4A3EI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI02
1TWAI 1X3ZA 4NB8A 3HOZI 1YUAA 3H0GI 4Y52I 2BJOA 1USPA 5C44I 4MH4A 1ML8A 1R9TI 3HOWI 4A93I 3LUSA 4A3EI 4BY1I 1WW9A 4BY7I 3GTMS 2R92I 3S15I 5IP9I 2F4OA 2K5RA 3S17I 1I6HI 3I07A 4A3DI 5C3EI 4NBHA 4X6AI 4NBBA 1RLYA 3S16I 3FKII 4XX2A 3HOUI 2PK7A 2JNYA 2F4MA 1LQLA 2VUMI 2E2JI 1TWGI 2DE6A 3VMIA 3S2DI 4A3JI 2P3YA 2YU9I 1QYPA 3GTMI 3VMHA 3HOXI 3GTKI 2J6AA 2KPIA 3K7AI 4BBRI 3ESWA 2JR6A 3GTLI 4QTUA 4NBDA 1PFTA 3S1NI 3S1RI 1N2FA 1Y1VS 4NBAA 1ZB8A 3I4NI 3VB9A 3GTJI 3GTOI 3EERA 5FLMI 1I50I 4NOZA 2JA6I 3GTQI 3RZDI 2JA7I 3D6WA 1X3WA 1WCMI 1K83I 1Y1WI 3RZOI 4A3LI 1RO4A 1NUIA 3S2HI 3HOYI 2NVXI 4BXXI 4QTTA 4Y7NI 2JS4A 1SFOI 3GKQA 4A3FI 5IP7I 1DL6A 2AKLA 5C4JI 3Q87A 3VMGA 5CM2M 4A3BI 2JA5I 3M4OI 3M3YI 2E2II 3S1MI 3CQZI 1TWHI 4NB9A 2R7ZI 1VLAA 1TWFI 4NBGA 4NBFA 2DE7A 2E2HI 5C4XI 1USPB 3HOVI 4A3II 3PO3S 1L1OC 3GTPI 4A3MI 3GCFA 1TFIA 4NBCA 2DE5A 4BBSI 3H3VJ 4A3CI 4A3KI 3GTGI 2JA8I 4NBEA 1Y1VI 4A3GI 2HF1A 2B63I 1TWCI 2R93I 2NVQI 2NVYI 3I4MI 2NVTI 3U50C 3PO3I 3PO2I 3S1QI 1I3QI 1ZB9A 3S14I 2RBLA
chains in the Genus database with same CATH superfamily
3CC71 5FLXb 3H0GI 1M901 1VQ81 2JIRA 1ML8A 1VQMZ 4A3EI 4BY7I 3GTMS 2LIYA 1VQ61 2YADA 1YIJZ 1KD12 1YIT1 3S17I 1KC82 1K732 5C3EI 4A3DI 2O4HA 4NBBA 4XX2A 3P5JB 2E2JI 3VMIA 3CCS1 3QWUA 5D1PA 3VMHA 3HOXI 4RS4A 2KPIA 1VQKZ 3CCM1 4NBDA 3S1RI 4E2ZA 1YJW1 2JIQA 3CXCZ 3GTJI 1I50I 4MD7A 5A2Qf 3F3PC 1QVFZ 4E30A 2Y0SA 2VUGA 2P28A 2OTJZ 2IZ4A 1KRLA 1Q811 3BG1B 4Y7NI 2EGTA 3CCEZ 2E7ZA 1DL6A 3CCJZ 4EWCA 5CM2M 4A3BI 2JIMA 2V8JA 3CCRZ 1TWHI 1QXFA 1TWFI 4NBGA 4NBFA 3CCU1 5AN9F 3HOVI 1L1OC 1VQL1 3GCFA 4RVFA 4BBSI 4A3KI 2JA8I 1VQ9Z 3KIHA 2QR1B 2HF1A 2V8KA 2V3VA 1Q822 2NVQI 2NVYI 3CC4Z 1RNIA 1FDIA 3PO3I 3CMAZ 3S1QI 3G71Z 2JUBA 1ZB9A 3G4S1 2M48A 3I55Z 1Z02A 3CCLZ 4NB8A 3HOZI 2BJOA 1USPA 1Q821 5C44I 4MH4A 2QEXZ 5IT9f 1R9TI 1RO0A 1Y8CA 4A93I 1NJI2 4BY1I 2R92I 3TDHB 5IP9I 3G711 3S15I 2F4OA 2K5RA 2QKDA 2QREB 2I3CA 3I551 3HOUI 1W2BZ 2JNYA 2RPRA 3IFUA 3I561 3EEDA 2VUMI 2DE6A 1WZNA 1NJI1 3J81f 3GTKI 1KQSZ 4BBRI 1S7MA 1S72Z 3NDIA 3GTLI 1AA6A 1M1K2 2V8IA 1PFTA 1YJNZ 1N2FA 4HH4A 1VQ41 3GTOI 2WAQA 5FLMI 3GTQI 2Q51A 2JA7I 1QVGZ 1VQM1 4A3LI 3RZOI 3S2HI 3HOYI 2NVXI 4QTTA 5D1OB 1SFOI 1YIJ1 1KD11 1KC81 3G6EZ 3OW2Z 2QA4Z 2OTLZ 2AYDA 3Q87A 3VMGA 1K731 3M3YI 4NB9A 2R7ZI 2V45A 1VLAA 2DE7A 1USPB 2GU2A 1VQPZ 1X0TA 2E9HA 2VPWA 2OOXB 5LL6f 5T67A 1VQK1 4E33A 1YI2Z 2B63I 2NAPA 4NFRA 1K8A2 1I3QI 4AYBA 1N8R2 2RBLA 4MRIA 2OTJ1 3CCVZ 2VPYA 1VQNZ 2QLVB 3CC2Z 3JAMf 3FQQA 3CCE1 3HOWI 3LUSA 1Z03A 2JIPA 3CCJ1 1JJ2Y 1QF8A 4RVDA 3CCR1 3T4NB 2QRDB 3CMEZ 3I07A 1N8R1 1K9M2 4X6AI 4S1TA 1RLYA 3IR7A 5D1OA 2W04A 3CPWY 1JWHC 1VQN1 2HU9A 2IV2X 3GTMI 2OOYB 1VQ91 5A2Qb 2ZAEB 3NDJA 1VQ5Z 3ESWA 3CC41 3KIFA 1NP6A 4QTUA 3CCQZ 1YHQZ 1Q7Y2 3CMA1 4MXUA 3S1NI 3NH8A 1W2BY 2PMZA 4NBAA 3I4NI 5T64A 3EERA 3CD6Z 3MZKB 2RIQA 3CCL1 4E2WA 4NOZA 1YUKA 3RZDI 3MZLB 1X3WA 2QEX1 3CC7Z 3VTNA 1NUIA 4BXXI 3JAMb 3FQMA 1M902 1WIIA 2LEXA 1VQ8Z 4A3FI 3F3FC 2AKLA 4MD8A 2JA5I 2VPXA 3CD61 2M6NA 2E2II 1VQ6Z 2PM9A 2GTHA 1YITZ 2E2HI 5C4XI 4DQYB 1SIWA 4A3II 3PO3S 3GTPI 1ZH1A 2JIOA 1TFIA 1S721 2DE5A 4E31A 3CCSZ 1M1K1 3OW2Y 4A3CI 4E32A 2R6MA 4NBEA 1YJN1 3IX0A 2K3RA 1Y1VI 1TWCI 2R93I 5IT9b 4MD9A 3CXCY 4RVGA 2NVTI 1FDOA 3U50C 3CCMZ 2JMOA 4DK1A 3PO2I 1YJWZ 2H85A 1QVFY 1WJ2A 3S14I 1TWAI 1X3ZA 2VPZA 2WB1A 2VF1A 1YUAA 4Y52I 4E2XA 3G6E1 1VQ7Z 2OTL1 2QA41 4CL1A 1WW9A 3J81b 1Q812 3J7A4 3NH4A 2GTIA 3NFZA 2RT9A 3MONA 1I6HI 3IF8A 4NBHA 3S16I 3FKII 1VQP1 2PK7A 1YJ9Z 2F4MA 1LQLA 3CCUZ 1TWGI 2Q4ZA 3S2DI 4A3JI 2P3YA 2YU9I 1QYPA 1VQ71 4HGYA 1VQLZ 2J6AA 4MONA 1YI21 3K7AI 2O53A 2JR6A 2OZKA 1K8A1 1Q16A 3J80f 1YJ91 1Y1VS 1ZB8A 3VB9A 4HGZA 3CCV1 2QRCB 2JA6I 5FLXf 3CC21 3G4SZ 3D6WA 1WCMI 2KI7B 1RQFA 1P9NA 1K83I 3NH5A 1Y1WI 1RO4A 2JS4A 1VQOZ 3GKQA 3TE5B 5IP7I 1Z01A 3CME1 5C4JI 2W03A 1K9M1 3M4OI 1Q862 1JJ2Z 3BG0B 3CQZI 3S1MI 1RO2A 2LFUA 4DGLA 3D9XA 4A3MI 4RVHA 1KQSY 3CPWZ 3HKZA 3I56Z 1VQ51 1VQO1 4NBCA 3H3VJ 3CCQ1 3GTGI 1YHQ1 1Q7Y1 4TNUA 1Q861 4A3GI 3I4MI 4E2YA 2RHBA 5T6BA 3D2LA 2IZ3A 3J80b 4NH1C 1VQ4Z 4RV9A 1QVGY 2G2KA
chains in the Genus database with same CATH topology
3CC71 5FLXb 3H0GI 1M901 1VQ81 1ML8A 1VQMZ 4A3EI 4BY7I 3GTMS 2LIYA 1VQ61 2YADA 1YIJZ 1KD12 1YIT1 3S17I 1KC82 1K732 5C3EI 4A3DI 2O4HA 4NBBA 4XX2A 3P5JB 2E2JI 3VMIA 3CCS1 3QWUA 5D1PA 3VMHA 3HOXI 4RS4A 2KPIA 1VQKZ 3CCM1 4NBDA 3S1RI 4E2ZA 1YJW1 3CXCZ 3GTJI 1I50I 4MD7A 5A2Qf 3F3PC 1QVFZ 4E30A 2Y0SA 2VUGA 2P28A 2OTJZ 2IZ4A 1KRLA 1Q811 3BG1B 4Y7NI 2EGTA 3CCEZ 1DL6A 3CCJZ 4EWCA 5CM2M 4A3BI 2V8JA 3CCRZ 1TWHI 1TWFI 4NBGA 4NBFA 3CCU1 5AN9F 3HOVI 1L1OC 1VQL1 3GCFA 4RVFA 4BBSI 4A3KI 2JA8I 1VQ9Z 3KIHA 2QR1B 2HF1A 2V8KA 1Q822 2NVQI 2NVYI 3CC4Z 1RNIA 3PO3I 3CMAZ 3S1QI 3G71Z 2JUBA 1ZB9A 3G4S1 2M48A 3I55Z 1Z02A 3CCLZ 4NB8A 3HOZI 2BJOA 1USPA 1Q821 5C44I 4MH4A 2QEXZ 5IT9f 1R9TI 1RO0A 4A93I 1NJI2 4BY1I 2R92I 3TDHB 5IP9I 3G711 3S15I 2F4OA 2K5RA 2QKDA 2QREB 2I3CA 3I551 3HOUI 1W2BZ 2JNYA 2RPRA 3IFUA 3I561 3EEDA 2VUMI 2DE6A 1NJI1 3J81f 3GTKI 1KQSZ 4BBRI 1S7MA 1S72Z 3NDIA 3GTLI 1M1K2 2V8IA 1PFTA 1YJNZ 1N2FA 4HH4A 1VQ41 3GTOI 2WAQA 5FLMI 3GTQI 2Q51A 2JA7I 1QVGZ 1VQM1 4A3LI 3RZOI 3S2HI 3HOYI 2NVXI 4QTTA 5D1OB 1SFOI 1YIJ1 1KD11 1KC81 3G6EZ 3OW2Z 2QA4Z 2OTLZ 3Q87A 3VMGA 1K731 3M3YI 4NB9A 2R7ZI 1VLAA 2DE7A 1USPB 2GU2A 1VQPZ 1X0TA 2E9HA 2OOXB 5LL6f 5T67A 1VQK1 4E33A 1YI2Z 2B63I 4NFRA 1K8A2 1I3QI 4AYBA 1N8R2 2RBLA 4MRIA 2OTJ1 3CCVZ 1VQNZ 2QLVB 3CC2Z 3JAMf 3FQQA 3CCE1 3HOWI 3LUSA 1Z03A 3CCJ1 1JJ2Y 1QF8A 4RVDA 3CCR1 3T4NB 2QRDB 3CMEZ 3I07A 1N8R1 1K9M2 4X6AI 4S1TA 1RLYA 5D1OA 2W04A 3CPWY 1JWHC 1VQN1 2HU9A 3GTMI 2OOYB 1VQ91 5A2Qb 2ZAEB 3NDJA 1VQ5Z 3ESWA 3CC41 3KIFA 1NP6A 4QTUA 3CCQZ 1YHQZ 1Q7Y2 3CMA1 4MXUA 3S1NI 3NH8A 1W2BY 2PMZA 4NBAA 3I4NI 5T64A 3EERA 3CD6Z 3MZKB 2RIQA 3CCL1 4E2WA 4NOZA 1YUKA 3RZDI 3MZLB 1X3WA 2QEX1 3CC7Z 3VTNA 1NUIA 4BXXI 3JAMb 3FQMA 1M902 1WIIA 1VQ8Z 4A3FI 3F3FC 2AKLA 4MD8A 2JA5I 3CD61 2M6NA 2E2II 1VQ6Z 2PM9A 2GTHA 1YITZ 2E2HI 5C4XI 4DQYB 4A3II 3PO3S 3GTPI 1ZH1A 1TFIA 1S721 2DE5A 4E31A 3CCSZ 1M1K1 3OW2Y 4A3CI 4E32A 2R6MA 4NBEA 1YJN1 3IX0A 2K3RA 1Y1VI 1TWCI 2R93I 5IT9b 4MD9A 3CXCY 4RVGA 2NVTI 3U50C 3CCMZ 2JMOA 4DK1A 3PO2I 1YJWZ 2H85A 1QVFY 3S14I 1TWAI 1X3ZA 2WB1A 2VF1A 1YUAA 4Y52I 4E2XA 3G6E1 1VQ7Z 2OTL1 2QA41 4CL1A 1WW9A 3J81b 1Q812 3J7A4 3NH4A 2GTIA 3NFZA 2RT9A 3MONA 1I6HI 3IF8A 4NBHA 3S16I 3FKII 1VQP1 2PK7A 1YJ9Z 2F4MA 1LQLA 3CCUZ 1TWGI 2Q4ZA 3S2DI 4A3JI 2P3YA 2YU9I 1QYPA 1VQ71 4HGYA 1VQLZ 2J6AA 4MONA 1YI21 3K7AI 2O53A 2JR6A 2OZKA 1K8A1 3J80f 1YJ91 1Y1VS 1ZB8A 3VB9A 4HGZA 3CCV1 2QRCB 2JA6I 5FLXf 3CC21 3G4SZ 3D6WA 1WCMI 2KI7B 1RQFA 1P9NA 1K83I 3NH5A 1Y1WI 1RO4A 2JS4A 1VQOZ 3GKQA 3TE5B 5IP7I 1Z01A 3CME1 5C4JI 2W03A 1K9M1 3M4OI 1Q862 1JJ2Z 3BG0B 3CQZI 3S1MI 1RO2A 2LFUA 4DGLA 3D9XA 4A3MI 4RVHA 1KQSY 3CPWZ 3HKZA 3I56Z 1VQ51 1VQO1 4NBCA 3H3VJ 3CCQ1 3GTGI 1YHQ1 1Q7Y1 4TNUA 1Q861 4A3GI 3I4MI 4E2YA 2RHBA 5T6BA 2IZ3A 3J80b 4NH1C 1VQ4Z 4RV9A 1QVGY 2G2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  1X3Z A;  4NB8 A;  3HOZ I;  1YUA A;  3H0G I;  4Y52 I;  2BJO A;  1USP A;  5C44 I;  4MH4 A;  1ML8 A;  1R9T I;  3HOW I;  4A93 I;  3LUS A;  4A3E I;  4BY1 I;  1WW9 A;  4BY7 I;  3GTM S;  2R92 I;  3S15 I;  5IP9 I;  2F4O A;  2K5R A;  3S17 I;  1I6H I;  3I07 A;  4A3D I;  5C3E I;  4NBH A;  4X6A I;  4NBB A;  1RLY A;  3S16 I;  3FKI I;  4XX2 A;  3HOU I;  2PK7 A;  2JNY A;  2F4M A;  1LQL A;  2VUM I;  2E2J I;  1TWG I;  2DE6 A;  3VMI A;  3S2D I;  4A3J I;  2P3Y A;  2YU9 I;  1QYP A;  3GTM I;  3VMH A;  3HOX I;  3GTK I;  2J6A A;  2KPI A;  3K7A I;  4BBR I;  3ESW A;  2JR6 A;  3GTL I;  4QTU A;  4NBD A;  1PFT A;  3S1N I;  3S1R I;  1N2F A;  1Y1V S;  4NBA A;  1ZB8 A;  3I4N I;  3VB9 A;  3GTJ I;  3GTO I;  3EER A;  5FLM I;  1I50 I;  4NOZ A;  2JA6 I;  3GTQ I;  3RZD I;  2JA7 I;  3D6W A;  1X3W A;  1WCM I;  1K83 I;  1Y1W I;  3RZO I;  4A3L I;  1RO4 A;  1NUI A;  3S2H I;  3HOY I;  2NVX I;  4BXX I;  4QTT A;  4Y7N I;  2JS4 A;  1SFO I;  3GKQ A;  4A3F I;  5IP7 I;  1DL6 A;  2AKL A;  5C4J I;  3Q87 A;  3VMG A;  5CM2 M;  4A3B I;  2JA5 I;  3M4O I;  3M3Y I;  2E2I I;  3S1M I;  3CQZ I;  1TWH I;  4NB9 A;  2R7Z I;  1VLA A;  1TWF I;  4NBG A;  4NBF A;  2DE7 A;  2E2H I;  5C4X I;  1USP B;  3HOV I;  4A3I I;  3PO3 S;  1L1O C;  3GTP I;  4A3M I;  3GCF A;  1TFI A;  4NBC A;  2DE5 A;  4BBS I;  3H3V J;  4A3C I;  4A3K I;  3GTG I;  2JA8 I;  4NBE A;  1Y1V I;  4A3G I;  2HF1 A;  2B63 I;  1TWC I;  2R93 I;  2NVQ I;  2NVY I;  3I4M I;  2NVT I;  3U50 C;  3PO3 I;  3PO2 I;  3S1Q I;  1I3Q I;  1ZB9 A;  3S14 I;  2RBL A; 
#chains in the Genus database with same CATH topology
 3CC7 1;  5FLX b;  3H0G I;  1M90 1;  1VQ8 1;  2JIR A;  1ML8 A;  1VQM Z;  4A3E I;  4BY7 I;  3GTM S;  2LIY A;  1VQ6 1;  2YAD A;  1YIJ Z;  1KD1 2;  1YIT 1;  3S17 I;  1KC8 2;  1K73 2;  5C3E I;  4A3D I;  2O4H A;  4NBB A;  4XX2 A;  3P5J B;  2E2J I;  3VMI A;  3CCS 1;  3QWU A;  5D1P A;  3VMH A;  3HOX I;  4RS4 A;  2KPI A;  1VQK Z;  3CCM 1;  4NBD A;  3S1R I;  4E2Z A;  1YJW 1;  2JIQ A;  3CXC Z;  3GTJ I;  1I50 I;  4MD7 A;  5A2Q f;  3F3P C;  1QVF Z;  4E30 A;  2Y0S A;  2VUG A;  2P28 A;  2OTJ Z;  2IZ4 A;  1KRL A;  1Q81 1;  3BG1 B;  4Y7N I;  2EGT A;  3CCE Z;  2E7Z A;  1DL6 A;  3CCJ Z;  4EWC A;  5CM2 M;  4A3B I;  2JIM A;  2V8J A;  3CCR Z;  1TWH I;  1QXF A;  1TWF I;  4NBG A;  4NBF A;  3CCU 1;  5AN9 F;  3HOV I;  1L1O C;  1VQL 1;  3GCF A;  4RVF A;  4BBS I;  4A3K I;  2JA8 I;  1VQ9 Z;  3KIH A;  2QR1 B;  2HF1 A;  2V8K A;  2V3V A;  1Q82 2;  2NVQ I;  2NVY I;  3CC4 Z;  1RNI A;  1FDI A;  3PO3 I;  3CMA Z;  3S1Q I;  3G71 Z;  2JUB A;  1ZB9 A;  3G4S 1;  2M48 A;  3I55 Z;  1Z02 A;  3CCL Z;  4NB8 A;  3HOZ I;  2BJO A;  1USP A;  1Q82 1;  5C44 I;  4MH4 A;  2QEX Z;  5IT9 f;  1R9T I;  1RO0 A;  1Y8C A;  4A93 I;  1NJI 2;  4BY1 I;  2R92 I;  3TDH B;  5IP9 I;  3G71 1;  3S15 I;  2F4O A;  2K5R A;  2QKD A;  2QRE B;  2I3C A;  3I55 1;  3HOU I;  1W2B Z;  2JNY A;  2RPR A;  3IFU A;  3I56 1;  3EED A;  2VUM I;  2DE6 A;  1WZN A;  1NJI 1;  3J81 f;  3GTK I;  1KQS Z;  4BBR I;  1S7M A;  1S72 Z;  3NDI A;  3GTL I;  1AA6 A;  1M1K 2;  2V8I A;  1PFT A;  1YJN Z;  1N2F A;  4HH4 A;  1VQ4 1;  3GTO I;  2WAQ A;  5FLM I;  3GTQ I;  2Q51 A;  2JA7 I;  1QVG Z;  1VQM 1;  4A3L I;  3RZO I;  3S2H I;  3HOY I;  2NVX I;  4QTT A;  5D1O B;  1SFO I;  1YIJ 1;  1KD1 1;  1KC8 1;  3G6E Z;  3OW2 Z;  2QA4 Z;  2OTL Z;  2AYD A;  3Q87 A;  3VMG A;  1K73 1;  3M3Y I;  4NB9 A;  2R7Z I;  2V45 A;  1VLA A;  2DE7 A;  1USP B;  2GU2 A;  1VQP Z;  1X0T A;  2E9H A;  2VPW A;  2OOX B;  5LL6 f;  5T67 A;  1VQK 1;  4E33 A;  1YI2 Z;  2B63 I;  2NAP A;  4NFR A;  1K8A 2;  1I3Q I;  4AYB A;  1N8R 2;  2RBL A;  4MRI A;  2OTJ 1;  3CCV Z;  2VPY A;  1VQN Z;  2QLV B;  3CC2 Z;  3JAM f;  3FQQ A;  3CCE 1;  3HOW I;  3LUS A;  1Z03 A;  2JIP A;  3CCJ 1;  1JJ2 Y;  1QF8 A;  4RVD A;  3CCR 1;  3T4N B;  2QRD B;  3CME Z;  3I07 A;  1N8R 1;  1K9M 2;  4X6A I;  4S1T A;  1RLY A;  3IR7 A;  5D1O A;  2W04 A;  3CPW Y;  1JWH C;  1VQN 1;  2HU9 A;  2IV2 X;  3GTM I;  2OOY B;  1VQ9 1;  5A2Q b;  2ZAE B;  3NDJ A;  1VQ5 Z;  3ESW A;  3CC4 1;  3KIF A;  1NP6 A;  4QTU A;  3CCQ Z;  1YHQ Z;  1Q7Y 2;  3CMA 1;  4MXU A;  3S1N I;  3NH8 A;  1W2B Y;  2PMZ A;  4NBA A;  3I4N I;  5T64 A;  3EER A;  3CD6 Z;  3MZK B;  2RIQ A;  3CCL 1;  4E2W A;  4NOZ A;  1YUK A;  3RZD I;  3MZL B;  1X3W A;  2QEX 1;  3CC7 Z;  3VTN A;  1NUI A;  4BXX I;  3JAM b;  3FQM A;  1M90 2;  1WII A;  2LEX A;  1VQ8 Z;  4A3F I;  3F3F C;  2AKL A;  4MD8 A;  2JA5 I;  2VPX A;  3CD6 1;  2M6N A;  2E2I I;  1VQ6 Z;  2PM9 A;  2GTH A;  1YIT Z;  2E2H I;  5C4X I;  4DQY B;  1SIW A;  4A3I I;  3PO3 S;  3GTP I;  1ZH1 A;  2JIO A;  1TFI A;  1S72 1;  2DE5 A;  4E31 A;  3CCS Z;  1M1K 1;  3OW2 Y;  4A3C I;  4E32 A;  2R6M A;  4NBE A;  1YJN 1;  3IX0 A;  2K3R A;  1Y1V I;  1TWC I;  2R93 I;  5IT9 b;  4MD9 A;  3CXC Y;  4RVG A;  2NVT I;  1FDO A;  3U50 C;  3CCM Z;  2JMO A;  4DK1 A;  3PO2 I;  1YJW Z;  2H85 A;  1QVF Y;  1WJ2 A;  3S14 I;  1TWA I;  1X3Z A;  2VPZ A;  2WB1 A;  2VF1 A;  1YUA A;  4Y52 I;  4E2X A;  3G6E 1;  1VQ7 Z;  2OTL 1;  2QA4 1;  4CL1 A;  1WW9 A;  3J81 b;  1Q81 2;  3J7A 4;  3NH4 A;  2GTI A;  3NFZ A;  2RT9 A;  3MON A;  1I6H I;  3IF8 A;  4NBH A;  3S16 I;  3FKI I;  1VQP 1;  2PK7 A;  1YJ9 Z;  2F4M A;  1LQL A;  3CCU Z;  1TWG I;  2Q4Z A;  3S2D I;  4A3J I;  2P3Y A;  2YU9 I;  1QYP A;  1VQ7 1;  4HGY A;  1VQL Z;  2J6A A;  4MON A;  1YI2 1;  3K7A I;  2O53 A;  2JR6 A;  2OZK A;  1K8A 1;  1Q16 A;  3J80 f;  1YJ9 1;  1Y1V S;  1ZB8 A;  3VB9 A;  4HGZ A;  3CCV 1;  2QRC B;  2JA6 I;  5FLX f;  3CC2 1;  3G4S Z;  3D6W A;  1WCM I;  2KI7 B;  1RQF A;  1P9N A;  1K83 I;  3NH5 A;  1Y1W I;  1RO4 A;  2JS4 A;  1VQO Z;  3GKQ A;  3TE5 B;  5IP7 I;  1Z01 A;  3CME 1;  5C4J I;  2W03 A;  1K9M 1;  3M4O I;  1Q86 2;  1JJ2 Z;  3BG0 B;  3CQZ I;  3S1M I;  1RO2 A;  2LFU A;  4DGL A;  3D9X A;  4A3M I;  4RVH A;  1KQS Y;  3CPW Z;  3HKZ A;  3I56 Z;  1VQ5 1;  1VQO 1;  4NBC A;  3H3V J;  3CCQ 1;  3GTG I;  1YHQ 1;  1Q7Y 1;  4TNU A;  1Q86 1;  4A3G I;  3I4M I;  4E2Y A;  2RHB A;  5T6B A;  3D2L A;  2IZ3 A;  3J80 b;  4NH1 C;  1VQ4 Z;  4RV9 A;  1QVG Y;  2G2K A; 
#chains in the Genus database with same CATH homology
 3CC7 1;  5FLX b;  3H0G I;  1M90 1;  1VQ8 1;  1ML8 A;  1VQM Z;  4A3E I;  4BY7 I;  3GTM S;  2LIY A;  1VQ6 1;  2YAD A;  1YIJ Z;  1KD1 2;  1YIT 1;  3S17 I;  1KC8 2;  1K73 2;  5C3E I;  4A3D I;  2O4H A;  4NBB A;  4XX2 A;  3P5J B;  2E2J I;  3VMI A;  3CCS 1;  3QWU A;  5D1P A;  3VMH A;  3HOX I;  4RS4 A;  2KPI A;  1VQK Z;  3CCM 1;  4NBD A;  3S1R I;  4E2Z A;  1YJW 1;  3CXC Z;  3GTJ I;  1I50 I;  4MD7 A;  5A2Q f;  3F3P C;  1QVF Z;  4E30 A;  2Y0S A;  2VUG A;  2P28 A;  2OTJ Z;  2IZ4 A;  1KRL A;  1Q81 1;  3BG1 B;  4Y7N I;  2EGT A;  3CCE Z;  1DL6 A;  3CCJ Z;  4EWC A;  5CM2 M;  4A3B I;  2V8J A;  3CCR Z;  1TWH I;  1TWF I;  4NBG A;  4NBF A;  3CCU 1;  5AN9 F;  3HOV I;  1L1O C;  1VQL 1;  3GCF A;  4RVF A;  4BBS I;  4A3K I;  2JA8 I;  1VQ9 Z;  3KIH A;  2QR1 B;  2HF1 A;  2V8K A;  1Q82 2;  2NVQ I;  2NVY I;  3CC4 Z;  1RNI A;  3PO3 I;  3CMA Z;  3S1Q I;  3G71 Z;  2JUB A;  1ZB9 A;  3G4S 1;  2M48 A;  3I55 Z;  1Z02 A;  3CCL Z;  4NB8 A;  3HOZ I;  2BJO A;  1USP A;  1Q82 1;  5C44 I;  4MH4 A;  2QEX Z;  5IT9 f;  1R9T I;  1RO0 A;  4A93 I;  1NJI 2;  4BY1 I;  2R92 I;  3TDH B;  5IP9 I;  3G71 1;  3S15 I;  2F4O A;  2K5R A;  2QKD A;  2QRE B;  2I3C A;  3I55 1;  3HOU I;  1W2B Z;  2JNY A;  2RPR A;  3IFU A;  3I56 1;  3EED A;  2VUM I;  2DE6 A;  1NJI 1;  3J81 f;  3GTK I;  1KQS Z;  4BBR I;  1S7M A;  1S72 Z;  3NDI A;  3GTL I;  1M1K 2;  2V8I A;  1PFT A;  1YJN Z;  1N2F A;  4HH4 A;  1VQ4 1;  3GTO I;  2WAQ A;  5FLM I;  3GTQ I;  2Q51 A;  2JA7 I;  1QVG Z;  1VQM 1;  4A3L I;  3RZO I;  3S2H I;  3HOY I;  2NVX I;  4QTT A;  5D1O B;  1SFO I;  1YIJ 1;  1KD1 1;  1KC8 1;  3G6E Z;  3OW2 Z;  2QA4 Z;  2OTL Z;  3Q87 A;  3VMG A;  1K73 1;  3M3Y I;  4NB9 A;  2R7Z I;  1VLA A;  2DE7 A;  1USP B;  2GU2 A;  1VQP Z;  1X0T A;  2E9H A;  2OOX B;  5LL6 f;  5T67 A;  1VQK 1;  4E33 A;  1YI2 Z;  2B63 I;  4NFR A;  1K8A 2;  1I3Q I;  4AYB A;  1N8R 2;  2RBL A;  4MRI A;  2OTJ 1;  3CCV Z;  1VQN Z;  2QLV B;  3CC2 Z;  3JAM f;  3FQQ A;  3CCE 1;  3HOW I;  3LUS A;  1Z03 A;  3CCJ 1;  1JJ2 Y;  1QF8 A;  4RVD A;  3CCR 1;  3T4N B;  2QRD B;  3CME Z;  3I07 A;  1N8R 1;  1K9M 2;  4X6A I;  4S1T A;  1RLY A;  5D1O A;  2W04 A;  3CPW Y;  1JWH C;  1VQN 1;  2HU9 A;  3GTM I;  2OOY B;  1VQ9 1;  5A2Q b;  2ZAE B;  3NDJ A;  1VQ5 Z;  3ESW A;  3CC4 1;  3KIF A;  1NP6 A;  4QTU A;  3CCQ Z;  1YHQ Z;  1Q7Y 2;  3CMA 1;  4MXU A;  3S1N I;  3NH8 A;  1W2B Y;  2PMZ A;  4NBA A;  3I4N I;  5T64 A;  3EER A;  3CD6 Z;  3MZK B;  2RIQ A;  3CCL 1;  4E2W A;  4NOZ A;  1YUK A;  3RZD I;  3MZL B;  1X3W A;  2QEX 1;  3CC7 Z;  3VTN A;  1NUI A;  4BXX I;  3JAM b;  3FQM A;  1M90 2;  1WII A;  1VQ8 Z;  4A3F I;  3F3F C;  2AKL A;  4MD8 A;  2JA5 I;  3CD6 1;  2M6N A;  2E2I I;  1VQ6 Z;  2PM9 A;  2GTH A;  1YIT Z;  2E2H I;  5C4X I;  4DQY B;  4A3I I;  3PO3 S;  3GTP I;  1ZH1 A;  1TFI A;  1S72 1;  2DE5 A;  4E31 A;  3CCS Z;  1M1K 1;  3OW2 Y;  4A3C I;  4E32 A;  2R6M A;  4NBE A;  1YJN 1;  3IX0 A;  2K3R A;  1Y1V I;  1TWC I;  2R93 I;  5IT9 b;  4MD9 A;  3CXC Y;  4RVG A;  2NVT I;  3U50 C;  3CCM Z;  2JMO A;  4DK1 A;  3PO2 I;  1YJW Z;  2H85 A;  1QVF Y;  3S14 I;  1TWA I;  1X3Z A;  2WB1 A;  2VF1 A;  1YUA A;  4Y52 I;  4E2X A;  3G6E 1;  1VQ7 Z;  2OTL 1;  2QA4 1;  4CL1 A;  1WW9 A;  3J81 b;  1Q81 2;  3J7A 4;  3NH4 A;  2GTI A;  3NFZ A;  2RT9 A;  3MON A;  1I6H I;  3IF8 A;  4NBH A;  3S16 I;  3FKI I;  1VQP 1;  2PK7 A;  1YJ9 Z;  2F4M A;  1LQL A;  3CCU Z;  1TWG I;  2Q4Z A;  3S2D I;  4A3J I;  2P3Y A;  2YU9 I;  1QYP A;  1VQ7 1;  4HGY A;  1VQL Z;  2J6A A;  4MON A;  1YI2 1;  3K7A I;  2O53 A;  2JR6 A;  2OZK A;  1K8A 1;  3J80 f;  1YJ9 1;  1Y1V S;  1ZB8 A;  3VB9 A;  4HGZ A;  3CCV 1;  2QRC B;  2JA6 I;  5FLX f;  3CC2 1;  3G4S Z;  3D6W A;  1WCM I;  2KI7 B;  1RQF A;  1P9N A;  1K83 I;  3NH5 A;  1Y1W I;  1RO4 A;  2JS4 A;  1VQO Z;  3GKQ A;  3TE5 B;  5IP7 I;  1Z01 A;  3CME 1;  5C4J I;  2W03 A;  1K9M 1;  3M4O I;  1Q86 2;  1JJ2 Z;  3BG0 B;  3CQZ I;  3S1M I;  1RO2 A;  2LFU A;  4DGL A;  3D9X A;  4A3M I;  4RVH A;  1KQS Y;  3CPW Z;  3HKZ A;  3I56 Z;  1VQ5 1;  1VQO 1;  4NBC A;  3H3V J;  3CCQ 1;  3GTG I;  1YHQ 1;  1Q7Y 1;  4TNU A;  1Q86 1;  4A3G I;  3I4M I;  4E2Y A;  2RHB A;  5T6B A;  2IZ3 A;  3J80 b;  4NH1 C;  1VQ4 Z;  4RV9 A;  1QVG Y;  2G2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...