4A3EI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI02
2P3YA 3U50C 3S1MI 1ML8A 1Y1VS 2JNYA 3S1RI 3GTPI 2F4MA 1DL6A 2JA7I 2R92I 3GTLI 3FKII 4NBGA 2NVTI 1I3QI 3Q87A 1TWHI 4A3JI 2NVXI 3GCFA 3ESWA 4A3GI 4BY7I 4Y7NI 1VLAA 5C44I 4A3FI 2JR6A 3S1NI 1TWCI 1PFTA 2DE7A 2YU9I 3S2HI 4A3MI 2NVYI 3H0GI 1NUIA 5FLMI 3HOZI 3GTKI 1SFOI 4QTTA 1TWFI 4BBSI 4Y52I 2VUMI 3S16I 3GTGI 1TFIA 1ZB8A 4NBDA 1N2FA 2R7ZI 4A3KI 3EERA 4NBFA 3H3VJ 1QYPA 1I50I 1Y1WI 3HOVI 3GTQI 4XX2A 3M3YI 4BXXI 3I4NI 3HOUI 4X6AI 4NBCA 3LUSA 3K7AI 4QTUA 3S17I 3HOWI 2AKLA 1WCMI 1R9TI 3GTOI 3VMIA 2NVQI 1X3ZA 3RZOI 2B63I 2R93I 1USPA 3S2DI 3CQZI 4A3LI 2DE6A 5C3EI 3S14I 4NBAA 3VB9A 1LQLA 4A3II 4A3DI 3PO3I 1I6HI 2RBLA 4NB8A 2K5RA 3D6WA 3GTMI 3GTJI 2HF1A 4NBEA 3VMGA 2KPIA 5CM2M 2DE5A 2F4OA 4NBHA 3GKQA 4NBBA 2JA5I 5IP9I 3HOYI 3M4OI 1RO4A 1USPB 2E2HI 1K83I 4BBRI 2PK7A 2BJOA 3HOXI 1TWAI 1Y1VI 2JA8I 4A3CI 3I4MI 3RZDI 1ZB9A 5C4JI 1X3WA 4NOZA 3PO3S 3S1QI 1L1OC 4BY1I 2J6AA 1TWGI 1WW9A 3I07A 3GTMS 4A3EI 1RLYA 1YUAA 3VMHA 5IP7I 4A93I 5C4XI 2JS4A 2E2II 2JA6I 4MH4A 4NB9A 3S15I 3PO2I 4A3BI 2E2JI
chains in the Genus database with same CATH superfamily
1RO0A 4HGZA 1Y1VS 3CCQ1 3CD61 4RS4A 1KQSY 2F4MA 2JA7I 2IZ4A 2R92I 3NH8A 3CXCZ 4DK1A 3Q87A 1TWHI 1Q862 1VQLZ 3GCFA 2VPZA 1VLAA 1VQ81 4A3FI 2QR1B 2R6MA 1YUKA 2YU9I 1RO2A 1FDIA 1NUIA 2AYDA 1M902 1NP6A 2PMZA 5AN9F 3CC2Z 2VUMI 3CCJZ 1TFIA 1ZB8A 4NBDA 1YITZ 1VQPZ 3IF8A 2QEX1 4HGYA 1Y1WI 1YI2Z 3MZLB 1RQFA 1QVGZ 4MD8A 1P9NA 1QXFA 2Y0SA 3HOWI 3GTOI 3VMIA 3CC71 1QVGY 1VQ61 4TNUA 1X3ZA 2B63I 1YJN1 1S7MA 1VQK1 3G71Z 4A3LI 1VQ91 2QA41 4A3DI 2WAQA 1I6HI 2RBLA 4E2XA 1W2BY 3FQMA 2M6NA 3I551 3G6EZ 1KD11 3GTMI 1VQOZ 3T4NB 3M4OI 1K731 1N8R2 3D2LA 1NJI2 2O4HA 1K8A2 2RIQA 2RPRA 1FDOA 2JIQA 4BY1I 3I07A 2VPYA 1RLYA 2E9HA 5LL6f 5C4XI 2JA6I 2VPWA 4MH4A 3S15I 2GU2A 3I561 1YJW1 2VF1A 2QLVB 2E2JI 4MD9A 3U50C 1Q822 1VQ41 2IZ3A 1Y8CA 1DL6A 1RNIA 3CMAZ 3TDHB 4MXUA 3FKII 1Q861 4NBGA 2M48A 2NVTI 1VQ5Z 1Z01A 3CCVZ 4A3JI 1K9M2 1JJ2Z 5T64A 3CCE1 2PM9A 2JR6A 3G4S1 1TWCI 2G2KA 4A3MI 2NVYI 1VQM1 3CCRZ 3CME1 3HOZI 4QTTA 1TWFI 4Y52I 1SIWA 3EEDA 5D1OB 4S1TA 3F3FC 4A3KI 4NBFA 5T67A 2QREB 3CXCY 3M3YI 3CCQZ 1YJ91 3CD6Z 3I4NI 4X6AI 3K7AI 1VQ71 1WCMI 1R9TI 2GTIA 3F3PC 1USPA 3S2DI 3CCUZ 1VQ8Z 3VB9A 3J81f 2OOYB 2OTL1 3GTJI 3KIFA 1YIT1 4AYBA 2ZAEB 4NBBA 2H85A 4RVFA 2OTJZ 1NJI1 1K8A1 2QKDA 2E2HI 2JUBA 1Q7Y2 4BBRI 1Z03A 1TWAI 2JA8I 3RZDI 3CC4Z 3J80b 2P28A 1L1OC 3GTMS 3D9XA 1VQN1 3G711 2I3CA 2OOXB 3VMHA 5IP7I 4E2ZA 1VQ6Z 4A93I 3CCL1 1YJNZ 1VQKZ 1VQ9Z 3KIHA 2QA4Z 5D1PA 4RVGA 3IX0A 3S1MI 1ML8A 1Q821 2VPXA 2JNYA 2V3VA 3J81b 1YIJZ 3S1RI 3I55Z 3NH4A 3GTLI 3BG0B 2V8KA 2RHBA 2IV2X 1JWHC 2QRDB 4A3GI 4BY7I 2LFUA 5C44I 3IFUA 1WIIA 3S1NI 1KC81 2DE7A 3CCM1 2QRCB 1YHQZ 5FLMI 2K3RA 4BBSI 4E31A 3S16I 1X0TA 3JAMf 1N2FA 3I56Z 3NDJA 1S72Z 3EERA 1YJWZ 3H3VJ 1QYPA 1I50I 3HOVI 4MRIA 1Q812 3GTQI 4XX2A 2JIPA 2W04A 4BXXI 1VQ4Z 3CCV1 4NFRA 1M901 1JJ2Y 3S17I 3CPWZ 2AKLA 2JIOA 1K732 4DQYB 2NVQI 3NH5A 2LEXA 3RZOI 2R93I 2V8JA 3CCS1 5IT9b 3CCEZ 3CPWY 3J7A4 2DE6A 1KRLA 5T6BA 3S14I 3CCR1 2YADA 2LIYA 4NBAA 3TE5B 3G4SZ 4A3II 1M1K2 4E32A 3PO3I 2K5RA 1VQMZ 3D6WA 3CMEZ 3J80f 2DE5A 2HU9A 2F4OA 1KQSZ 2JA5I 2NAPA 5IP9I 1Q7Y1 1VQL1 3HOYI 1USPB 2V8IA 2JIMA 3JAMb 3BG1B 2E7ZA 2PK7A 1Y1VI 5A2Qf 1QF8A 2GTHA 5FLXf 1YJ9Z 3S1QI 1WW9A 1WZNA 5D1OA 1VQ7Z 1YUAA 3CCU1 3CC21 3CCJ1 1VQP1 3OW2Z 4A3BI 1N8R1 2P3YA 2W03A 4E2WA 3NDIA 1YI21 3OW2Y 2QEXZ 3GTPI 2OTLZ 2OTJ1 1I3QI 2NVXI 4CL1A 2VUGA 3CC41 3ESWA 4Y7NI 3CC7Z 4E30A 1PFTA 4DGLA 5A2Qb 3S2HI 3H0GI 3NFZA 5FLXb 2Q4ZA 3GTKI 3G6E1 1SFOI 2KI7B 1VQO1 1VQNZ 1W2BZ 3GTGI 3CCLZ 4RVHA 3FQQA 2R7ZI 1K9M1 2RT9A 2Q51A 1Q811 1Q16A 1YIJ1 5IT9f 4RVDA 2O53A 2WB1A 3MONA 3HOUI 4NBCA 3LUSA 1WJ2A 4QTUA 4NH1C 2V45A 4MONA 1ZH1A 1QVFZ 3CQZI 1M1K1 1YHQ1 5C3EI 3QWUA 1LQLA 3IR7A 1QVFY 4RV9A 3CCMZ 4NB8A 3CMA1 2HF1A 4NBEA 3VMGA 1Z02A 2KPIA 5CM2M 1AA6A 1KD12 1S721 2EGTA 1VQ51 4NBHA 3GKQA 4E2YA 3P5JB 1RO4A 3MZKB 3VTNA 1K83I 2BJOA 3HOXI 4A3CI 3I4MI 1ZB9A 5C4JI 4HH4A 1X3WA 2OZKA 3HKZA 4NOZA 3PO3S 2J6AA 1TWGI 4EWCA 4MD7A 2JIRA 4A3EI 4E33A 2JS4A 2E2II 2JMOA 4NB9A 3CCSZ 3PO2I 1KC82
chains in the Genus database with same CATH topology
1RO0A 4HGZA 1Y1VS 3CCQ1 3CD61 4RS4A 1KQSY 2F4MA 2JA7I 2IZ4A 2R92I 3NH8A 3CXCZ 4DK1A 3Q87A 1TWHI 1Q862 1VQLZ 3GCFA 1VLAA 1VQ81 4A3FI 2QR1B 2R6MA 1YUKA 2YU9I 1RO2A 1NUIA 1M902 1NP6A 2PMZA 5AN9F 3CC2Z 2VUMI 3CCJZ 1TFIA 1ZB8A 4NBDA 1YITZ 1VQPZ 3IF8A 2QEX1 4HGYA 1Y1WI 1YI2Z 3MZLB 1RQFA 1QVGZ 4MD8A 1P9NA 2Y0SA 3HOWI 3GTOI 3VMIA 3CC71 1QVGY 1VQ61 4TNUA 1X3ZA 2B63I 1YJN1 1S7MA 1VQK1 3G71Z 4A3LI 1VQ91 2QA41 4A3DI 2WAQA 1I6HI 2RBLA 4E2XA 1W2BY 3FQMA 2M6NA 3I551 3G6EZ 1KD11 3GTMI 1VQOZ 3T4NB 3M4OI 1K731 1N8R2 1NJI2 2O4HA 1K8A2 2RIQA 2RPRA 4BY1I 3I07A 1RLYA 2E9HA 5LL6f 5C4XI 2JA6I 4MH4A 3S15I 2GU2A 3I561 1YJW1 2VF1A 2QLVB 2E2JI 4MD9A 3U50C 1Q822 1VQ41 2IZ3A 1DL6A 1RNIA 3CMAZ 3TDHB 4MXUA 3FKII 1Q861 4NBGA 2M48A 2NVTI 1VQ5Z 1Z01A 3CCVZ 4A3JI 1K9M2 1JJ2Z 5T64A 3CCE1 2PM9A 2JR6A 3G4S1 1TWCI 2G2KA 4A3MI 2NVYI 1VQM1 3CCRZ 3CME1 3HOZI 4QTTA 1TWFI 4Y52I 3EEDA 5D1OB 4S1TA 3F3FC 4A3KI 4NBFA 5T67A 2QREB 3CXCY 3M3YI 3CCQZ 1YJ91 3CD6Z 3I4NI 4X6AI 3K7AI 1VQ71 1WCMI 1R9TI 2GTIA 3F3PC 1USPA 3S2DI 3CCUZ 1VQ8Z 3VB9A 3J81f 2OOYB 2OTL1 3GTJI 3KIFA 1YIT1 4AYBA 2ZAEB 4NBBA 2H85A 4RVFA 2OTJZ 1NJI1 1K8A1 2QKDA 2E2HI 2JUBA 1Q7Y2 4BBRI 1Z03A 1TWAI 2JA8I 3RZDI 3CC4Z 3J80b 2P28A 1L1OC 3GTMS 3D9XA 1VQN1 3G711 2I3CA 2OOXB 3VMHA 5IP7I 4E2ZA 1VQ6Z 4A93I 3CCL1 1YJNZ 1VQKZ 1VQ9Z 3KIHA 2QA4Z 5D1PA 4RVGA 3IX0A 3S1MI 1ML8A 1Q821 2JNYA 3J81b 1YIJZ 3S1RI 3I55Z 3NH4A 3GTLI 3BG0B 2V8KA 2RHBA 1JWHC 2QRDB 4A3GI 4BY7I 2LFUA 5C44I 3IFUA 1WIIA 3S1NI 1KC81 2DE7A 3CCM1 2QRCB 1YHQZ 5FLMI 2K3RA 4BBSI 4E31A 3S16I 1X0TA 3JAMf 1N2FA 3I56Z 3NDJA 1S72Z 3EERA 1YJWZ 3H3VJ 1QYPA 1I50I 3HOVI 4MRIA 1Q812 3GTQI 4XX2A 2W04A 4BXXI 1VQ4Z 3CCV1 4NFRA 1M901 1JJ2Y 3S17I 3CPWZ 2AKLA 1K732 4DQYB 2NVQI 3NH5A 3RZOI 2R93I 2V8JA 3CCS1 5IT9b 3CCEZ 3CPWY 3J7A4 2DE6A 1KRLA 5T6BA 3S14I 3CCR1 2YADA 2LIYA 4NBAA 3TE5B 3G4SZ 4A3II 1M1K2 4E32A 3PO3I 2K5RA 1VQMZ 3D6WA 3CMEZ 3J80f 2DE5A 2F4OA 2HU9A 1KQSZ 2JA5I 5IP9I 1Q7Y1 1VQL1 3HOYI 1USPB 2V8IA 3JAMb 3BG1B 2PK7A 1Y1VI 5A2Qf 1QF8A 2GTHA 5FLXf 1YJ9Z 3S1QI 1WW9A 5D1OA 1VQ7Z 1YUAA 3CCU1 3CC21 3CCJ1 1VQP1 3OW2Z 4A3BI 1N8R1 2P3YA 2W03A 4E2WA 3NDIA 1YI21 3OW2Y 2QEXZ 3GTPI 2OTLZ 2OTJ1 1I3QI 2NVXI 4CL1A 2VUGA 3CC41 3ESWA 4Y7NI 3CC7Z 4E30A 1PFTA 4DGLA 5A2Qb 3S2HI 3H0GI 3NFZA 5FLXb 2Q4ZA 3GTKI 3G6E1 1SFOI 2KI7B 1VQO1 1VQNZ 1W2BZ 3GTGI 3CCLZ 4RVHA 3FQQA 2R7ZI 1K9M1 2RT9A 2Q51A 1Q811 1YIJ1 5IT9f 4RVDA 2O53A 2WB1A 3MONA 3HOUI 4NBCA 3LUSA 4QTUA 4NH1C 4MONA 1ZH1A 1QVFZ 3CQZI 1M1K1 1YHQ1 5C3EI 3QWUA 1LQLA 1QVFY 4RV9A 3CCMZ 4NB8A 3CMA1 2HF1A 4NBEA 3VMGA 1Z02A 2KPIA 5CM2M 1KD12 1S721 2EGTA 1VQ51 4NBHA 3GKQA 4E2YA 3P5JB 1RO4A 3MZKB 3VTNA 1K83I 2BJOA 3HOXI 4A3CI 3I4MI 1ZB9A 5C4JI 4HH4A 1X3WA 2OZKA 3HKZA 4NOZA 3PO3S 2J6AA 1TWGI 4EWCA 4MD7A 4A3EI 4E33A 2JS4A 2E2II 2JMOA 4NB9A 3CCSZ 3PO2I 1KC82
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P3Y A;  3U50 C;  3S1M I;  1ML8 A;  1Y1V S;  2JNY A;  3S1R I;  3GTP I;  2F4M A;  1DL6 A;  2JA7 I;  2R92 I;  3GTL I;  3FKI I;  4NBG A;  2NVT I;  1I3Q I;  3Q87 A;  1TWH I;  4A3J I;  2NVX I;  3GCF A;  3ESW A;  4A3G I;  4BY7 I;  4Y7N I;  1VLA A;  5C44 I;  4A3F I;  2JR6 A;  3S1N I;  1TWC I;  1PFT A;  2DE7 A;  2YU9 I;  3S2H I;  4A3M I;  2NVY I;  3H0G I;  1NUI A;  5FLM I;  3HOZ I;  3GTK I;  1SFO I;  4QTT A;  1TWF I;  4BBS I;  4Y52 I;  2VUM I;  3S16 I;  3GTG I;  1TFI A;  1ZB8 A;  4NBD A;  1N2F A;  2R7Z I;  4A3K I;  3EER A;  4NBF A;  3H3V J;  1QYP A;  1I50 I;  1Y1W I;  3HOV I;  3GTQ I;  4XX2 A;  3M3Y I;  4BXX I;  3I4N I;  3HOU I;  4X6A I;  4NBC A;  3LUS A;  3K7A I;  4QTU A;  3S17 I;  3HOW I;  2AKL A;  1WCM I;  1R9T I;  3GTO I;  3VMI A;  2NVQ I;  1X3Z A;  3RZO I;  2B63 I;  2R93 I;  1USP A;  3S2D I;  3CQZ I;  4A3L I;  2DE6 A;  5C3E I;  3S14 I;  4NBA A;  3VB9 A;  1LQL A;  4A3I I;  4A3D I;  3PO3 I;  1I6H I;  2RBL A;  4NB8 A;  2K5R A;  3D6W A;  3GTM I;  3GTJ I;  2HF1 A;  4NBE A;  3VMG A;  2KPI A;  5CM2 M;  2DE5 A;  2F4O A;  4NBH A;  3GKQ A;  4NBB A;  2JA5 I;  5IP9 I;  3HOY I;  3M4O I;  1RO4 A;  1USP B;  2E2H I;  1K83 I;  4BBR I;  2PK7 A;  2BJO A;  3HOX I;  1TWA I;  1Y1V I;  2JA8 I;  4A3C I;  3I4M I;  3RZD I;  1ZB9 A;  5C4J I;  1X3W A;  4NOZ A;  3PO3 S;  3S1Q I;  1L1O C;  4BY1 I;  2J6A A;  1TWG I;  1WW9 A;  3I07 A;  3GTM S;  4A3E I;  1RLY A;  1YUA A;  3VMH A;  5IP7 I;  4A93 I;  5C4X I;  2JS4 A;  2E2I I;  2JA6 I;  4MH4 A;  4NB9 A;  3S15 I;  3PO2 I;  4A3B I;  2E2J I; 
#chains in the Genus database with same CATH topology
 1RO0 A;  4HGZ A;  1Y1V S;  3CCQ 1;  3CD6 1;  4RS4 A;  1KQS Y;  2F4M A;  2JA7 I;  2IZ4 A;  2R92 I;  3NH8 A;  3CXC Z;  4DK1 A;  3Q87 A;  1TWH I;  1Q86 2;  1VQL Z;  3GCF A;  2VPZ A;  1VLA A;  1VQ8 1;  4A3F I;  2QR1 B;  2R6M A;  1YUK A;  2YU9 I;  1RO2 A;  1FDI A;  1NUI A;  2AYD A;  1M90 2;  1NP6 A;  2PMZ A;  5AN9 F;  3CC2 Z;  2VUM I;  3CCJ Z;  1TFI A;  1ZB8 A;  4NBD A;  1YIT Z;  1VQP Z;  3IF8 A;  2QEX 1;  4HGY A;  1Y1W I;  1YI2 Z;  3MZL B;  1RQF A;  1QVG Z;  4MD8 A;  1P9N A;  1QXF A;  2Y0S A;  3HOW I;  3GTO I;  3VMI A;  3CC7 1;  1QVG Y;  1VQ6 1;  4TNU A;  1X3Z A;  2B63 I;  1YJN 1;  1S7M A;  1VQK 1;  3G71 Z;  4A3L I;  1VQ9 1;  2QA4 1;  4A3D I;  2WAQ A;  1I6H I;  2RBL A;  4E2X A;  1W2B Y;  3FQM A;  2M6N A;  3I55 1;  3G6E Z;  1KD1 1;  3GTM I;  1VQO Z;  3T4N B;  3M4O I;  1K73 1;  1N8R 2;  3D2L A;  1NJI 2;  2O4H A;  1K8A 2;  2RIQ A;  2RPR A;  1FDO A;  2JIQ A;  4BY1 I;  3I07 A;  2VPY A;  1RLY A;  2E9H A;  5LL6 f;  5C4X I;  2JA6 I;  2VPW A;  4MH4 A;  3S15 I;  2GU2 A;  3I56 1;  1YJW 1;  2VF1 A;  2QLV B;  2E2J I;  4MD9 A;  3U50 C;  1Q82 2;  1VQ4 1;  2IZ3 A;  1Y8C A;  1DL6 A;  1RNI A;  3CMA Z;  3TDH B;  4MXU A;  3FKI I;  1Q86 1;  4NBG A;  2M48 A;  2NVT I;  1VQ5 Z;  1Z01 A;  3CCV Z;  4A3J I;  1K9M 2;  1JJ2 Z;  5T64 A;  3CCE 1;  2PM9 A;  2JR6 A;  3G4S 1;  1TWC I;  2G2K A;  4A3M I;  2NVY I;  1VQM 1;  3CCR Z;  3CME 1;  3HOZ I;  4QTT A;  1TWF I;  4Y52 I;  1SIW A;  3EED A;  5D1O B;  4S1T A;  3F3F C;  4A3K I;  4NBF A;  5T67 A;  2QRE B;  3CXC Y;  3M3Y I;  3CCQ Z;  1YJ9 1;  3CD6 Z;  3I4N I;  4X6A I;  3K7A I;  1VQ7 1;  1WCM I;  1R9T I;  2GTI A;  3F3P C;  1USP A;  3S2D I;  3CCU Z;  1VQ8 Z;  3VB9 A;  3J81 f;  2OOY B;  2OTL 1;  3GTJ I;  3KIF A;  1YIT 1;  4AYB A;  2ZAE B;  4NBB A;  2H85 A;  4RVF A;  2OTJ Z;  1NJI 1;  1K8A 1;  2QKD A;  2E2H I;  2JUB A;  1Q7Y 2;  4BBR I;  1Z03 A;  1TWA I;  2JA8 I;  3RZD I;  3CC4 Z;  3J80 b;  2P28 A;  1L1O C;  3GTM S;  3D9X A;  1VQN 1;  3G71 1;  2I3C A;  2OOX B;  3VMH A;  5IP7 I;  4E2Z A;  1VQ6 Z;  4A93 I;  3CCL 1;  1YJN Z;  1VQK Z;  1VQ9 Z;  3KIH A;  2QA4 Z;  5D1P A;  4RVG A;  3IX0 A;  3S1M I;  1ML8 A;  1Q82 1;  2VPX A;  2JNY A;  2V3V A;  3J81 b;  1YIJ Z;  3S1R I;  3I55 Z;  3NH4 A;  3GTL I;  3BG0 B;  2V8K A;  2RHB A;  2IV2 X;  1JWH C;  2QRD B;  4A3G I;  4BY7 I;  2LFU A;  5C44 I;  3IFU A;  1WII A;  3S1N I;  1KC8 1;  2DE7 A;  3CCM 1;  2QRC B;  1YHQ Z;  5FLM I;  2K3R A;  4BBS I;  4E31 A;  3S16 I;  1X0T A;  3JAM f;  1N2F A;  3I56 Z;  3NDJ A;  1S72 Z;  3EER A;  1YJW Z;  3H3V J;  1QYP A;  1I50 I;  3HOV I;  4MRI A;  1Q81 2;  3GTQ I;  4XX2 A;  2JIP A;  2W04 A;  4BXX I;  1VQ4 Z;  3CCV 1;  4NFR A;  1M90 1;  1JJ2 Y;  3S17 I;  3CPW Z;  2AKL A;  2JIO A;  1K73 2;  4DQY B;  2NVQ I;  3NH5 A;  2LEX A;  3RZO I;  2R93 I;  2V8J A;  3CCS 1;  5IT9 b;  3CCE Z;  3CPW Y;  3J7A 4;  2DE6 A;  1KRL A;  5T6B A;  3S14 I;  3CCR 1;  2YAD A;  2LIY A;  4NBA A;  3TE5 B;  3G4S Z;  4A3I I;  1M1K 2;  4E32 A;  3PO3 I;  2K5R A;  1VQM Z;  3D6W A;  3CME Z;  3J80 f;  2DE5 A;  2HU9 A;  2F4O A;  1KQS Z;  2JA5 I;  2NAP A;  5IP9 I;  1Q7Y 1;  1VQL 1;  3HOY I;  1USP B;  2V8I A;  2JIM A;  3JAM b;  3BG1 B;  2E7Z A;  2PK7 A;  1Y1V I;  5A2Q f;  1QF8 A;  2GTH A;  5FLX f;  1YJ9 Z;  3S1Q I;  1WW9 A;  1WZN A;  5D1O A;  1VQ7 Z;  1YUA A;  3CCU 1;  3CC2 1;  3CCJ 1;  1VQP 1;  3OW2 Z;  4A3B I;  1N8R 1;  2P3Y A;  2W03 A;  4E2W A;  3NDI A;  1YI2 1;  3OW2 Y;  2QEX Z;  3GTP I;  2OTL Z;  2OTJ 1;  1I3Q I;  2NVX I;  4CL1 A;  2VUG A;  3CC4 1;  3ESW A;  4Y7N I;  3CC7 Z;  4E30 A;  1PFT A;  4DGL A;  5A2Q b;  3S2H I;  3H0G I;  3NFZ A;  5FLX b;  2Q4Z A;  3GTK I;  3G6E 1;  1SFO I;  2KI7 B;  1VQO 1;  1VQN Z;  1W2B Z;  3GTG I;  3CCL Z;  4RVH A;  3FQQ A;  2R7Z I;  1K9M 1;  2RT9 A;  2Q51 A;  1Q81 1;  1Q16 A;  1YIJ 1;  5IT9 f;  4RVD A;  2O53 A;  2WB1 A;  3MON A;  3HOU I;  4NBC A;  3LUS A;  1WJ2 A;  4QTU A;  4NH1 C;  2V45 A;  4MON A;  1ZH1 A;  1QVF Z;  3CQZ I;  1M1K 1;  1YHQ 1;  5C3E I;  3QWU A;  1LQL A;  3IR7 A;  1QVF Y;  4RV9 A;  3CCM Z;  4NB8 A;  3CMA 1;  2HF1 A;  4NBE A;  3VMG A;  1Z02 A;  2KPI A;  5CM2 M;  1AA6 A;  1KD1 2;  1S72 1;  2EGT A;  1VQ5 1;  4NBH A;  3GKQ A;  4E2Y A;  3P5J B;  1RO4 A;  3MZK B;  3VTN A;  1K83 I;  2BJO A;  3HOX I;  4A3C I;  3I4M I;  1ZB9 A;  5C4J I;  4HH4 A;  1X3W A;  2OZK A;  3HKZ A;  4NOZ A;  3PO3 S;  2J6A A;  1TWG I;  4EWC A;  4MD7 A;  2JIR A;  4A3E I;  4E33 A;  2JS4 A;  2E2I I;  2JMO A;  4NB9 A;  3CCS Z;  3PO2 I;  1KC8 2; 
#chains in the Genus database with same CATH homology
 1RO0 A;  4HGZ A;  1Y1V S;  3CCQ 1;  3CD6 1;  4RS4 A;  1KQS Y;  2F4M A;  2JA7 I;  2IZ4 A;  2R92 I;  3NH8 A;  3CXC Z;  4DK1 A;  3Q87 A;  1TWH I;  1Q86 2;  1VQL Z;  3GCF A;  1VLA A;  1VQ8 1;  4A3F I;  2QR1 B;  2R6M A;  1YUK A;  2YU9 I;  1RO2 A;  1NUI A;  1M90 2;  1NP6 A;  2PMZ A;  5AN9 F;  3CC2 Z;  2VUM I;  3CCJ Z;  1TFI A;  1ZB8 A;  4NBD A;  1YIT Z;  1VQP Z;  3IF8 A;  2QEX 1;  4HGY A;  1Y1W I;  1YI2 Z;  3MZL B;  1RQF A;  1QVG Z;  4MD8 A;  1P9N A;  2Y0S A;  3HOW I;  3GTO I;  3VMI A;  3CC7 1;  1QVG Y;  1VQ6 1;  4TNU A;  1X3Z A;  2B63 I;  1YJN 1;  1S7M A;  1VQK 1;  3G71 Z;  4A3L I;  1VQ9 1;  2QA4 1;  4A3D I;  2WAQ A;  1I6H I;  2RBL A;  4E2X A;  1W2B Y;  3FQM A;  2M6N A;  3I55 1;  3G6E Z;  1KD1 1;  3GTM I;  1VQO Z;  3T4N B;  3M4O I;  1K73 1;  1N8R 2;  1NJI 2;  2O4H A;  1K8A 2;  2RIQ A;  2RPR A;  4BY1 I;  3I07 A;  1RLY A;  2E9H A;  5LL6 f;  5C4X I;  2JA6 I;  4MH4 A;  3S15 I;  2GU2 A;  3I56 1;  1YJW 1;  2VF1 A;  2QLV B;  2E2J I;  4MD9 A;  3U50 C;  1Q82 2;  1VQ4 1;  2IZ3 A;  1DL6 A;  1RNI A;  3CMA Z;  3TDH B;  4MXU A;  3FKI I;  1Q86 1;  4NBG A;  2M48 A;  2NVT I;  1VQ5 Z;  1Z01 A;  3CCV Z;  4A3J I;  1K9M 2;  1JJ2 Z;  5T64 A;  3CCE 1;  2PM9 A;  2JR6 A;  3G4S 1;  1TWC I;  2G2K A;  4A3M I;  2NVY I;  1VQM 1;  3CCR Z;  3CME 1;  3HOZ I;  4QTT A;  1TWF I;  4Y52 I;  3EED A;  5D1O B;  4S1T A;  3F3F C;  4A3K I;  4NBF A;  5T67 A;  2QRE B;  3CXC Y;  3M3Y I;  3CCQ Z;  1YJ9 1;  3CD6 Z;  3I4N I;  4X6A I;  3K7A I;  1VQ7 1;  1WCM I;  1R9T I;  2GTI A;  3F3P C;  1USP A;  3S2D I;  3CCU Z;  1VQ8 Z;  3VB9 A;  3J81 f;  2OOY B;  2OTL 1;  3GTJ I;  3KIF A;  1YIT 1;  4AYB A;  2ZAE B;  4NBB A;  2H85 A;  4RVF A;  2OTJ Z;  1NJI 1;  1K8A 1;  2QKD A;  2E2H I;  2JUB A;  1Q7Y 2;  4BBR I;  1Z03 A;  1TWA I;  2JA8 I;  3RZD I;  3CC4 Z;  3J80 b;  2P28 A;  1L1O C;  3GTM S;  3D9X A;  1VQN 1;  3G71 1;  2I3C A;  2OOX B;  3VMH A;  5IP7 I;  4E2Z A;  1VQ6 Z;  4A93 I;  3CCL 1;  1YJN Z;  1VQK Z;  1VQ9 Z;  3KIH A;  2QA4 Z;  5D1P A;  4RVG A;  3IX0 A;  3S1M I;  1ML8 A;  1Q82 1;  2JNY A;  3J81 b;  1YIJ Z;  3S1R I;  3I55 Z;  3NH4 A;  3GTL I;  3BG0 B;  2V8K A;  2RHB A;  1JWH C;  2QRD B;  4A3G I;  4BY7 I;  2LFU A;  5C44 I;  3IFU A;  1WII A;  3S1N I;  1KC8 1;  2DE7 A;  3CCM 1;  2QRC B;  1YHQ Z;  5FLM I;  2K3R A;  4BBS I;  4E31 A;  3S16 I;  1X0T A;  3JAM f;  1N2F A;  3I56 Z;  3NDJ A;  1S72 Z;  3EER A;  1YJW Z;  3H3V J;  1QYP A;  1I50 I;  3HOV I;  4MRI A;  1Q81 2;  3GTQ I;  4XX2 A;  2W04 A;  4BXX I;  1VQ4 Z;  3CCV 1;  4NFR A;  1M90 1;  1JJ2 Y;  3S17 I;  3CPW Z;  2AKL A;  1K73 2;  4DQY B;  2NVQ I;  3NH5 A;  3RZO I;  2R93 I;  2V8J A;  3CCS 1;  5IT9 b;  3CCE Z;  3CPW Y;  3J7A 4;  2DE6 A;  1KRL A;  5T6B A;  3S14 I;  3CCR 1;  2YAD A;  2LIY A;  4NBA A;  3TE5 B;  3G4S Z;  4A3I I;  1M1K 2;  4E32 A;  3PO3 I;  2K5R A;  1VQM Z;  3D6W A;  3CME Z;  3J80 f;  2DE5 A;  2F4O A;  2HU9 A;  1KQS Z;  2JA5 I;  5IP9 I;  1Q7Y 1;  1VQL 1;  3HOY I;  1USP B;  2V8I A;  3JAM b;  3BG1 B;  2PK7 A;  1Y1V I;  5A2Q f;  1QF8 A;  2GTH A;  5FLX f;  1YJ9 Z;  3S1Q I;  1WW9 A;  5D1O A;  1VQ7 Z;  1YUA A;  3CCU 1;  3CC2 1;  3CCJ 1;  1VQP 1;  3OW2 Z;  4A3B I;  1N8R 1;  2P3Y A;  2W03 A;  4E2W A;  3NDI A;  1YI2 1;  3OW2 Y;  2QEX Z;  3GTP I;  2OTL Z;  2OTJ 1;  1I3Q I;  2NVX I;  4CL1 A;  2VUG A;  3CC4 1;  3ESW A;  4Y7N I;  3CC7 Z;  4E30 A;  1PFT A;  4DGL A;  5A2Q b;  3S2H I;  3H0G I;  3NFZ A;  5FLX b;  2Q4Z A;  3GTK I;  3G6E 1;  1SFO I;  2KI7 B;  1VQO 1;  1VQN Z;  1W2B Z;  3GTG I;  3CCL Z;  4RVH A;  3FQQ A;  2R7Z I;  1K9M 1;  2RT9 A;  2Q51 A;  1Q81 1;  1YIJ 1;  5IT9 f;  4RVD A;  2O53 A;  2WB1 A;  3MON A;  3HOU I;  4NBC A;  3LUS A;  4QTU A;  4NH1 C;  4MON A;  1ZH1 A;  1QVF Z;  3CQZ I;  1M1K 1;  1YHQ 1;  5C3E I;  3QWU A;  1LQL A;  1QVF Y;  4RV9 A;  3CCM Z;  4NB8 A;  3CMA 1;  2HF1 A;  4NBE A;  3VMG A;  1Z02 A;  2KPI A;  5CM2 M;  1KD1 2;  1S72 1;  2EGT A;  1VQ5 1;  4NBH A;  3GKQ A;  4E2Y A;  3P5J B;  1RO4 A;  3MZK B;  3VTN A;  1K83 I;  2BJO A;  3HOX I;  4A3C I;  3I4M I;  1ZB9 A;  5C4J I;  4HH4 A;  1X3W A;  2OZK A;  3HKZ A;  4NOZ A;  3PO3 S;  2J6A A;  1TWG I;  4EWC A;  4MD7 A;  4A3E I;  4E33 A;  2JS4 A;  2E2I I;  2JMO A;  4NB9 A;  3CCS Z;  3PO2 I;  1KC8 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...