4A3EI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI02
3ESWA 2NVTI 3RZOI 3GTPI 4Y7NI 3GCFA 4NB8A 3HOXI 4BY7I 1TFIA 5IP9I 3GTGI 4BBRI 2PK7A 4NBBA 3Q87A 1TWCI 3FKII 3GTMI 2RBLA 2R93I 2JA8I 4NBDA 4A3KI 4A3GI 1SFOI 1LQLA 4BBSI 3GTMS 3D6WA 4X6AI 4MH4A 3HOYI 3H0GI 4NBCA 2YU9I 2JR6A 1Y1VS 4QTUA 4NBEA 4QTTA 4A3MI 3VMGA 2NVYI 1ML8A 1Y1VI 2K5RA 5FLMI 4A93I 2NVQI 2DE5A 3H3VJ 1R9TI 4Y52I 1YUAA 3S1QI 2R92I 2E2JI 2VUMI 1N2FA 3HOVI 1I3QI 3EERA 2F4MA 2BJOA 2P3YA 3HOZI 1ZB9A 3HOWI 4A3BI 4A3DI 3RZDI 3GTLI 3S1NI 3M4OI 1WCMI 3LUSA 3HOUI 1L1OC 1VLAA 4A3EI 3VB9A 3I4NI 2F4OA 1QYPA 3S2DI 3VMIA 1Y1WI 1I50I 3PO3I 5C4JI 1X3WA 4XX2A 3S17I 2R7ZI 1ZB8A 2JA7I 4A3CI 1DL6A 3VMHA 3PO3S 3GTKI 2E2HI 3S2HI 2DE7A 3GTJI 4NBGA 2AKLA 2B63I 3M3YI 2KPIA 4A3II 2HF1A 4A3FI 1TWFI 3U50C 1TWHI 2DE6A 4NBAA 4BXXI 1USPA 2J6AA 3GKQA 3I07A 2JA5I 3PO2I 1X3ZA 4BY1I 2E2II 2JA6I 4A3LI 2JNYA 2NVXI 3S1RI 1PFTA 1USPB 1I6HI 1NUIA 3S1MI 3K7AI 1TWGI 5C4XI 2JS4A 3S15I 4NOZA 4NBHA 4NBFA 1K83I 5CM2M 5C44I 1RLYA 3GTOI 3S16I 3CQZI 5C3EI 1RO4A 3I4MI 4A3JI 1TWAI 1WW9A 3S14I 4NB9A 5IP7I 3GTQI
chains in the Genus database with same CATH superfamily
2NVTI 3RZOI 4DK1A 2E9HA 1VQM1 3GCFA 4NB8A 3HOXI 4BY7I 5IP9I 2OZKA 4NBBA 5AN9F 3IFUA 5T64A 4MD8A 1W2BY 4A3GI 1VQ7Z 3CMEZ 4BBSI 3GTMS 3D6WA 2Y0SA 4X6AI 1FDIA 4MH4A 1YHQZ 2PM9A 1VQK1 2YU9I 3I56Z 4RVFA 4QTTA 4A3MI 1X0TA 2NVYI 1Y1VI 2QEXZ 3CCVZ 3CCMZ 5FLMI 2NVQI 3IX0A 2DE5A 3CCR1 2PMZA 2QREB 1VQKZ 3CCQZ 1WIIA 1N2FA 4E32A 3G6E1 2RT9A 1QF8A 4E30A 1QVGZ 3J81f 2P3YA 2QA4Z 3HOZI 3HOWI 1VQ8Z 4A3DI 3RZDI 3GTLI 3J80f 1JWHC 3HOUI 1L1OC 2Q4ZA 2OOXB 4A3EI 1RO0A 5D1OB 2QR1B 3S2DI 3VMIA 1VQ5Z 3QWUA 3MZLB 1Y1WI 2VPYA 3CC41 3CCM1 2WB1A 3CC7Z 3CPWY 5D1OA 3FQMA 2JMOA 3CPWZ 3M3YI 2VPZA 1K732 1KD12 3J7A4 1TWFI 3U50C 4BXXI 2J6AA 5IT9f 1Q821 3GKQA 3I07A 1X3ZA 5FLXf 1KQSY 2AYDA 2M48A 5T6BA 1USPB 4DGLA 2NAPA 2KI7B 5C4XI 3VTNA 4NBFA 2IZ3A 5CM2M 2GTHA 3CQZI 1RO4A 1RNIA 1QXFA 3CXCY 2HU9A 3CMAZ 1Q812 1TWAI 3EEDA 1KRLA 3ESWA 2QA41 3G71Z 3OW2Z 3CCJZ 3HKZA 1TFIA 3OW2Y 3GTGI 2OOYB 3FKII 1Q811 3CMA1 4NBDA 3JAMf 1KD11 1YI2Z 3CCUZ 1VQ61 1YJNZ 2JR6A 1RQFA 2VF1A 4MONA 3KIHA 1ML8A 2O4HA 1YJWZ 4EWCA 3IR7A 4E2XA 1KC82 2VUGA 3D2LA 3CCU1 2VPWA 1R9TI 1K731 4Y52I 1YUAA 2JIRA 2E2JI 1VQ41 2W04A 2F4MA 2BJOA 2H85A 3D9XA 3S1NI 1M901 1WCMI 3LUSA 4HGYA 1VLAA 2QRDB 3VB9A 1JJ2Y 2K3RA 1QYPA 1I50I 1YI21 2OTLZ 1X3WA 4XX2A 1AA6A 1NP6A 1YUKA 2LIYA 3PO3S 2OTJZ 3TDHB 2DE7A 3GTJI 2G2KA 1Y8CA 4NBGA 3CD6Z 1N8R1 2W03A 3CC21 2VPXA 2P28A 2DE6A 4NFRA 4E2YA 2JA5I 3PO2I 2E2II 1M1K1 4A3LI 2IV2X 2E7ZA 3S1MI 1YJW1 4MRIA 4NOZA 4NBHA 2JUBA 3NDJA 5C44I 1RLYA 3KIFA 1RO2A 2V8KA 2QKDA 3G4S1 1WW9A 3S14I 2JIMA 3CD61 2IZ4A 3GTPI 2V8JA 4BBRI 1K9M2 1NJI1 3CCE1 3Q87A 1TWCI 4MXUA 2LFUA 3GTMI 1N8R2 3I561 1SFOI 4CL1A 1VQ91 5IT9b 2QEX1 3H0GI 4NBCA 1ZH1A 1Y1VS 3CCV1 1VQLZ 1M1K2 4E31A 1FDOA 4E33A 2EGTA 3VMGA 1YIT1 1YJN1 2GU2A 3CCQ1 2JIOA 4A93I 2RHBA 2I3CA 3G6EZ 4NH1C 3NDIA 1KQSZ 3H3VJ 1VQ6Z 2R92I 2VUMI 1VQ81 1I3QI 1Z03A 2JIQA 3EERA 3NFZA 1VQO1 2QRCB 3M4OI 1Q862 3J81b 1S7MA 2F4OA 3G4SZ 2V8IA 4RVHA 1Z01A 2RIQA 3CCLZ 5FLXb 5C4JI 1WJ2A 2QLVB 2JA7I 1YIJ1 1DL6A 1M902 1K9M1 1Q861 1Z02A 2V3VA 2E2HI 1YITZ 2AKLA 2B63I 3NH8A 1VQ4Z 1KC81 1TWHI 3I55Z 4NBAA 5D1PA 3TE5B 2JA6I 1YJ9Z 2JNYA 3S1RI 1PFTA 5T67A 1VQNZ 3K7AI 3P5JB 1VQMZ 2JS4A 3S15I 1QVGY 4RV9A 3FQQA 5C3EI 4MD9A 4RVDA 3I4MI 1Q16A 1VQ71 4A3JI 2OTJ1 5IP7I 1VQP1 3CC2Z 4Y7NI 5LL6f 1YIJZ 2LEXA 2PK7A 4S1TA 3G711 2RBLA 2R93I 2WAQA 2JA8I 4DQYB 4A3KI 1LQLA 4HGZA 3JAMb 3I551 3HOYI 4RVGA 1P9NA 4QTUA 4NBEA 4TNUA 2ZAEB 1K8A1 3CCEZ 1S72Z 2RPRA 2K5RA 2R6MA 1VQL1 3CC4Z 3CC71 3BG1B 1VQPZ 1VQ9Z 3BG0B 3NH5A 3S1QI 2M6NA 4RS4A 1Q822 2V45A 1JJ2Z 3HOVI 3CXCZ 3CCSZ 1ZB9A 4A3BI 1S721 1W2BZ 1VQ51 2OTL1 3I4NI 1SIWA 3F3FC 1Q7Y1 3PO3I 3S17I 2R7ZI 2JIPA 1ZB8A 1VQOZ 2YADA 5A2Qb 4HH4A 4A3CI 3VMHA 3GTKI 3S2HI 4MD7A 2O53A 2KPIA 3CCJ1 2HF1A 4A3II 4A3FI 4AYBA 1NJI2 3CME1 3MONA 2Q51A 1USPA 1Q7Y2 3F3PC 1YHQ1 3MZKB 4BY1I 2NVXI 2GTIA 1QVFZ 5A2Qf 1I6HI 3CCS1 1NUIA 4E2WA 1TWGI 1QVFY 1YJ91 3NH4A 3J80b 1K8A2 1K83I 3GTOI 3CCL1 3S16I 1VQN1 1WZNA 3CCRZ 3IF8A 4E2ZA 3T4NB 4NB9A 3GTQI
chains in the Genus database with same CATH topology
2NVTI 3RZOI 4DK1A 2E9HA 1VQM1 3GCFA 4NB8A 3HOXI 4BY7I 5IP9I 2OZKA 4NBBA 5AN9F 3IFUA 5T64A 4MD8A 1W2BY 4A3GI 1VQ7Z 3CMEZ 4BBSI 3GTMS 3D6WA 2Y0SA 4X6AI 4MH4A 1YHQZ 2PM9A 1VQK1 2YU9I 3I56Z 4RVFA 4QTTA 4A3MI 1X0TA 2NVYI 1Y1VI 2QEXZ 3CCVZ 3CCMZ 5FLMI 2NVQI 3IX0A 2DE5A 3CCR1 2PMZA 2QREB 1VQKZ 3CCQZ 1WIIA 1N2FA 4E32A 3G6E1 2RT9A 1QF8A 4E30A 1QVGZ 3J81f 2P3YA 2QA4Z 3HOZI 3HOWI 1VQ8Z 4A3DI 3RZDI 3GTLI 3J80f 1JWHC 3HOUI 1L1OC 2Q4ZA 2OOXB 4A3EI 1RO0A 5D1OB 2QR1B 3S2DI 3VMIA 1VQ5Z 3QWUA 3MZLB 1Y1WI 3CC41 3CCM1 2WB1A 3CC7Z 3CPWY 5D1OA 3FQMA 2JMOA 3CPWZ 3M3YI 1K732 1KD12 3J7A4 1TWFI 3U50C 4BXXI 2J6AA 5IT9f 1Q821 3GKQA 3I07A 1X3ZA 5FLXf 1KQSY 2M48A 5T6BA 1USPB 4DGLA 2KI7B 5C4XI 3VTNA 4NBFA 2IZ3A 5CM2M 2GTHA 3CQZI 1RO4A 1RNIA 3CXCY 2HU9A 3CMAZ 1Q812 1TWAI 3EEDA 1KRLA 3ESWA 2QA41 3G71Z 3OW2Z 3CCJZ 3HKZA 1TFIA 3OW2Y 3GTGI 2OOYB 3FKII 1Q811 3CMA1 4NBDA 3JAMf 1KD11 1YI2Z 3CCUZ 1VQ61 1YJNZ 2JR6A 1RQFA 2VF1A 4MONA 3KIHA 1ML8A 2O4HA 1YJWZ 4EWCA 4E2XA 1KC82 2VUGA 3CCU1 1R9TI 1K731 4Y52I 1YUAA 2E2JI 1VQ41 2W04A 2F4MA 2BJOA 2H85A 3D9XA 3S1NI 1M901 1WCMI 3LUSA 4HGYA 1VLAA 2QRDB 3VB9A 1JJ2Y 2K3RA 1QYPA 1I50I 1YI21 2OTLZ 1X3WA 4XX2A 1NP6A 1YUKA 2LIYA 3PO3S 2OTJZ 3TDHB 2DE7A 3GTJI 2G2KA 4NBGA 3CD6Z 1N8R1 2W03A 3CC21 2P28A 2DE6A 4NFRA 4E2YA 2JA5I 3PO2I 2E2II 1M1K1 4A3LI 3S1MI 1YJW1 4MRIA 4NOZA 4NBHA 2JUBA 3NDJA 5C44I 1RLYA 3KIFA 1RO2A 2V8KA 2QKDA 3G4S1 1WW9A 3S14I 3CD61 2IZ4A 3GTPI 2V8JA 4BBRI 1K9M2 1NJI1 3CCE1 3Q87A 1TWCI 4MXUA 2LFUA 3GTMI 1N8R2 3I561 1SFOI 4CL1A 1VQ91 5IT9b 2QEX1 3H0GI 4NBCA 1ZH1A 1Y1VS 3CCV1 1VQLZ 1M1K2 4E31A 4E33A 2EGTA 3VMGA 1YIT1 1YJN1 2GU2A 3CCQ1 4A93I 2RHBA 2I3CA 3G6EZ 4NH1C 3NDIA 1KQSZ 3H3VJ 1VQ6Z 2R92I 2VUMI 1VQ81 1I3QI 1Z03A 3EERA 3NFZA 1VQO1 2QRCB 3M4OI 1Q862 3J81b 1S7MA 2F4OA 3G4SZ 2V8IA 4RVHA 1Z01A 2RIQA 3CCLZ 5FLXb 5C4JI 2QLVB 2JA7I 1YIJ1 1DL6A 1M902 1K9M1 1Q861 1Z02A 2E2HI 1YITZ 2AKLA 2B63I 3NH8A 1VQ4Z 1KC81 1TWHI 3I55Z 4NBAA 5D1PA 3TE5B 2JA6I 1YJ9Z 2JNYA 3S1RI 1PFTA 5T67A 1VQNZ 3K7AI 3P5JB 1VQMZ 2JS4A 3S15I 1QVGY 4RV9A 3FQQA 5C3EI 4MD9A 4RVDA 3I4MI 1VQ71 4A3JI 2OTJ1 5IP7I 1VQP1 3CC2Z 4Y7NI 5LL6f 1YIJZ 2PK7A 4S1TA 3G711 2RBLA 2R93I 2WAQA 2JA8I 4DQYB 4A3KI 1LQLA 4HGZA 3JAMb 3I551 3HOYI 4RVGA 1P9NA 4QTUA 4NBEA 4TNUA 2ZAEB 1K8A1 3CCEZ 1S72Z 2RPRA 2K5RA 2R6MA 1VQL1 3CC4Z 3CC71 3BG1B 1VQPZ 1VQ9Z 3BG0B 3NH5A 3S1QI 2M6NA 4RS4A 1Q822 1JJ2Z 3HOVI 3CXCZ 3CCSZ 1ZB9A 4A3BI 1S721 1W2BZ 1VQ51 2OTL1 3I4NI 3F3FC 1Q7Y1 3PO3I 3S17I 2R7ZI 1ZB8A 1VQOZ 2YADA 5A2Qb 4HH4A 4A3CI 3VMHA 3GTKI 3S2HI 4MD7A 2O53A 2KPIA 3CCJ1 2HF1A 4A3II 4A3FI 4AYBA 1NJI2 3CME1 3MONA 2Q51A 1USPA 1Q7Y2 3F3PC 1YHQ1 3MZKB 4BY1I 2NVXI 2GTIA 1QVFZ 5A2Qf 1I6HI 3CCS1 1NUIA 4E2WA 1TWGI 1QVFY 1YJ91 3NH4A 3J80b 1K8A2 1K83I 3GTOI 3CCL1 3S16I 1VQN1 3CCRZ 3IF8A 4E2ZA 3T4NB 4NB9A 3GTQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESW A;  2NVT I;  3RZO I;  3GTP I;  4Y7N I;  3GCF A;  4NB8 A;  3HOX I;  4BY7 I;  1TFI A;  5IP9 I;  3GTG I;  4BBR I;  2PK7 A;  4NBB A;  3Q87 A;  1TWC I;  3FKI I;  3GTM I;  2RBL A;  2R93 I;  2JA8 I;  4NBD A;  4A3K I;  4A3G I;  1SFO I;  1LQL A;  4BBS I;  3GTM S;  3D6W A;  4X6A I;  4MH4 A;  3HOY I;  3H0G I;  4NBC A;  2YU9 I;  2JR6 A;  1Y1V S;  4QTU A;  4NBE A;  4QTT A;  4A3M I;  3VMG A;  2NVY I;  1ML8 A;  1Y1V I;  2K5R A;  5FLM I;  4A93 I;  2NVQ I;  2DE5 A;  3H3V J;  1R9T I;  4Y52 I;  1YUA A;  3S1Q I;  2R92 I;  2E2J I;  2VUM I;  1N2F A;  3HOV I;  1I3Q I;  3EER A;  2F4M A;  2BJO A;  2P3Y A;  3HOZ I;  1ZB9 A;  3HOW I;  4A3B I;  4A3D I;  3RZD I;  3GTL I;  3S1N I;  3M4O I;  1WCM I;  3LUS A;  3HOU I;  1L1O C;  1VLA A;  4A3E I;  3VB9 A;  3I4N I;  2F4O A;  1QYP A;  3S2D I;  3VMI A;  1Y1W I;  1I50 I;  3PO3 I;  5C4J I;  1X3W A;  4XX2 A;  3S17 I;  2R7Z I;  1ZB8 A;  2JA7 I;  4A3C I;  1DL6 A;  3VMH A;  3PO3 S;  3GTK I;  2E2H I;  3S2H I;  2DE7 A;  3GTJ I;  4NBG A;  2AKL A;  2B63 I;  3M3Y I;  2KPI A;  4A3I I;  2HF1 A;  4A3F I;  1TWF I;  3U50 C;  1TWH I;  2DE6 A;  4NBA A;  4BXX I;  1USP A;  2J6A A;  3GKQ A;  3I07 A;  2JA5 I;  3PO2 I;  1X3Z A;  4BY1 I;  2E2I I;  2JA6 I;  4A3L I;  2JNY A;  2NVX I;  3S1R I;  1PFT A;  1USP B;  1I6H I;  1NUI A;  3S1M I;  3K7A I;  1TWG I;  5C4X I;  2JS4 A;  3S15 I;  4NOZ A;  4NBH A;  4NBF A;  1K83 I;  5CM2 M;  5C44 I;  1RLY A;  3GTO I;  3S16 I;  3CQZ I;  5C3E I;  1RO4 A;  3I4M I;  4A3J I;  1TWA I;  1WW9 A;  3S14 I;  4NB9 A;  5IP7 I;  3GTQ I; 
#chains in the Genus database with same CATH topology
 2NVT I;  3RZO I;  4DK1 A;  2E9H A;  1VQM 1;  3GCF A;  4NB8 A;  3HOX I;  4BY7 I;  5IP9 I;  2OZK A;  4NBB A;  5AN9 F;  3IFU A;  5T64 A;  4MD8 A;  1W2B Y;  4A3G I;  1VQ7 Z;  3CME Z;  4BBS I;  3GTM S;  3D6W A;  2Y0S A;  4X6A I;  1FDI A;  4MH4 A;  1YHQ Z;  2PM9 A;  1VQK 1;  2YU9 I;  3I56 Z;  4RVF A;  4QTT A;  4A3M I;  1X0T A;  2NVY I;  1Y1V I;  2QEX Z;  3CCV Z;  3CCM Z;  5FLM I;  2NVQ I;  3IX0 A;  2DE5 A;  3CCR 1;  2PMZ A;  2QRE B;  1VQK Z;  3CCQ Z;  1WII A;  1N2F A;  4E32 A;  3G6E 1;  2RT9 A;  1QF8 A;  4E30 A;  1QVG Z;  3J81 f;  2P3Y A;  2QA4 Z;  3HOZ I;  3HOW I;  1VQ8 Z;  4A3D I;  3RZD I;  3GTL I;  3J80 f;  1JWH C;  3HOU I;  1L1O C;  2Q4Z A;  2OOX B;  4A3E I;  1RO0 A;  5D1O B;  2QR1 B;  3S2D I;  3VMI A;  1VQ5 Z;  3QWU A;  3MZL B;  1Y1W I;  2VPY A;  3CC4 1;  3CCM 1;  2WB1 A;  3CC7 Z;  3CPW Y;  5D1O A;  3FQM A;  2JMO A;  3CPW Z;  3M3Y I;  2VPZ A;  1K73 2;  1KD1 2;  3J7A 4;  1TWF I;  3U50 C;  4BXX I;  2J6A A;  5IT9 f;  1Q82 1;  3GKQ A;  3I07 A;  1X3Z A;  5FLX f;  1KQS Y;  2AYD A;  2M48 A;  5T6B A;  1USP B;  4DGL A;  2NAP A;  2KI7 B;  5C4X I;  3VTN A;  4NBF A;  2IZ3 A;  5CM2 M;  2GTH A;  3CQZ I;  1RO4 A;  1RNI A;  1QXF A;  3CXC Y;  2HU9 A;  3CMA Z;  1Q81 2;  1TWA I;  3EED A;  1KRL A;  3ESW A;  2QA4 1;  3G71 Z;  3OW2 Z;  3CCJ Z;  3HKZ A;  1TFI A;  3OW2 Y;  3GTG I;  2OOY B;  3FKI I;  1Q81 1;  3CMA 1;  4NBD A;  3JAM f;  1KD1 1;  1YI2 Z;  3CCU Z;  1VQ6 1;  1YJN Z;  2JR6 A;  1RQF A;  2VF1 A;  4MON A;  3KIH A;  1ML8 A;  2O4H A;  1YJW Z;  4EWC A;  3IR7 A;  4E2X A;  1KC8 2;  2VUG A;  3D2L A;  3CCU 1;  2VPW A;  1R9T I;  1K73 1;  4Y52 I;  1YUA A;  2JIR A;  2E2J I;  1VQ4 1;  2W04 A;  2F4M A;  2BJO A;  2H85 A;  3D9X A;  3S1N I;  1M90 1;  1WCM I;  3LUS A;  4HGY A;  1VLA A;  2QRD B;  3VB9 A;  1JJ2 Y;  2K3R A;  1QYP A;  1I50 I;  1YI2 1;  2OTL Z;  1X3W A;  4XX2 A;  1AA6 A;  1NP6 A;  1YUK A;  2LIY A;  3PO3 S;  2OTJ Z;  3TDH B;  2DE7 A;  3GTJ I;  2G2K A;  1Y8C A;  4NBG A;  3CD6 Z;  1N8R 1;  2W03 A;  3CC2 1;  2VPX A;  2P28 A;  2DE6 A;  4NFR A;  4E2Y A;  2JA5 I;  3PO2 I;  2E2I I;  1M1K 1;  4A3L I;  2IV2 X;  2E7Z A;  3S1M I;  1YJW 1;  4MRI A;  4NOZ A;  4NBH A;  2JUB A;  3NDJ A;  5C44 I;  1RLY A;  3KIF A;  1RO2 A;  2V8K A;  2QKD A;  3G4S 1;  1WW9 A;  3S14 I;  2JIM A;  3CD6 1;  2IZ4 A;  3GTP I;  2V8J A;  4BBR I;  1K9M 2;  1NJI 1;  3CCE 1;  3Q87 A;  1TWC I;  4MXU A;  2LFU A;  3GTM I;  1N8R 2;  3I56 1;  1SFO I;  4CL1 A;  1VQ9 1;  5IT9 b;  2QEX 1;  3H0G I;  4NBC A;  1ZH1 A;  1Y1V S;  3CCV 1;  1VQL Z;  1M1K 2;  4E31 A;  1FDO A;  4E33 A;  2EGT A;  3VMG A;  1YIT 1;  1YJN 1;  2GU2 A;  3CCQ 1;  2JIO A;  4A93 I;  2RHB A;  2I3C A;  3G6E Z;  4NH1 C;  3NDI A;  1KQS Z;  3H3V J;  1VQ6 Z;  2R92 I;  2VUM I;  1VQ8 1;  1I3Q I;  1Z03 A;  2JIQ A;  3EER A;  3NFZ A;  1VQO 1;  2QRC B;  3M4O I;  1Q86 2;  3J81 b;  1S7M A;  2F4O A;  3G4S Z;  2V8I A;  4RVH A;  1Z01 A;  2RIQ A;  3CCL Z;  5FLX b;  5C4J I;  1WJ2 A;  2QLV B;  2JA7 I;  1YIJ 1;  1DL6 A;  1M90 2;  1K9M 1;  1Q86 1;  1Z02 A;  2V3V A;  2E2H I;  1YIT Z;  2AKL A;  2B63 I;  3NH8 A;  1VQ4 Z;  1KC8 1;  1TWH I;  3I55 Z;  4NBA A;  5D1P A;  3TE5 B;  2JA6 I;  1YJ9 Z;  2JNY A;  3S1R I;  1PFT A;  5T67 A;  1VQN Z;  3K7A I;  3P5J B;  1VQM Z;  2JS4 A;  3S15 I;  1QVG Y;  4RV9 A;  3FQQ A;  5C3E I;  4MD9 A;  4RVD A;  3I4M I;  1Q16 A;  1VQ7 1;  4A3J I;  2OTJ 1;  5IP7 I;  1VQP 1;  3CC2 Z;  4Y7N I;  5LL6 f;  1YIJ Z;  2LEX A;  2PK7 A;  4S1T A;  3G71 1;  2RBL A;  2R93 I;  2WAQ A;  2JA8 I;  4DQY B;  4A3K I;  1LQL A;  4HGZ A;  3JAM b;  3I55 1;  3HOY I;  4RVG A;  1P9N A;  4QTU A;  4NBE A;  4TNU A;  2ZAE B;  1K8A 1;  3CCE Z;  1S72 Z;  2RPR A;  2K5R A;  2R6M A;  1VQL 1;  3CC4 Z;  3CC7 1;  3BG1 B;  1VQP Z;  1VQ9 Z;  3BG0 B;  3NH5 A;  3S1Q I;  2M6N A;  4RS4 A;  1Q82 2;  2V45 A;  1JJ2 Z;  3HOV I;  3CXC Z;  3CCS Z;  1ZB9 A;  4A3B I;  1S72 1;  1W2B Z;  1VQ5 1;  2OTL 1;  3I4N I;  1SIW A;  3F3F C;  1Q7Y 1;  3PO3 I;  3S17 I;  2R7Z I;  2JIP A;  1ZB8 A;  1VQO Z;  2YAD A;  5A2Q b;  4HH4 A;  4A3C I;  3VMH A;  3GTK I;  3S2H I;  4MD7 A;  2O53 A;  2KPI A;  3CCJ 1;  2HF1 A;  4A3I I;  4A3F I;  4AYB A;  1NJI 2;  3CME 1;  3MON A;  2Q51 A;  1USP A;  1Q7Y 2;  3F3P C;  1YHQ 1;  3MZK B;  4BY1 I;  2NVX I;  2GTI A;  1QVF Z;  5A2Q f;  1I6H I;  3CCS 1;  1NUI A;  4E2W A;  1TWG I;  1QVF Y;  1YJ9 1;  3NH4 A;  3J80 b;  1K8A 2;  1K83 I;  3GTO I;  3CCL 1;  3S16 I;  1VQN 1;  1WZN A;  3CCR Z;  3IF8 A;  4E2Z A;  3T4N B;  4NB9 A;  3GTQ I; 
#chains in the Genus database with same CATH homology
 2NVT I;  3RZO I;  4DK1 A;  2E9H A;  1VQM 1;  3GCF A;  4NB8 A;  3HOX I;  4BY7 I;  5IP9 I;  2OZK A;  4NBB A;  5AN9 F;  3IFU A;  5T64 A;  4MD8 A;  1W2B Y;  4A3G I;  1VQ7 Z;  3CME Z;  4BBS I;  3GTM S;  3D6W A;  2Y0S A;  4X6A I;  4MH4 A;  1YHQ Z;  2PM9 A;  1VQK 1;  2YU9 I;  3I56 Z;  4RVF A;  4QTT A;  4A3M I;  1X0T A;  2NVY I;  1Y1V I;  2QEX Z;  3CCV Z;  3CCM Z;  5FLM I;  2NVQ I;  3IX0 A;  2DE5 A;  3CCR 1;  2PMZ A;  2QRE B;  1VQK Z;  3CCQ Z;  1WII A;  1N2F A;  4E32 A;  3G6E 1;  2RT9 A;  1QF8 A;  4E30 A;  1QVG Z;  3J81 f;  2P3Y A;  2QA4 Z;  3HOZ I;  3HOW I;  1VQ8 Z;  4A3D I;  3RZD I;  3GTL I;  3J80 f;  1JWH C;  3HOU I;  1L1O C;  2Q4Z A;  2OOX B;  4A3E I;  1RO0 A;  5D1O B;  2QR1 B;  3S2D I;  3VMI A;  1VQ5 Z;  3QWU A;  3MZL B;  1Y1W I;  3CC4 1;  3CCM 1;  2WB1 A;  3CC7 Z;  3CPW Y;  5D1O A;  3FQM A;  2JMO A;  3CPW Z;  3M3Y I;  1K73 2;  1KD1 2;  3J7A 4;  1TWF I;  3U50 C;  4BXX I;  2J6A A;  5IT9 f;  1Q82 1;  3GKQ A;  3I07 A;  1X3Z A;  5FLX f;  1KQS Y;  2M48 A;  5T6B A;  1USP B;  4DGL A;  2KI7 B;  5C4X I;  3VTN A;  4NBF A;  2IZ3 A;  5CM2 M;  2GTH A;  3CQZ I;  1RO4 A;  1RNI A;  3CXC Y;  2HU9 A;  3CMA Z;  1Q81 2;  1TWA I;  3EED A;  1KRL A;  3ESW A;  2QA4 1;  3G71 Z;  3OW2 Z;  3CCJ Z;  3HKZ A;  1TFI A;  3OW2 Y;  3GTG I;  2OOY B;  3FKI I;  1Q81 1;  3CMA 1;  4NBD A;  3JAM f;  1KD1 1;  1YI2 Z;  3CCU Z;  1VQ6 1;  1YJN Z;  2JR6 A;  1RQF A;  2VF1 A;  4MON A;  3KIH A;  1ML8 A;  2O4H A;  1YJW Z;  4EWC A;  4E2X A;  1KC8 2;  2VUG A;  3CCU 1;  1R9T I;  1K73 1;  4Y52 I;  1YUA A;  2E2J I;  1VQ4 1;  2W04 A;  2F4M A;  2BJO A;  2H85 A;  3D9X A;  3S1N I;  1M90 1;  1WCM I;  3LUS A;  4HGY A;  1VLA A;  2QRD B;  3VB9 A;  1JJ2 Y;  2K3R A;  1QYP A;  1I50 I;  1YI2 1;  2OTL Z;  1X3W A;  4XX2 A;  1NP6 A;  1YUK A;  2LIY A;  3PO3 S;  2OTJ Z;  3TDH B;  2DE7 A;  3GTJ I;  2G2K A;  4NBG A;  3CD6 Z;  1N8R 1;  2W03 A;  3CC2 1;  2P28 A;  2DE6 A;  4NFR A;  4E2Y A;  2JA5 I;  3PO2 I;  2E2I I;  1M1K 1;  4A3L I;  3S1M I;  1YJW 1;  4MRI A;  4NOZ A;  4NBH A;  2JUB A;  3NDJ A;  5C44 I;  1RLY A;  3KIF A;  1RO2 A;  2V8K A;  2QKD A;  3G4S 1;  1WW9 A;  3S14 I;  3CD6 1;  2IZ4 A;  3GTP I;  2V8J A;  4BBR I;  1K9M 2;  1NJI 1;  3CCE 1;  3Q87 A;  1TWC I;  4MXU A;  2LFU A;  3GTM I;  1N8R 2;  3I56 1;  1SFO I;  4CL1 A;  1VQ9 1;  5IT9 b;  2QEX 1;  3H0G I;  4NBC A;  1ZH1 A;  1Y1V S;  3CCV 1;  1VQL Z;  1M1K 2;  4E31 A;  4E33 A;  2EGT A;  3VMG A;  1YIT 1;  1YJN 1;  2GU2 A;  3CCQ 1;  4A93 I;  2RHB A;  2I3C A;  3G6E Z;  4NH1 C;  3NDI A;  1KQS Z;  3H3V J;  1VQ6 Z;  2R92 I;  2VUM I;  1VQ8 1;  1I3Q I;  1Z03 A;  3EER A;  3NFZ A;  1VQO 1;  2QRC B;  3M4O I;  1Q86 2;  3J81 b;  1S7M A;  2F4O A;  3G4S Z;  2V8I A;  4RVH A;  1Z01 A;  2RIQ A;  3CCL Z;  5FLX b;  5C4J I;  2QLV B;  2JA7 I;  1YIJ 1;  1DL6 A;  1M90 2;  1K9M 1;  1Q86 1;  1Z02 A;  2E2H I;  1YIT Z;  2AKL A;  2B63 I;  3NH8 A;  1VQ4 Z;  1KC8 1;  1TWH I;  3I55 Z;  4NBA A;  5D1P A;  3TE5 B;  2JA6 I;  1YJ9 Z;  2JNY A;  3S1R I;  1PFT A;  5T67 A;  1VQN Z;  3K7A I;  3P5J B;  1VQM Z;  2JS4 A;  3S15 I;  1QVG Y;  4RV9 A;  3FQQ A;  5C3E I;  4MD9 A;  4RVD A;  3I4M I;  1VQ7 1;  4A3J I;  2OTJ 1;  5IP7 I;  1VQP 1;  3CC2 Z;  4Y7N I;  5LL6 f;  1YIJ Z;  2PK7 A;  4S1T A;  3G71 1;  2RBL A;  2R93 I;  2WAQ A;  2JA8 I;  4DQY B;  4A3K I;  1LQL A;  4HGZ A;  3JAM b;  3I55 1;  3HOY I;  4RVG A;  1P9N A;  4QTU A;  4NBE A;  4TNU A;  2ZAE B;  1K8A 1;  3CCE Z;  1S72 Z;  2RPR A;  2K5R A;  2R6M A;  1VQL 1;  3CC4 Z;  3CC7 1;  3BG1 B;  1VQP Z;  1VQ9 Z;  3BG0 B;  3NH5 A;  3S1Q I;  2M6N A;  4RS4 A;  1Q82 2;  1JJ2 Z;  3HOV I;  3CXC Z;  3CCS Z;  1ZB9 A;  4A3B I;  1S72 1;  1W2B Z;  1VQ5 1;  2OTL 1;  3I4N I;  3F3F C;  1Q7Y 1;  3PO3 I;  3S17 I;  2R7Z I;  1ZB8 A;  1VQO Z;  2YAD A;  5A2Q b;  4HH4 A;  4A3C I;  3VMH A;  3GTK I;  3S2H I;  4MD7 A;  2O53 A;  2KPI A;  3CCJ 1;  2HF1 A;  4A3I I;  4A3F I;  4AYB A;  1NJI 2;  3CME 1;  3MON A;  2Q51 A;  1USP A;  1Q7Y 2;  3F3P C;  1YHQ 1;  3MZK B;  4BY1 I;  2NVX I;  2GTI A;  1QVF Z;  5A2Q f;  1I6H I;  3CCS 1;  1NUI A;  4E2W A;  1TWG I;  1QVF Y;  1YJ9 1;  3NH4 A;  3J80 b;  1K8A 2;  1K83 I;  3GTO I;  3CCL 1;  3S16 I;  1VQN 1;  3CCR Z;  3IF8 A;  4E2Z A;  3T4N B;  4NB9 A;  3GTQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...