IFUA 1L1OC 3S2DI 3CCLZ 1YJNZ 3I4MI 4NBFA 3J80f 3K7AI 3CC4Z 1Q812 1X3WA 2RBLA 5C44I 4BBSI 1ZH1A 1VQL1 2NVYI 2HF1A 4DGLA 2PK7A 3CD61 2IZ4A 3GTKI 5FLMI 1TWHI 1LQLA 1KD11 3H3VJ 3U50C 2Q4ZA 2OTJ1 1JWHC 3I561 4NBDA 5IT9f 1VQLZ 3VMIA 3CCJZ 3KIHA 2V8IA 2BJOA 3I56Z 5T64A 2Y0SA 2E2II 2JA8I 3D9XA 2Q51A 3TE5B 1YJW1 1TWAI 1R9TI 3MZKB 1S721 4QTUA 2M48A 2JUBA 2OZKA 1YUKA 2LIYA 1Y1VI 4S1TA 2O53A 1S72Z 1Q821 1K8A1 3PO2I 3KIFA 5T67A 3HOZI 5A2Qb 3GTQI 1K731 2B63I 3IX0A 4Y7NI 3CXCZ 4MRIA 3J7A4 2YADA 1Y1VS 4A93I 2LFUA 1M902 4NB8A 3GTOI 1QF8A 2QRDB 4BY1I 4A3MI 1WCMI 4RVFA 3CXCY 3OW2Y 2K3RA 5C4XI 2RT9A 3BG1B 2WB1A 1TWGI 3HOUI 2JA6I 2E2JI 1RNIA 2OTL1 2HU9A 3I551 5IP7I 4MD9A 1KC81 3MONA 3GTJI 3G711 2DE7A 2V8KA 3G6E1 2VF1A 1Q7Y1 3S2HI 2P3YA 1VQ91 2OTLZ 4NH1C 4CL1A 1M1K1 2JA7I 2QKDA 1PFTA 5FLXb 3G71Z 4HGYA 1I3QI 3NH8A 4BBRI 3T4NB 4Y52I 1TFIA 4MH4A 3ESWA 2QA41 3M3YI 3FKII 4RVDA 3GTLI 4HH4A 3VTNA 1ML8A 4E2XA 4A3GI 3F3PC 3H0GI 3GTGI 3F3FC 2JA5I 3S16I 3CCQ1 2I3CA 2QR1B 2PM9A 2QA4Z 1X0TA 2RHBA 1Z02A 4QTTA 2GTHA 1VQ71 2QEX1 1QVGZ 4E33A 2AKLA 3HKZA 3S1MI 4DK1A 4EWCA 3G4S1 2JNYA 1N8R1 3LUSA 1RO2A 1USPB 5T6BA 1Q822 3CD6Z 3J81f 2YU9I 2OTJZ 5C4JI 2R93I 2QEXZ 3G4SZ 2KPIA 3S1RI 1K9M1 4RS4A 2R7ZI 2R6MA 3P5JB 1RO4A 1VQ81 3CCU1 1Z03A 5FLXf 1KQSZ 1Q861 2H85A 4MXUA 1TWCI 4NFRA 5LL6f 3CCR1 3GTPI 1YJWZ 1Q811 5D1OB 4NBBA 1WW9A 4E2YA 3NDIA 1VQ8Z 3HOVI 3CCUZ 1KRLA 3NDJA 4A3CI 1VQM1 2E2HI 3CPWZ 3M4OI 1NUIA 3QWUA 4E2WA 1QVFZ 4NBHA 3S1NI 4A3KI 1M1K2 1VQMZ 1JJ2Z 2GU2A 1NJI2 1NP6A 1N2FA 4MD7A 2ZAEB 5CM2M 3GTMI 1ZB8A 1USPA 1JJ2Y 2O4HA 1I6HI 2DE6A 1VQP1 4A3II 2OOYB 1VQ41 2P28A 4NBEA 3S1QI 4DQYB 5C3EI 1Y1WI 2K5RA 3HOXI 1YJ91 5IT9b 2RPRA 1VQK1 2KI7B 4A3EI 3I55Z 3GTMS 1VQ4Z 1KD12 3VMGA 3G6EZ 4A3FI 1YIJ1 1ZB9A 3FQQA 4MD8A 1YJ9Z 1VQKZ 1VQ9Z 5D1OA 3MZLB 2NVTI 2E9HA 1RO0A 1DL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUS A;  3VMH A;  1USP B;  4NBA A;  1Y1V I;  2YU9 I;  5C4J I;  2R93 I;  3VB9 A;  1K83 I;  3PO2 I;  3HOZ I;  1TWF I;  2KPI A;  4NB9 A;  3GTQ I;  3S17 I;  3S1R I;  2R7Z I;  2B63 I;  4NOZ A;  2F4O A;  4BXX I;  1RO4 A;  4XX2 A;  3Q87 A;  4Y7N I;  1I50 I;  2DE5 A;  1Y1V S;  1YUA A;  4A93 I;  4NB8 A;  3GTO I;  3S15 I;  1TWC I;  4BY1 I;  3GTP I;  4A3M I;  3RZO I;  1WCM I;  2JS4 A;  2J6A A;  4NBC A;  3GKQ A;  4NBB A;  1WW9 A;  5C4X I;  2NVQ I;  4A3B I;  3HOV I;  2F4M A;  2JR6 A;  1TWG I;  3HOU I;  4A3C I;  2JA6 I;  2R92 I;  2E2J I;  2E2H I;  1L1O C;  1VLA A;  3M4O I;  3S2D I;  1NUI A;  5IP7 I;  3I4M I;  4NBF A;  3K7A I;  3GTJ I;  3PO3 I;  2DE7 A;  3I4N I;  4NBH A;  3S1N I;  1X3W A;  4A3K I;  2RBL A;  3S2H I;  2P3Y A;  1QYP A;  5C44 I;  2VUM I;  4BBS I;  2NVY I;  2JA7 I;  1N2F A;  1PFT A;  2HF1 A;  2PK7 A;  1RLY A;  1SFO I;  5CM2 M;  3CQZ I;  1I3Q I;  3GTK I;  5FLM I;  1TWH I;  1LQL A;  3GTM I;  1ZB8 A;  1USP A;  3D6W A;  4BBR I;  3U50 C;  3I07 A;  3H3V J;  4Y52 I;  3GCF A;  1I6H I;  3PO3 S;  1TFI A;  2DE6 A;  4MH4 A;  4NBD A;  4A3I I;  3ESW A;  3RZD I;  3HOW I;  4A3D I;  1X3Z A;  4NBE A;  3VMI A;  3S1Q I;  3M3Y I;  3FKI I;  5C3E I;  3GTL I;  4BY7 I;  4X6A I;  1Y1W I;  2K5R A;  1ML8 A;  2NVX I;  4A3G I;  3HOX I;  3H0G I;  3GTG I;  3S14 I;  2BJO A;  3EER A;  2JA5 I;  4A3E I;  3S16 I;  5IP9 I;  3GTM S;  2E2I I;  2JA8 I;  3VMG A;  4A3F I;  4A3J I;  1TWA I;  4QTT A;  1ZB9 A;  1R9T I;  2AKL A;  4QTU A;  4A3L I;  3S1M I;  4NBG A;  2NVT I;  3HOY I;  2JNY A;  1DL6 A; 
#chains in the Genus database with same CATH topology
 2VPY A;  3VMH A;  5A2Q f;  4NBA A;  1M90 1;  1YIJ Z;  5AN9 F;  1W2B Z;  3VB9 A;  1K83 I;  2JMO A;  3JAM b;  3CC4 1;  1K9M 2;  3EED A;  3CCM 1;  1TWF I;  3CC7 1;  3S17 I;  3CCE 1;  1P9N A;  1VQO 1;  4NOZ A;  2V8J A;  1W2B Y;  1Q86 2;  4XX2 A;  3Q87 A;  2IZ3 A;  1I50 I;  2DE5 A;  1YUA A;  3CCQ Z;  3S15 I;  1VQ5 1;  3CCM Z;  2V3V A;  2PMZ A;  3CC7 Z;  3CCE Z;  1RQF A;  1K8A 2;  2M6N A;  4RVG A;  1VQO Z;  2QRC B;  2J6A A;  4HGZ A;  3TDH B;  1QVG Y;  1VQ7 Z;  1K73 2;  3CCJ 1;  2OOX B;  1VQ5 Z;  2E7Z A;  1VLA A;  3D2L A;  3PO3 I;  3I4N I;  2QLV B;  2GTI A;  2VUG A;  2W04 A;  1VQN 1;  1QYP A;  2VUM I;  4AYB A;  3NFZ A;  1AA6 A;  4RV9 A;  2G2K A;  1RLY A;  1SFO I;  3CQZ I;  1KQS Y;  2JIQ A;  3D6W A;  3I07 A;  1KC8 2;  1VQN Z;  3GCF A;  4RVH A;  3PO3 S;  1YIT 1;  1YI2 1;  2RIQ A;  3RZD I;  3BG0 B;  3CCR Z;  3HOW I;  4A3D I;  1X3Z A;  1Q7Y 2;  3CC2 1;  3NH5 A;  1FDI A;  2WAQ A;  3JAM f;  1S7M A;  4BY7 I;  4X6A I;  2NVX I;  3S14 I;  3EER A;  3CPW Y;  2AYD A;  1YIT Z;  1YI2 Z;  5IP9 I;  3CMA 1;  3J80 b;  3CC2 Z;  3FQM A;  1QVF Y;  4TNU A;  1VQ6 1;  4A3J I;  3OW2 Z;  2EGT A;  4A3L I;  4NBG A;  3CMA Z;  3HOY I;  2W03 A;  2V45 A;  3IF8 A;  1Y8C A;  1VQ6 Z;  4E2Z A;  1YHQ 1;  1VQP Z;  3NH4 A;  3CME 1;  4E32 A;  4MON A;  2QRE B;  4NB9 A;  1QXF A;  3J81 b;  4E30 A;  2F4O A;  1N8R 2;  4BXX I;  1YHQ Z;  3CME Z;  3CCV 1;  3CCS 1;  4E31 A;  3RZO I;  1Z01 A;  3CCL 1;  2JS4 A;  1YJN 1;  4NBC A;  3GKQ A;  2NVQ I;  4A3B I;  2LEX A;  1NJI 1;  2F4M A;  3CCV Z;  3CCS Z;  2JR6 A;  5D1P A;  1SIW A;  1WII A;  2R92 I;  3IFU A;  1L1O C;  3S2D I;  3CCL Z;  1YJN Z;  3I4M I;  4NBF A;  3J80 f;  3K7A I;  2VPZ A;  3CC4 Z;  1Q81 2;  1X3W A;  2RBL A;  5C44 I;  4BBS I;  1ZH1 A;  1VQL 1;  2NVY I;  2HF1 A;  4DGL A;  2PK7 A;  3CD6 1;  2IZ4 A;  3GTK I;  5FLM I;  1TWH I;  1LQL A;  1KD1 1;  3H3V J;  3U50 C;  2Q4Z A;  2OTJ 1;  1JWH C;  3I56 1;  4NBD A;  5IT9 f;  1VQL Z;  2JIM A;  3VMI A;  3CCJ Z;  2JIO A;  3KIH A;  2V8I A;  2BJO A;  3I56 Z;  5T64 A;  2Y0S A;  2E2I I;  2JA8 I;  3D9X A;  2Q51 A;  3TE5 B;  3IR7 A;  1YJW 1;  1TWA I;  1R9T I;  3MZK B;  1S72 1;  4QTU A;  2M48 A;  2JUB A;  2OZK A;  1YUK A;  2LIY A;  1WJ2 A;  1Y1V I;  4S1T A;  2O53 A;  1S72 Z;  1Q82 1;  1K8A 1;  3PO2 I;  3KIF A;  5T67 A;  3HOZ I;  5A2Q b;  1WZN A;  3GTQ I;  1K73 1;  2B63 I;  3IX0 A;  4Y7N I;  3CXC Z;  4MRI A;  3J7A 4;  2YAD A;  1Y1V S;  4A93 I;  2LFU A;  1M90 2;  4NB8 A;  3GTO I;  1QF8 A;  2QRD B;  4BY1 I;  4A3M I;  1WCM I;  4RVF A;  3CXC Y;  3OW2 Y;  2K3R A;  5C4X I;  2RT9 A;  3BG1 B;  2WB1 A;  1TWG I;  3HOU I;  2JA6 I;  2E2J I;  1Q16 A;  1RNI A;  2OTL 1;  2HU9 A;  3I55 1;  5IP7 I;  4MD9 A;  1KC8 1;  3MON A;  3GTJ I;  3G71 1;  2VPW A;  2JIP A;  2DE7 A;  2V8K A;  3G6E 1;  2VF1 A;  1Q7Y 1;  3S2H I;  2P3Y A;  1VQ9 1;  2OTL Z;  4NH1 C;  4CL1 A;  1M1K 1;  2JA7 I;  2QKD A;  1PFT A;  5FLX b;  3G71 Z;  4HGY A;  1I3Q I;  3NH8 A;  4BBR I;  3T4N B;  4Y52 I;  1TFI A;  4MH4 A;  3ESW A;  2QA4 1;  3M3Y I;  3FKI I;  4RVD A;  3GTL I;  4HH4 A;  3VTN A;  1ML8 A;  4E2X A;  4A3G I;  3F3P C;  3H0G I;  3GTG I;  3F3F C;  2JA5 I;  3S16 I;  3CCQ 1;  2I3C A;  2QR1 B;  2PM9 A;  2QA4 Z;  1X0T A;  2RHB A;  1Z02 A;  4QTT A;  2GTH A;  1VQ7 1;  2QEX 1;  1QVG Z;  4E33 A;  2AKL A;  3HKZ A;  3S1M I;  4DK1 A;  4EWC A;  1FDO A;  3G4S 1;  2JNY A;  1N8R 1;  3LUS A;  1RO2 A;  1USP B;  5T6B A;  1Q82 2;  3CD6 Z;  3J81 f;  2YU9 I;  2NAP A;  2OTJ Z;  5C4J I;  2R93 I;  2QEX Z;  3G4S Z;  2KPI A;  3S1R I;  1K9M 1;  4RS4 A;  2R7Z I;  2R6M A;  3P5J B;  1RO4 A;  1VQ8 1;  3CCU 1;  1Z03 A;  5FLX f;  1KQS Z;  1Q86 1;  2H85 A;  4MXU A;  2IV2 X;  1TWC I;  4NFR A;  5LL6 f;  3CCR 1;  3GTP I;  1YJW Z;  1Q81 1;  5D1O B;  2JIR A;  4NBB A;  1WW9 A;  4E2Y A;  3NDI A;  1VQ8 Z;  3HOV I;  3CCU Z;  1KRL A;  3NDJ A;  4A3C I;  1VQM 1;  2E2H I;  3CPW Z;  3M4O I;  1NUI A;  3QWU A;  4E2W A;  1QVF Z;  4NBH A;  3S1N I;  4A3K I;  1M1K 2;  1VQM Z;  1JJ2 Z;  2GU2 A;  1NJI 2;  1NP6 A;  1N2F A;  4MD7 A;  2ZAE B;  5CM2 M;  3GTM I;  1ZB8 A;  1USP A;  1JJ2 Y;  2O4H A;  1I6H I;  2DE6 A;  1VQP 1;  4A3I I;  2OOY B;  1VQ4 1;  2P28 A;  4NBE A;  3S1Q I;  4DQY B;  5C3E I;  1Y1W I;  2K5R A;  3HOX I;  1YJ9 1;  5IT9 b;  2RPR A;  1VQK 1;  2KI7 B;  4A3E I;  3I55 Z;  3GTM S;  1VQ4 Z;  1KD1 2;  3VMG A;  3G6E Z;  4A3F I;  2VPX A;  1YIJ 1;  1ZB9 A;  3FQQ A;  4MD8 A;  1YJ9 Z;  1VQK Z;  1VQ9 Z;  5D1O A;  3MZL B;  2NVT I;  2E9H A;  1RO0 A;  1DL6 A; 
#chains in the Genus database with same CATH homology
 3VMH A;  5A2Q f;  4NBA A;  1M90 1;  1YIJ Z;  5AN9 F;  1W2B Z;  3VB9 A;  1K83 I;  2JMO A;  3JAM b;  3CC4 1;  1K9M 2;  3EED A;  3CCM 1;  1TWF I;  3CC7 1;  3S17 I;  3CCE 1;  1P9N A;  1VQO 1;  4NOZ A;  2V8J A;  1W2B Y;  1Q86 2;  4XX2 A;  3Q87 A;  2IZ3 A;  1I50 I;  2DE5 A;  1YUA A;  3CCQ Z;  3S15 I;  1VQ5 1;  3CCM Z;  2PMZ A;  3CC7 Z;  3CCE Z;  1RQF A;  1K8A 2;  2M6N A;  4RVG A;  1VQO Z;  2QRC B;  2J6A A;  4HGZ A;  3TDH B;  1QVG Y;  1VQ7 Z;  1K73 2;  3CCJ 1;  2OOX B;  1VQ5 Z;  1VLA A;  3PO3 I;  3I4N I;  2QLV B;  2GTI A;  2VUG A;  2W04 A;  1VQN 1;  1QYP A;  2VUM I;  4AYB A;  3NFZ A;  4RV9 A;  2G2K A;  1RLY A;  1SFO I;  3CQZ I;  1KQS Y;  3D6W A;  3I07 A;  1KC8 2;  1VQN Z;  3GCF A;  4RVH A;  3PO3 S;  1YIT 1;  1YI2 1;  2RIQ A;  3RZD I;  3BG0 B;  3CCR Z;  3HOW I;  4A3D I;  1X3Z A;  1Q7Y 2;  3CC2 1;  3NH5 A;  2WAQ A;  3JAM f;  1S7M A;  4BY7 I;  4X6A I;  2NVX I;  3S14 I;  3EER A;  3CPW Y;  1YIT Z;  1YI2 Z;  5IP9 I;  3CMA 1;  3J80 b;  3CC2 Z;  3FQM A;  1QVF Y;  4TNU A;  1VQ6 1;  4A3J I;  3OW2 Z;  2EGT A;  4A3L I;  4NBG A;  3CMA Z;  3HOY I;  2W03 A;  3IF8 A;  1VQ6 Z;  4E2Z A;  1YHQ 1;  1VQP Z;  3NH4 A;  3CME 1;  4E32 A;  4MON A;  2QRE B;  4NB9 A;  3J81 b;  4E30 A;  2F4O A;  1N8R 2;  4BXX I;  1YHQ Z;  3CME Z;  3CCV 1;  3CCS 1;  4E31 A;  3RZO I;  1Z01 A;  3CCL 1;  2JS4 A;  1YJN 1;  4NBC A;  3GKQ A;  2NVQ I;  4A3B I;  1NJI 1;  2F4M A;  3CCV Z;  3CCS Z;  2JR6 A;  5D1P A;  1WII A;  2R92 I;  3IFU A;  1L1O C;  3S2D I;  3CCL Z;  1YJN Z;  3I4M I;  4NBF A;  3J80 f;  3K7A I;  3CC4 Z;  1Q81 2;  1X3W A;  2RBL A;  5C44 I;  4BBS I;  1ZH1 A;  1VQL 1;  2NVY I;  2HF1 A;  4DGL A;  2PK7 A;  3CD6 1;  2IZ4 A;  3GTK I;  5FLM I;  1TWH I;  1LQL A;  1KD1 1;  3H3V J;  3U50 C;  2Q4Z A;  2OTJ 1;  1JWH C;  3I56 1;  4NBD A;  5IT9 f;  1VQL Z;  3VMI A;  3CCJ Z;  3KIH A;  2V8I A;  2BJO A;  3I56 Z;  5T64 A;  2Y0S A;  2E2I I;  2JA8 I;  3D9X A;  2Q51 A;  3TE5 B;  1YJW 1;  1TWA I;  1R9T I;  3MZK B;  1S72 1;  4QTU A;  2M48 A;  2JUB A;  2OZK A;  1YUK A;  2LIY A;  1Y1V I;  4S1T A;  2O53 A;  1S72 Z;  1Q82 1;  1K8A 1;  3PO2 I;  3KIF A;  5T67 A;  3HOZ I;  5A2Q b;  3GTQ I;  1K73 1;  2B63 I;  3IX0 A;  4Y7N I;  3CXC Z;  4MRI A;  3J7A 4;  2YAD A;  1Y1V S;  4A93 I;  2LFU A;  1M90 2;  4NB8 A;  3GTO I;  1QF8 A;  2QRD B;  4BY1 I;  4A3M I;  1WCM I;  4RVF A;  3CXC Y;  3OW2 Y;  2K3R A;  5C4X I;  2RT9 A;  3BG1 B;  2WB1 A;  1TWG I;  3HOU I;  2JA6 I;  2E2J I;  1RNI A;  2OTL 1;  2HU9 A;  3I55 1;  5IP7 I;  4MD9 A;  1KC8 1;  3MON A;  3GTJ I;  3G71 1;  2DE7 A;  2V8K A;  3G6E 1;  2VF1 A;  1Q7Y 1;  3S2H I;  2P3Y A;  1VQ9 1;  2OTL Z;  4NH1 C;  4CL1 A;  1M1K 1;  2JA7 I;  2QKD A;  1PFT A;  5FLX b;  3G71 Z;  4HGY A;  1I3Q I;  3NH8 A;  4BBR I;  3T4N B;  4Y52 I;  1TFI A;  4MH4 A;  3ESW A;  2QA4 1;  3M3Y I;  3FKI I;  4RVD A;  3GTL I;  4HH4 A;  3VTN A;  1ML8 A;  4E2X A;  4A3G I;  3F3P C;  3H0G I;  3GTG I;  3F3F C;  2JA5 I;  3S16 I;  3CCQ 1;  2I3C A;  2QR1 B;  2PM9 A;  2QA4 Z;  1X0T A;  2RHB A;  1Z02 A;  4QTT A;  2GTH A;  1VQ7 1;  2QEX 1;  1QVG Z;  4E33 A;  2AKL A;  3HKZ A;  3S1M I;  4DK1 A;  4EWC A;  3G4S 1;  2JNY A;  1N8R 1;  3LUS A;  1RO2 A;  1USP B;  5T6B A;  1Q82 2;  3CD6 Z;  3J81 f;  2YU9 I;  2OTJ Z;  5C4J I;  2R93 I;  2QEX Z;  3G4S Z;  2KPI A;  3S1R I;  1K9M 1;  4RS4 A;  2R7Z I;  2R6M A;  3P5J B;  1RO4 A;  1VQ8 1;  3CCU 1;  1Z03 A;  5FLX f;  1KQS Z;  1Q86 1;  2H85 A;  4MXU A;  1TWC I;  4NFR A;  5LL6 f;  3CCR 1;  3GTP I;  1YJW Z;  1Q81 1;  5D1O B;  4NBB A;  1WW9 A;  4E2Y A;  3NDI A;  1VQ8 Z;  3HOV I;  3CCU Z;  1KRL A;  3NDJ A;  4A3C I;  1VQM 1;  2E2H I;  3CPW Z;  3M4O I;  1NUI A;  3QWU A;  4E2W A;  1QVF Z;  4NBH A;  3S1N I;  4A3K I;  1M1K 2;  1VQM Z;  1JJ2 Z;  2GU2 A;  1NJI 2;  1NP6 A;  1N2F A;  4MD7 A;  2ZAE B;  5CM2 M;  3GTM I;  1ZB8 A;  1USP A;  1JJ2 Y;  2O4H A;  1I6H I;  2DE6 A;  1VQP 1;  4A3I I;  2OOY B;  1VQ4 1;  2P28 A;  4NBE A;  3S1Q I;  4DQY B;  5C3E I;  1Y1W I;  2K5R A;  3HOX I;  1YJ9 1;  5IT9 b;  2RPR A;  1VQK 1;  2KI7 B;  4A3E I;  3I55 Z;  3GTM S;  1VQ4 Z;  1KD1 2;  3VMG A;  3G6E Z;  4A3F I;  1YIJ 1;  1ZB9 A;  3FQQ A;  4MD8 A;  1YJ9 Z;  1VQK Z;  1VQ9 Z;  5D1O A;  3MZL B;  2NVT I;  2E9H A;  1RO0 A;  1DL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...