4A3EI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI02
1USPA 3GTKI 3D6WA 2E2II 4NOZA 3VMHA 2PK7A 3HOYI 2E2HI 3EERA 2AKLA 4BBSI 2DE7A 1PFTA 1VLAA 1L1OC 2HF1A 5FLMI 1I3QI 1X3ZA 2DE6A 3GTPI 4A3BI 3S1RI 4BY1I 4BBRI 3GTMI 3HOWI 4NBGA 3GTOI 5CM2M 1TWFI 3S16I 1Y1VI 3PO3S 2R7ZI 4A3DI 3Q87A 2B63I 4QTTA 3FKII 4NB8A 4NBFA 2K5RA 1N2FA 4NBAA 3VB9A 1TWCI 4X6AI 2RBLA 2J6AA 2JA5I 1I6HI 3GTGI 1QYPA 1ZB9A 3I07A 3LUSA 3S14I 2KPIA 4A3JI 3VMGA 3CQZI 3I4MI 3GTJI 1TWHI 5C4JI 2JS4A 1ML8A 4NBDA 4A3KI 4MH4A 4QTUA 2NVTI 2F4MA 3M4OI 4A3CI 3PO3I 2JNYA 1LQLA 3HOUI 3S1MI 3K7AI 3GCFA 5C44I 2NVQI 3GTQI 1Y1WI 5C4XI 1RO4A 2P3YA 3S17I 3H3VJ 1K83I 3M3YI 2NVXI 4BXXI 4A3MI 4NBHA 4Y52I 2NVYI 4A93I 4NBEA 1WCMI 2JA7I 3HOVI 1SFOI 1I50I 1TWGI 3RZOI 1DL6A 1X3WA 2VUMI 3H0GI 3HOXI 4A3FI 1RLYA 1R9TI 2E2JI 2JA6I 2JA8I 3S15I 2BJOA 3PO2I 3VMIA 3HOZI 4A3LI 1ZB8A 3GTMS 2JR6A 5IP9I 3GTLI 1NUIA 1TFIA 1YUAA 1Y1VS 3S1QI 3RZDI 3S2DI 5C3EI 4A3GI 4A3EI 1USPB 2YU9I 4NB9A 4NBCA 4BY7I 3S2HI 3U50C 3GKQA 4A3II 4Y7NI 1TWAI 3ESWA 1WW9A 2F4OA 3S1NI 4NBBA 3I4NI 4XX2A 5IP7I 2R92I 2DE5A 2R93I
chains in the Genus database with same CATH superfamily
1X0TA 2Q51A 3MZKB 3OW2Y 4NOZA 3HOYI 3CC2Z 3EERA 4BBSI 1VQ61 2DE7A 2VPWA 1KC81 1WIIA 1Q812 5FLMI 1X3ZA 2E9HA 4A3BI 3J80f 3NFZA 3S1RI 3CCLZ 4E2XA 5CM2M 1YIJZ 3S16I 2R7ZI 3Q87A 3I551 4QTTA 2V8IA 4NBFA 1M1K1 2K5RA 1N2FA 4X6AI 2JIMA 1Y8CA 1Q16A 4TNUA 1ZH1A 4E2ZA 5FLXb 1K9M1 3HKZA 3GTJI 2W04A 5C4JI 4S1TA 2JS4A 3CCR1 3TE5B 2NVTI 2F4MA 3M4OI 1VQK1 1RNIA 1LQLA 3S1MI 1Q861 3CCJZ 3GCFA 5D1OB 4RVDA 5C44I 2V3VA 2VPZA 5C4XI 1RO4A 2RHBA 3M3YI 1VQLZ 1KD12 3TDHB 3G711 4NBHA 1Q822 3J80b 1KC82 1WCMI 4E2YA 2QEX1 2PMZA 2JIRA 1X3WA 1YJ9Z 1K731 2JA8I 2GU2A 3VMIA 1VQ51 3HOZI 2RPRA 2V8KA 2E7ZA 1YI2Z 3GTMS 1YUAA 2KI7B 1Y1VS 2GTIA 3CCUZ 5C3EI 5LL6f 4A3EI 2OTJZ 2R6MA 2W03A 4Y7NI 3CCE1 3ESWA 5IP7I 1RO2A 1QYPA 1VQPZ 3G4S1 1USPA 1K9M2 3GTKI 2LEXA 1VQOZ 3VMHA 1M901 2PK7A 2H85A 2AKLA 1YJW1 1VQ7Z 1PFTA 2HF1A 1K8A1 3GTPI 4DGLA 1W2BZ 1VQ6Z 3BG1B 3CPWZ 3GTOI 1WJ2A 3PO3S 1VQM1 4E31A 3KIFA 1YITZ 2QA41 2QREB 3CMAZ 2VPYA 1Q7Y1 1S72Z 3G6E1 1FDIA 3F3FC 2RBLA 5IT9f 1W2BY 2J6AA 3T4NB 2JA5I 3CCVZ 4E2WA 3CPWY 3GTGI 1ZB9A 3I07A 3LUSA 4DQYB 3CQZI 1Z03A 1TWHI 2VPXA 1AA6A 2WAQA 4A3KI 3JAMb 4QTUA 4A3CI 2NAPA 3CCRZ 4MD8A 5AN9F 3D2LA 1VQ9Z 3GTQI 3CC71 5T6BA 1YHQ1 3S17I 4RVHA 2OOYB 1YJNZ 3CCSZ 2OTL1 1M902 4BXXI 2VUGA 4Y52I 1N8R2 4NBEA 3FQQA 4RVGA 3QWUA 2JA7I 1NJI1 4MONA 3CC21 1TWGI 1VQ8Z 3RZOI 3HOXI 1R9TI 3S15I 1P9NA 3CCL1 3D9XA 1ZB8A 3CCMZ 5IT9b 2QKDA 2V45A 4BY7I 2Q4ZA 4NBCA 1TWAI 1WW9A 2F4OA 3S1NI 1KRLA 2OOXB 2GTHA 3D6WA 2E2II 2E2HI 3G4SZ 1VQ4Z 3J81f 1VLAA 2HU9A 1I3QI 2DE6A 2JMOA 1M1K2 3GTMI 3HOWI 3FQMA 1RO0A 2PM9A 3CMEZ 1Y1VI 3CCQ1 3CCJ1 1Q811 2RT9A 3FKII 4NB8A 4NFRA 1NJI2 2Y0SA 1VQNZ 3IX0A 3J7A4 1I6HI 4NH1C 1QF8A 2JIOA 1RQFA 1Q862 3S14I 1NP6A 2JUBA 3VMGA 3I4MI 4MH4A 1YI21 3NDJA 3CC41 3PO3I 3I561 2QLVB 3NH5A 4EWCA 3HOUI 3CD61 3K7AI 3CCU1 4DK1A 2LFUA 2O53A 2ZAEB 3I55Z 2P3YA 1K732 1K83I 2NVXI 3J81b 1VQP1 4MXUA 2OTLZ 2IZ4A 3NDIA 3HOVI 1SFOI 1I50I 3CXCZ 1VQ71 3H0GI 4A3FI 1QVFZ 3IFUA 2BJOA 1KD11 1Q821 4CL1A 3KIHA 2QRCB 1VQN1 1VQKZ 1NUIA 1QXFA 4E32A 3RZDI 1YIT1 3S2DI 4A3GI 2QRDB 3CMA1 5D1OA 3S2HI 3MONA 3CXCY 2IZ3A 3GKQA 4A3II 1S721 5A2Qf 3VTNA 1QVGZ 1K8A2 1QVFY 3NH4A 1KQSZ 4XX2A 3G71Z 2DE5A 2I3CA 2V8JA 3CCV1 3NH8A 2QEXZ 1Z02A 1WZNA 2G2KA 1L1OC 2P28A 1YIJ1 3IR7A 2OZKA 4BY1I 4BBRI 1Q7Y2 5D1PA 1VQ5Z 1QVGY 3MZLB 4NBGA 1KQSY 1TWFI 4MD7A 2AYDA 3BG0B 4MD9A 1FDOA 3F3PC 2JIPA 2M6NA 4A3DI 1VQ91 2B63I 2WB1A 3CCQZ 1YJN1 3CCEZ 4NBAA 3VB9A 1TWCI 3CCS1 2RIQA 1YUKA 4E30A 1VQ81 2KPIA 1YJWZ 4A3JI 2YADA 1ML8A 4NBDA 4MRIA 5A2Qb 3CCM1 2O4HA 2JNYA 4E33A 1S7MA 1VQMZ 2JIQA 2QA4Z 3IF8A 1VQL1 2NVQI 5T67A 3CC4Z 1Y1WI 3I56Z 3CD6Z 3H3VJ 2IV2X 2M48A 1SIWA 4HGYA 3G6EZ 2LIYA 5T64A 3JAMf 4A3MI 2NVYI 1YJ91 4A93I 4HGZA 1JJ2Z 1VQ41 1DL6A 2VUMI 1RLYA 2E2JI 2JA6I 3PO2I 1N8R1 4RV9A 4A3LI 2OTJ1 4AYBA 3OW2Z 2JR6A 5IP9I 3CME1 3GTLI 1TFIA 5FLXf 3S1QI 2VF1A 2EGTA 1JWHC 1USPB 2YU9I 4NB9A 3EEDA 3CC7Z 2QR1B 2K3RA 1JJ2Y 3U50C 1YHQZ 4RVFA 1Z01A 1VQO1 4HH4A 4NBBA 3I4NI 3P5JB 2R92I 4RS4A 2R93I
chains in the Genus database with same CATH topology
1X0TA 2Q51A 3MZKB 3OW2Y 4NOZA 3HOYI 3CC2Z 3EERA 4BBSI 1VQ61 2DE7A 1KC81 1WIIA 1Q812 5FLMI 1X3ZA 2E9HA 4A3BI 3J80f 3NFZA 3S1RI 3CCLZ 4E2XA 5CM2M 1YIJZ 3S16I 2R7ZI 3Q87A 3I551 4QTTA 2V8IA 4NBFA 1M1K1 2K5RA 1N2FA 4X6AI 4TNUA 1ZH1A 4E2ZA 5FLXb 1K9M1 3HKZA 3GTJI 2W04A 5C4JI 4S1TA 2JS4A 3CCR1 3TE5B 2NVTI 2F4MA 3M4OI 1VQK1 1RNIA 1LQLA 3S1MI 1Q861 3CCJZ 3GCFA 5D1OB 4RVDA 5C44I 5C4XI 1RO4A 2RHBA 3M3YI 1VQLZ 1KD12 3TDHB 3G711 4NBHA 1Q822 3J80b 1KC82 1WCMI 4E2YA 2QEX1 2PMZA 1X3WA 1YJ9Z 1K731 2JA8I 2GU2A 3VMIA 1VQ51 3HOZI 2RPRA 2V8KA 1YI2Z 3GTMS 1YUAA 2KI7B 1Y1VS 2GTIA 3CCUZ 5C3EI 5LL6f 4A3EI 2OTJZ 2R6MA 2W03A 4Y7NI 3CCE1 3ESWA 5IP7I 1RO2A 1QYPA 1VQPZ 3G4S1 1USPA 1K9M2 3GTKI 1VQOZ 3VMHA 1M901 2PK7A 2H85A 2AKLA 1YJW1 1VQ7Z 1PFTA 2HF1A 1K8A1 3GTPI 4DGLA 1W2BZ 1VQ6Z 3BG1B 3CPWZ 3GTOI 3PO3S 1VQM1 4E31A 3KIFA 1YITZ 2QA41 2QREB 3CMAZ 1Q7Y1 1S72Z 3G6E1 3F3FC 2RBLA 5IT9f 1W2BY 2J6AA 3T4NB 2JA5I 3CCVZ 4E2WA 3CPWY 3GTGI 1ZB9A 3I07A 3LUSA 4DQYB 3CQZI 1Z03A 1TWHI 2WAQA 4A3KI 3JAMb 4QTUA 4A3CI 3CCRZ 4MD8A 5AN9F 1VQ9Z 3GTQI 3CC71 5T6BA 1YHQ1 3S17I 4RVHA 2OOYB 1YJNZ 3CCSZ 2OTL1 1M902 4BXXI 2VUGA 4Y52I 1N8R2 4NBEA 3FQQA 4RVGA 3QWUA 2JA7I 1NJI1 4MONA 3CC21 1TWGI 1VQ8Z 3RZOI 3HOXI 1R9TI 3S15I 1P9NA 3CCL1 3D9XA 1ZB8A 3CCMZ 5IT9b 2QKDA 4BY7I 2Q4ZA 4NBCA 1TWAI 1WW9A 2F4OA 3S1NI 1KRLA 2OOXB 2GTHA 3D6WA 2E2II 2E2HI 3G4SZ 1VQ4Z 3J81f 1VLAA 2HU9A 1I3QI 2DE6A 2JMOA 1M1K2 3GTMI 3HOWI 3FQMA 1RO0A 2PM9A 3CMEZ 1Y1VI 3CCQ1 3CCJ1 1Q811 2RT9A 3FKII 4NB8A 4NFRA 1NJI2 2Y0SA 1VQNZ 3IX0A 3J7A4 1I6HI 4NH1C 1QF8A 1RQFA 1Q862 3S14I 1NP6A 2JUBA 3VMGA 3I4MI 4MH4A 1YI21 3NDJA 3CC41 3PO3I 3I561 2QLVB 3NH5A 4EWCA 3HOUI 3CD61 3K7AI 3CCU1 4DK1A 2LFUA 2O53A 2ZAEB 3I55Z 2P3YA 1K732 1K83I 2NVXI 3J81b 1VQP1 4MXUA 2OTLZ 2IZ4A 3NDIA 3HOVI 1SFOI 1I50I 3CXCZ 1VQ71 3H0GI 4A3FI 1QVFZ 3IFUA 2BJOA 1KD11 1Q821 4CL1A 3KIHA 2QRCB 1VQN1 1VQKZ 1NUIA 4E32A 3RZDI 1YIT1 3S2DI 4A3GI 2QRDB 3CMA1 5D1OA 3S2HI 3MONA 3CXCY 2IZ3A 3GKQA 4A3II 1S721 5A2Qf 3VTNA 1QVGZ 1K8A2 1QVFY 3NH4A 1KQSZ 4XX2A 3G71Z 2DE5A 2I3CA 2V8JA 3CCV1 3NH8A 2QEXZ 1Z02A 2G2KA 1L1OC 2P28A 1YIJ1 2OZKA 4BY1I 4BBRI 1Q7Y2 5D1PA 1VQ5Z 1QVGY 3MZLB 4NBGA 1KQSY 1TWFI 4MD7A 3BG0B 4MD9A 3F3PC 2M6NA 4A3DI 1VQ91 2B63I 2WB1A 3CCQZ 1YJN1 4NBAA 3VB9A 3CCEZ 1TWCI 3CCS1 2RIQA 1YUKA 4E30A 1VQ81 2KPIA 1YJWZ 4A3JI 2YADA 1ML8A 4NBDA 4MRIA 5A2Qb 3CCM1 2O4HA 2JNYA 4E33A 1S7MA 1VQMZ 2QA4Z 3IF8A 1VQL1 2NVQI 5T67A 3CC4Z 1Y1WI 3I56Z 3CD6Z 3H3VJ 2M48A 4HGYA 3G6EZ 2LIYA 5T64A 3JAMf 4A3MI 2NVYI 1YJ91 4A93I 4HGZA 1JJ2Z 1VQ41 1DL6A 2VUMI 1RLYA 2E2JI 2JA6I 3PO2I 1N8R1 4RV9A 4A3LI 2OTJ1 4AYBA 3OW2Z 2JR6A 5IP9I 3CME1 3GTLI 1TFIA 5FLXf 3S1QI 2VF1A 2EGTA 1JWHC 1USPB 2YU9I 4NB9A 3EEDA 3CC7Z 2QR1B 2K3RA 1JJ2Y 3U50C 1YHQZ 4RVFA 1Z01A 1VQO1 4HH4A 4NBBA 3I4NI 3P5JB 2R92I 4RS4A 2R93I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  3GTK I;  3D6W A;  2E2I I;  4NOZ A;  3VMH A;  2PK7 A;  3HOY I;  2E2H I;  3EER A;  2AKL A;  4BBS I;  2DE7 A;  1PFT A;  1VLA A;  1L1O C;  2HF1 A;  5FLM I;  1I3Q I;  1X3Z A;  2DE6 A;  3GTP I;  4A3B I;  3S1R I;  4BY1 I;  4BBR I;  3GTM I;  3HOW I;  4NBG A;  3GTO I;  5CM2 M;  1TWF I;  3S16 I;  1Y1V I;  3PO3 S;  2R7Z I;  4A3D I;  3Q87 A;  2B63 I;  4QTT A;  3FKI I;  4NB8 A;  4NBF A;  2K5R A;  1N2F A;  4NBA A;  3VB9 A;  1TWC I;  4X6A I;  2RBL A;  2J6A A;  2JA5 I;  1I6H I;  3GTG I;  1QYP A;  1ZB9 A;  3I07 A;  3LUS A;  3S14 I;  2KPI A;  4A3J I;  3VMG A;  3CQZ I;  3I4M I;  3GTJ I;  1TWH I;  5C4J I;  2JS4 A;  1ML8 A;  4NBD A;  4A3K I;  4MH4 A;  4QTU A;  2NVT I;  2F4M A;  3M4O I;  4A3C I;  3PO3 I;  2JNY A;  1LQL A;  3HOU I;  3S1M I;  3K7A I;  3GCF A;  5C44 I;  2NVQ I;  3GTQ I;  1Y1W I;  5C4X I;  1RO4 A;  2P3Y A;  3S17 I;  3H3V J;  1K83 I;  3M3Y I;  2NVX I;  4BXX I;  4A3M I;  4NBH A;  4Y52 I;  2NVY I;  4A93 I;  4NBE A;  1WCM I;  2JA7 I;  3HOV I;  1SFO I;  1I50 I;  1TWG I;  3RZO I;  1DL6 A;  1X3W A;  2VUM I;  3H0G I;  3HOX I;  4A3F I;  1RLY A;  1R9T I;  2E2J I;  2JA6 I;  2JA8 I;  3S15 I;  2BJO A;  3PO2 I;  3VMI A;  3HOZ I;  4A3L I;  1ZB8 A;  3GTM S;  2JR6 A;  5IP9 I;  3GTL I;  1NUI A;  1TFI A;  1YUA A;  1Y1V S;  3S1Q I;  3RZD I;  3S2D I;  5C3E I;  4A3G I;  4A3E I;  1USP B;  2YU9 I;  4NB9 A;  4NBC A;  4BY7 I;  3S2H I;  3U50 C;  3GKQ A;  4A3I I;  4Y7N I;  1TWA I;  3ESW A;  1WW9 A;  2F4O A;  3S1N I;  4NBB A;  3I4N I;  4XX2 A;  5IP7 I;  2R92 I;  2DE5 A;  2R93 I; 
#chains in the Genus database with same CATH topology
 1X0T A;  2Q51 A;  3MZK B;  3OW2 Y;  4NOZ A;  3HOY I;  3CC2 Z;  3EER A;  4BBS I;  1VQ6 1;  2DE7 A;  2VPW A;  1KC8 1;  1WII A;  1Q81 2;  5FLM I;  1X3Z A;  2E9H A;  4A3B I;  3J80 f;  3NFZ A;  3S1R I;  3CCL Z;  4E2X A;  5CM2 M;  1YIJ Z;  3S16 I;  2R7Z I;  3Q87 A;  3I55 1;  4QTT A;  2V8I A;  4NBF A;  1M1K 1;  2K5R A;  1N2F A;  4X6A I;  2JIM A;  1Y8C A;  1Q16 A;  4TNU A;  1ZH1 A;  4E2Z A;  5FLX b;  1K9M 1;  3HKZ A;  3GTJ I;  2W04 A;  5C4J I;  4S1T A;  2JS4 A;  3CCR 1;  3TE5 B;  2NVT I;  2F4M A;  3M4O I;  1VQK 1;  1RNI A;  1LQL A;  3S1M I;  1Q86 1;  3CCJ Z;  3GCF A;  5D1O B;  4RVD A;  5C44 I;  2V3V A;  2VPZ A;  5C4X I;  1RO4 A;  2RHB A;  3M3Y I;  1VQL Z;  1KD1 2;  3TDH B;  3G71 1;  4NBH A;  1Q82 2;  3J80 b;  1KC8 2;  1WCM I;  4E2Y A;  2QEX 1;  2PMZ A;  2JIR A;  1X3W A;  1YJ9 Z;  1K73 1;  2JA8 I;  2GU2 A;  3VMI A;  1VQ5 1;  3HOZ I;  2RPR A;  2V8K A;  2E7Z A;  1YI2 Z;  3GTM S;  1YUA A;  2KI7 B;  1Y1V S;  2GTI A;  3CCU Z;  5C3E I;  5LL6 f;  4A3E I;  2OTJ Z;  2R6M A;  2W03 A;  4Y7N I;  3CCE 1;  3ESW A;  5IP7 I;  1RO2 A;  1QYP A;  1VQP Z;  3G4S 1;  1USP A;  1K9M 2;  3GTK I;  2LEX A;  1VQO Z;  3VMH A;  1M90 1;  2PK7 A;  2H85 A;  2AKL A;  1YJW 1;  1VQ7 Z;  1PFT A;  2HF1 A;  1K8A 1;  3GTP I;  4DGL A;  1W2B Z;  1VQ6 Z;  3BG1 B;  3CPW Z;  3GTO I;  1WJ2 A;  3PO3 S;  1VQM 1;  4E31 A;  3KIF A;  1YIT Z;  2QA4 1;  2QRE B;  3CMA Z;  2VPY A;  1Q7Y 1;  1S72 Z;  3G6E 1;  1FDI A;  3F3F C;  2RBL A;  5IT9 f;  1W2B Y;  2J6A A;  3T4N B;  2JA5 I;  3CCV Z;  4E2W A;  3CPW Y;  3GTG I;  1ZB9 A;  3I07 A;  3LUS A;  4DQY B;  3CQZ I;  1Z03 A;  1TWH I;  2VPX A;  1AA6 A;  2WAQ A;  4A3K I;  3JAM b;  4QTU A;  4A3C I;  2NAP A;  3CCR Z;  4MD8 A;  5AN9 F;  3D2L A;  1VQ9 Z;  3GTQ I;  3CC7 1;  5T6B A;  1YHQ 1;  3S17 I;  4RVH A;  2OOY B;  1YJN Z;  3CCS Z;  2OTL 1;  1M90 2;  4BXX I;  2VUG A;  4Y52 I;  1N8R 2;  4NBE A;  3FQQ A;  4RVG A;  3QWU A;  2JA7 I;  1NJI 1;  4MON A;  3CC2 1;  1TWG I;  1VQ8 Z;  3RZO I;  3HOX I;  1R9T I;  3S15 I;  1P9N A;  3CCL 1;  3D9X A;  1ZB8 A;  3CCM Z;  5IT9 b;  2QKD A;  2V45 A;  4BY7 I;  2Q4Z A;  4NBC A;  1TWA I;  1WW9 A;  2F4O A;  3S1N I;  1KRL A;  2OOX B;  2GTH A;  3D6W A;  2E2I I;  2E2H I;  3G4S Z;  1VQ4 Z;  3J81 f;  1VLA A;  2HU9 A;  1I3Q I;  2DE6 A;  2JMO A;  1M1K 2;  3GTM I;  3HOW I;  3FQM A;  1RO0 A;  2PM9 A;  3CME Z;  1Y1V I;  3CCQ 1;  3CCJ 1;  1Q81 1;  2RT9 A;  3FKI I;  4NB8 A;  4NFR A;  1NJI 2;  2Y0S A;  1VQN Z;  3IX0 A;  3J7A 4;  1I6H I;  4NH1 C;  1QF8 A;  2JIO A;  1RQF A;  1Q86 2;  3S14 I;  1NP6 A;  2JUB A;  3VMG A;  3I4M I;  4MH4 A;  1YI2 1;  3NDJ A;  3CC4 1;  3PO3 I;  3I56 1;  2QLV B;  3NH5 A;  4EWC A;  3HOU I;  3CD6 1;  3K7A I;  3CCU 1;  4DK1 A;  2LFU A;  2O53 A;  2ZAE B;  3I55 Z;  2P3Y A;  1K73 2;  1K83 I;  2NVX I;  3J81 b;  1VQP 1;  4MXU A;  2OTL Z;  2IZ4 A;  3NDI A;  3HOV I;  1SFO I;  1I50 I;  3CXC Z;  1VQ7 1;  3H0G I;  4A3F I;  1QVF Z;  3IFU A;  2BJO A;  1KD1 1;  1Q82 1;  4CL1 A;  3KIH A;  2QRC B;  1VQN 1;  1VQK Z;  1NUI A;  1QXF A;  4E32 A;  3RZD I;  1YIT 1;  3S2D I;  4A3G I;  2QRD B;  3CMA 1;  5D1O A;  3S2H I;  3MON A;  3CXC Y;  2IZ3 A;  3GKQ A;  4A3I I;  1S72 1;  5A2Q f;  3VTN A;  1QVG Z;  1K8A 2;  1QVF Y;  3NH4 A;  1KQS Z;  4XX2 A;  3G71 Z;  2DE5 A;  2I3C A;  2V8J A;  3CCV 1;  3NH8 A;  2QEX Z;  1Z02 A;  1WZN A;  2G2K A;  1L1O C;  2P28 A;  1YIJ 1;  3IR7 A;  2OZK A;  4BY1 I;  4BBR I;  1Q7Y 2;  5D1P A;  1VQ5 Z;  1QVG Y;  3MZL B;  4NBG A;  1KQS Y;  1TWF I;  4MD7 A;  2AYD A;  3BG0 B;  4MD9 A;  1FDO A;  3F3P C;  2JIP A;  2M6N A;  4A3D I;  1VQ9 1;  2B63 I;  2WB1 A;  3CCQ Z;  1YJN 1;  3CCE Z;  4NBA A;  3VB9 A;  1TWC I;  3CCS 1;  2RIQ A;  1YUK A;  4E30 A;  1VQ8 1;  2KPI A;  1YJW Z;  4A3J I;  2YAD A;  1ML8 A;  4NBD A;  4MRI A;  5A2Q b;  3CCM 1;  2O4H A;  2JNY A;  4E33 A;  1S7M A;  1VQM Z;  2JIQ A;  2QA4 Z;  3IF8 A;  1VQL 1;  2NVQ I;  5T67 A;  3CC4 Z;  1Y1W I;  3I56 Z;  3CD6 Z;  3H3V J;  2IV2 X;  2M48 A;  1SIW A;  4HGY A;  3G6E Z;  2LIY A;  5T64 A;  3JAM f;  4A3M I;  2NVY I;  1YJ9 1;  4A93 I;  4HGZ A;  1JJ2 Z;  1VQ4 1;  1DL6 A;  2VUM I;  1RLY A;  2E2J I;  2JA6 I;  3PO2 I;  1N8R 1;  4RV9 A;  4A3L I;  2OTJ 1;  4AYB A;  3OW2 Z;  2JR6 A;  5IP9 I;  3CME 1;  3GTL I;  1TFI A;  5FLX f;  3S1Q I;  2VF1 A;  2EGT A;  1JWH C;  1USP B;  2YU9 I;  4NB9 A;  3EED A;  3CC7 Z;  2QR1 B;  2K3R A;  1JJ2 Y;  3U50 C;  1YHQ Z;  4RVF A;  1Z01 A;  1VQO 1;  4HH4 A;  4NBB A;  3I4N I;  3P5J B;  2R92 I;  4RS4 A;  2R93 I; 
#chains in the Genus database with same CATH homology
 1X0T A;  2Q51 A;  3MZK B;  3OW2 Y;  4NOZ A;  3HOY I;  3CC2 Z;  3EER A;  4BBS I;  1VQ6 1;  2DE7 A;  1KC8 1;  1WII A;  1Q81 2;  5FLM I;  1X3Z A;  2E9H A;  4A3B I;  3J80 f;  3NFZ A;  3S1R I;  3CCL Z;  4E2X A;  5CM2 M;  1YIJ Z;  3S16 I;  2R7Z I;  3Q87 A;  3I55 1;  4QTT A;  2V8I A;  4NBF A;  1M1K 1;  2K5R A;  1N2F A;  4X6A I;  4TNU A;  1ZH1 A;  4E2Z A;  5FLX b;  1K9M 1;  3HKZ A;  3GTJ I;  2W04 A;  5C4J I;  4S1T A;  2JS4 A;  3CCR 1;  3TE5 B;  2NVT I;  2F4M A;  3M4O I;  1VQK 1;  1RNI A;  1LQL A;  3S1M I;  1Q86 1;  3CCJ Z;  3GCF A;  5D1O B;  4RVD A;  5C44 I;  5C4X I;  1RO4 A;  2RHB A;  3M3Y I;  1VQL Z;  1KD1 2;  3TDH B;  3G71 1;  4NBH A;  1Q82 2;  3J80 b;  1KC8 2;  1WCM I;  4E2Y A;  2QEX 1;  2PMZ A;  1X3W A;  1YJ9 Z;  1K73 1;  2JA8 I;  2GU2 A;  3VMI A;  1VQ5 1;  3HOZ I;  2RPR A;  2V8K A;  1YI2 Z;  3GTM S;  1YUA A;  2KI7 B;  1Y1V S;  2GTI A;  3CCU Z;  5C3E I;  5LL6 f;  4A3E I;  2OTJ Z;  2R6M A;  2W03 A;  4Y7N I;  3CCE 1;  3ESW A;  5IP7 I;  1RO2 A;  1QYP A;  1VQP Z;  3G4S 1;  1USP A;  1K9M 2;  3GTK I;  1VQO Z;  3VMH A;  1M90 1;  2PK7 A;  2H85 A;  2AKL A;  1YJW 1;  1VQ7 Z;  1PFT A;  2HF1 A;  1K8A 1;  3GTP I;  4DGL A;  1W2B Z;  1VQ6 Z;  3BG1 B;  3CPW Z;  3GTO I;  3PO3 S;  1VQM 1;  4E31 A;  3KIF A;  1YIT Z;  2QA4 1;  2QRE B;  3CMA Z;  1Q7Y 1;  1S72 Z;  3G6E 1;  3F3F C;  2RBL A;  5IT9 f;  1W2B Y;  2J6A A;  3T4N B;  2JA5 I;  3CCV Z;  4E2W A;  3CPW Y;  3GTG I;  1ZB9 A;  3I07 A;  3LUS A;  4DQY B;  3CQZ I;  1Z03 A;  1TWH I;  2WAQ A;  4A3K I;  3JAM b;  4QTU A;  4A3C I;  3CCR Z;  4MD8 A;  5AN9 F;  1VQ9 Z;  3GTQ I;  3CC7 1;  5T6B A;  1YHQ 1;  3S17 I;  4RVH A;  2OOY B;  1YJN Z;  3CCS Z;  2OTL 1;  1M90 2;  4BXX I;  2VUG A;  4Y52 I;  1N8R 2;  4NBE A;  3FQQ A;  4RVG A;  3QWU A;  2JA7 I;  1NJI 1;  4MON A;  3CC2 1;  1TWG I;  1VQ8 Z;  3RZO I;  3HOX I;  1R9T I;  3S15 I;  1P9N A;  3CCL 1;  3D9X A;  1ZB8 A;  3CCM Z;  5IT9 b;  2QKD A;  4BY7 I;  2Q4Z A;  4NBC A;  1TWA I;  1WW9 A;  2F4O A;  3S1N I;  1KRL A;  2OOX B;  2GTH A;  3D6W A;  2E2I I;  2E2H I;  3G4S Z;  1VQ4 Z;  3J81 f;  1VLA A;  2HU9 A;  1I3Q I;  2DE6 A;  2JMO A;  1M1K 2;  3GTM I;  3HOW I;  3FQM A;  1RO0 A;  2PM9 A;  3CME Z;  1Y1V I;  3CCQ 1;  3CCJ 1;  1Q81 1;  2RT9 A;  3FKI I;  4NB8 A;  4NFR A;  1NJI 2;  2Y0S A;  1VQN Z;  3IX0 A;  3J7A 4;  1I6H I;  4NH1 C;  1QF8 A;  1RQF A;  1Q86 2;  3S14 I;  1NP6 A;  2JUB A;  3VMG A;  3I4M I;  4MH4 A;  1YI2 1;  3NDJ A;  3CC4 1;  3PO3 I;  3I56 1;  2QLV B;  3NH5 A;  4EWC A;  3HOU I;  3CD6 1;  3K7A I;  3CCU 1;  4DK1 A;  2LFU A;  2O53 A;  2ZAE B;  3I55 Z;  2P3Y A;  1K73 2;  1K83 I;  2NVX I;  3J81 b;  1VQP 1;  4MXU A;  2OTL Z;  2IZ4 A;  3NDI A;  3HOV I;  1SFO I;  1I50 I;  3CXC Z;  1VQ7 1;  3H0G I;  4A3F I;  1QVF Z;  3IFU A;  2BJO A;  1KD1 1;  1Q82 1;  4CL1 A;  3KIH A;  2QRC B;  1VQN 1;  1VQK Z;  1NUI A;  4E32 A;  3RZD I;  1YIT 1;  3S2D I;  4A3G I;  2QRD B;  3CMA 1;  5D1O A;  3S2H I;  3MON A;  3CXC Y;  2IZ3 A;  3GKQ A;  4A3I I;  1S72 1;  5A2Q f;  3VTN A;  1QVG Z;  1K8A 2;  1QVF Y;  3NH4 A;  1KQS Z;  4XX2 A;  3G71 Z;  2DE5 A;  2I3C A;  2V8J A;  3CCV 1;  3NH8 A;  2QEX Z;  1Z02 A;  2G2K A;  1L1O C;  2P28 A;  1YIJ 1;  2OZK A;  4BY1 I;  4BBR I;  1Q7Y 2;  5D1P A;  1VQ5 Z;  1QVG Y;  3MZL B;  4NBG A;  1KQS Y;  1TWF I;  4MD7 A;  3BG0 B;  4MD9 A;  3F3P C;  2M6N A;  4A3D I;  1VQ9 1;  2B63 I;  2WB1 A;  3CCQ Z;  1YJN 1;  4NBA A;  3VB9 A;  3CCE Z;  1TWC I;  3CCS 1;  2RIQ A;  1YUK A;  4E30 A;  1VQ8 1;  2KPI A;  1YJW Z;  4A3J I;  2YAD A;  1ML8 A;  4NBD A;  4MRI A;  5A2Q b;  3CCM 1;  2O4H A;  2JNY A;  4E33 A;  1S7M A;  1VQM Z;  2QA4 Z;  3IF8 A;  1VQL 1;  2NVQ I;  5T67 A;  3CC4 Z;  1Y1W I;  3I56 Z;  3CD6 Z;  3H3V J;  2M48 A;  4HGY A;  3G6E Z;  2LIY A;  5T64 A;  3JAM f;  4A3M I;  2NVY I;  1YJ9 1;  4A93 I;  4HGZ A;  1JJ2 Z;  1VQ4 1;  1DL6 A;  2VUM I;  1RLY A;  2E2J I;  2JA6 I;  3PO2 I;  1N8R 1;  4RV9 A;  4A3L I;  2OTJ 1;  4AYB A;  3OW2 Z;  2JR6 A;  5IP9 I;  3CME 1;  3GTL I;  1TFI A;  5FLX f;  3S1Q I;  2VF1 A;  2EGT A;  1JWH C;  1USP B;  2YU9 I;  4NB9 A;  3EED A;  3CC7 Z;  2QR1 B;  2K3R A;  1JJ2 Y;  3U50 C;  1YHQ Z;  4RVF A;  1Z01 A;  1VQO 1;  4HH4 A;  4NBB A;  3I4N I;  3P5J B;  2R92 I;  4RS4 A;  2R93 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...