4A3EI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3eI02
1TFIA 3S1RI 2JA6I 4NBFA 4A3EI 3GTGI 3GTKI 3HOVI 2VUMI 3ESWA 3S16I 3S1QI 2B63I 3I07A 3PO3I 2F4MA 3M4OI 4A3JI 3I4NI 1L1OC 4BBRI 2JNYA 3H3VJ 4NBGA 4NBAA 3S15I 2R92I 5FLMI 2P3YA 1RO4A 5CM2M 3GTPI 1Y1VS 5C3EI 3RZOI 2R7ZI 4A3CI 3H0GI 4MH4A 1K83I 4NBDA 4QTTA 2JA7I 3VB9A 2NVTI 3GTMS 4Y7NI 1SFOI 4NBBA 2PK7A 1ML8A 2J6AA 3VMHA 2F4OA 5C44I 3LUSA 1I6HI 4A3LI 1USPA 1DL6A 2JA8I 4NB9A 1LQLA 4BY1I 3S17I 2AKLA 1I3QI 5IP9I 3GTOI 2NVQI 2JS4A 3S2HI 4A3GI 3HOUI 3I4MI 4NBEA 1NUIA 3GTLI 4A3MI 2KPIA 1QYPA 2YU9I 4Y52I 1USPB 1ZB8A 1N2FA 2RBLA 4BXXI 3S2DI 3HOYI 2K5RA 1Y1WI 2E2HI 4X6AI 3FKII 3K7AI 3S1MI 1I50I 1WW9A 3D6WA 4BBSI 1TWCI 1X3WA 4A3II 4QTUA 3VMIA 1TWHI 1ZB9A 2E2JI 1TWGI 4A93I 3Q87A 4A3FI 3S14I 4NBCA 1TWAI 1WCMI 1YUAA 2HF1A 1PFTA 2E2II 5IP7I 2DE6A 4NB8A 1RLYA 3PO3S 4NOZA 5C4JI 3GKQA 1X3ZA 3GCFA 5C4XI 2BJOA 3HOZI 3HOXI 3U50C 3RZDI 3EERA 2NVYI 4XX2A 2DE7A 3CQZI 1Y1VI 3GTQI 1VLAA 3S1NI 4A3KI 2JA5I 2DE5A 1TWFI 2JR6A 3VMGA 3PO2I 4A3DI 3M3YI 2NVXI 4BY7I 2R93I 3GTMI 4NBHA 3GTJI 1R9TI 3HOWI 4A3BI
chains in the Genus database with same CATH superfamily
3S1RI 4A3EI 3HOVI 2VUMI 1VQ51 4E2ZA 1VQO1 3I07A 4RVDA 2F4MA 3CC2Z 4A3JI 2JIOA 2V8IA 4NBGA 1RNIA 3RZOI 4MH4A 2HU9A 3CD6Z 2NVTI 4Y7NI 1SFOI 3CCSZ 1VQLZ 2F4OA 2Q51A 3LUSA 3CCR1 1M1K2 1I6HI 3CCLZ 1QVFZ 2JA8I 1VQN1 3S17I 4S1TA 4E30A 3IR7A 2NVQI 4HGZA 4TNUA 1QXFA 4E33A 3HOUI 4DGLA 4NBEA 1NUIA 1Q7Y1 1K732 2VPWA 1VQMZ 1VQM1 1YJN1 1USPB 2VPZA 4Y52I 1ZB8A 3CCJ1 1KQSY 3HOYI 1YHQ1 3J80b 2IV2X 1YHQZ 1YIJ1 4E2YA 3K7AI 2IZ3A 3S1MI 3EEDA 1WW9A 1TWCI 2JMOA 2RHBA 5AN9F 2JIPA 1ZB9A 2QLVB 1TWAI 1VQOZ 3D2LA 2HF1A 1M1K1 3G4S1 5C4JI 4EWCA 4HH4A 1S721 2IZ4A 3U50C 3JAMb 1Q811 2AYDA 1JWHC 4E2WA 1AA6A 2O53A 2OTJ1 3CPWZ 3S1NI 1K8A2 2LFUA 4RV9A 2LEXA 3J81f 2M6NA 2YADA 2JR6A 3CD61 3CMA1 3CC4Z 4MD9A 5D1PA 2R93I 2QKDA 1VQNZ 3CCRZ 3I55Z 1K731 3GTJI 2ZAEB 2OZKA 1NJI1 1KC82 2I3CA 3CCMZ 1VQ6Z 3I561 3CXCY 4MRIA 3J7A4 3F3PC 3GTKI 2QEX1 3CME1 5T67A 3ESWA 3S16I 1QVFY 3PO3I 2R6MA 4NH1C 2GU2A 4RVFA 3TDHB 3I4NI 2G2KA 2JNYA 1SIWA 1VQ71 3H3VJ 2Q4ZA 2R92I 1ZH1A 5CM2M 2OOYB 1VQP1 2JIMA 3GTPI 1KD11 5IT9f 2P28A 3H0GI 2E7ZA 1YITZ 3OW2Y 2JA7I 3GTMS 4NBBA 1M902 5D1OA 1Z03A 5FLXb 2W03A 2V3VA 1WIIA 3HKZA 3J80f 2OTL1 4A3LI 1RQFA 1DL6A 2EGTA 3CCM1 1QVGZ 3GTOI 4A3GI 1KC81 1NJI2 2YU9I 1N2FA 3KIHA 1JJ2Z 1Y1WI 2E2HI 3QWUA 5LL6f 4X6AI 1Q862 1S7MA 3FKII 4NFRA 3CCVZ 2VUGA 2QRCB 4A3II 4QTUA 3VMIA 1TWHI 2E2JI 2QEXZ 3FQMA 4A3FI 1Q822 1WCMI 4MONA 1YJW1 2PM9A 1N8R1 1Q7Y2 4NB8A 1RLYA 3PO3S 3NH8A 2JIQA 4NOZA 5T6BA 3GCFA 1Q861 2V8JA 1VQ7Z 3CCU1 2NVYI 5A2Qb 4XX2A 3G71Z 1YIT1 3CCUZ 3G711 3P5JB 1TWFI 2GTHA 3VMGA 3PO2I 3VTNA 4RVHA 3CC7Z 4HGYA 4NBHA 5IT9b 1R9TI 4DK1A 2WAQA 1W2BY 2Y0SA 4NBFA 2JA6I 5FLXf 3S1QI 2B63I 1VQKZ 2H85A 1YUKA 3M4OI 1L1OC 4BBRI 4NBAA 3I551 3S15I 5FLMI 3G6E1 2P3YA 3IF8A 5C3EI 3G6EZ 2R7ZI 2QR1B 1X0TA 3I56Z 1K83I 1K9M1 4NBDA 4QTTA 3VB9A 1KRLA 1VQ5Z 1ML8A 5C44I 2OTLZ 1USPA 4BY1I 1YIJZ 2AKLA 3OW2Z 1QVGY 2QREB 2JS4A 3S2HI 1WJ2A 3GTLI 3CCS1 4A3MI 2NAPA 2RPRA 1S72Z 2K3RA 2RIQA 1VQ8Z 5A2Qf 1VQ61 3CC71 4BBSI 1TWGI 3Q87A 2KI7B 1K9M2 5IP7I 3MZLB 3NFZA 3CCE1 3GKQA 1X3ZA 2RT9A 2BJOA 3CCEZ 5D1OB 3BG1B 1RO2A 1Q821 3EERA 3MONA 1P9NA 1VQ41 1N8R2 2JUBA 3CQZI 1Y1VI 3GTQI 1VLAA 1Z01A 4MD7A 2DE5A 1YJWZ 4A3DI 1RO0A 3CXCZ 1VQ91 3M3YI 4BY7I 3GTMI 1Y8CA 1Z02A 3CCQZ 4A3BI 2OTJZ 1KQSZ 3F3FC 1TFIA 1Q812 1W2BZ 1FDIA 4MXUA 2WB1A 1FDOA 4DQYB 1Q16A 3GTGI 2QA41 3CC41 3TE5B 2OOXB 2QA4Z 3G4SZ 1VQ4Z 3CCV1 1RO4A 2O4HA 5T64A 1Y1VS 4A3CI 4AYBA 3NDJA 4E32A 2PK7A 4MD8A 2J6AA 3VMHA 2V8KA 1YJNZ 1M901 3NDIA 2VF1A 3MZKB 2QRDB 4NB9A 1LQLA 1YJ9Z 1KD12 1VQPZ 1I3QI 5IP9I 3I4MI 3NH5A 3BG0B 4RVGA 3CPWY 2JIRA 2KPIA 3IFUA 3J81b 1QYPA 3FQQA 3CMEZ 1VQ9Z 2RBLA 4BXXI 3S2DI 2K5RA 1YI21 3NH4A 3CC21 1VQ81 1YI2Z 3CCQ1 1I50I 3D6WA 1X3WA 3D9XA 1WZNA 4A93I 3S14I 4NBCA 2LIYA 1YUAA 1PFTA 3CCL1 2E2II 3CMAZ 2DE6A 1VQL1 3IX0A 5C4XI 4RS4A 3HOZI 3T4NB 3HOXI 1JJ2Y 4E2XA 3RZDI 1K8A1 2PMZA 2DE7A 2VPYA 2V45A 1QF8A 4A3KI 2JA5I 4E31A 1NP6A 2E9HA 3CCJZ 2GTIA 4CL1A 3KIFA 2W04A 1VQK1 2NVXI 1YJ91 3JAMf 2VPXA 2M48A 3HOWI
chains in the Genus database with same CATH topology
3S1RI 4A3EI 3HOVI 2VUMI 1VQ51 4E2ZA 1VQO1 3I07A 4RVDA 2F4MA 3CC2Z 4A3JI 2V8IA 4NBGA 1RNIA 3RZOI 4MH4A 2HU9A 3CD6Z 2NVTI 4Y7NI 1SFOI 3CCSZ 1VQLZ 2F4OA 2Q51A 3LUSA 3CCR1 1M1K2 1I6HI 3CCLZ 1QVFZ 2JA8I 1VQN1 3S17I 4S1TA 4E30A 2NVQI 4HGZA 4TNUA 4E33A 3HOUI 4DGLA 4NBEA 1NUIA 1Q7Y1 1K732 1VQMZ 1VQM1 1YJN1 1USPB 4Y52I 1ZB8A 3CCJ1 1KQSY 3HOYI 1YHQ1 3J80b 1YHQZ 1YIJ1 4E2YA 3K7AI 2IZ3A 3S1MI 3EEDA 1WW9A 1TWCI 2JMOA 2RHBA 5AN9F 1ZB9A 2QLVB 1TWAI 1VQOZ 2HF1A 1M1K1 3G4S1 5C4JI 4EWCA 4HH4A 1S721 2IZ4A 3U50C 3JAMb 1Q811 1JWHC 4E2WA 2OTJ1 2O53A 3CPWZ 3S1NI 1K8A2 2LFUA 4RV9A 3J81f 2M6NA 2YADA 2JR6A 3CD61 3CMA1 3CC4Z 4MD9A 5D1PA 2R93I 2QKDA 1VQNZ 3CCRZ 3I55Z 1K731 3GTJI 2ZAEB 2OZKA 1NJI1 1KC82 2I3CA 3CCMZ 1VQ6Z 3I561 3CXCY 4MRIA 3J7A4 3F3PC 3GTKI 2QEX1 3CME1 5T67A 3ESWA 3S16I 1QVFY 3PO3I 2R6MA 4NH1C 2GU2A 4RVFA 3TDHB 3I4NI 2G2KA 2JNYA 1VQ71 3H3VJ 2Q4ZA 2R92I 1ZH1A 5CM2M 2OOYB 1VQP1 3GTPI 1KD11 5IT9f 2P28A 3H0GI 1YITZ 3OW2Y 2JA7I 3GTMS 4NBBA 1M902 5D1OA 1Z03A 5FLXb 2W03A 1WIIA 3HKZA 3J80f 2OTL1 4A3LI 1RQFA 1DL6A 2EGTA 3CCM1 1QVGZ 3GTOI 4A3GI 1KC81 1NJI2 2YU9I 1N2FA 3KIHA 1JJ2Z 1Y1WI 2E2HI 3QWUA 5LL6f 4X6AI 1Q862 1S7MA 3FKII 4NFRA 3CCVZ 2VUGA 2QRCB 4A3II 4QTUA 3VMIA 1TWHI 2E2JI 2QEXZ 3FQMA 4A3FI 1Q822 1WCMI 4MONA 1YJW1 2PM9A 1N8R1 1Q7Y2 4NB8A 1RLYA 3PO3S 3NH8A 4NOZA 5T6BA 3GCFA 1Q861 2V8JA 1VQ7Z 3CCU1 2NVYI 5A2Qb 4XX2A 3G71Z 1YIT1 3CCUZ 3G711 3P5JB 1TWFI 2GTHA 3VMGA 3PO2I 3VTNA 4RVHA 3CC7Z 4HGYA 4NBHA 5IT9b 1R9TI 4DK1A 2WAQA 1W2BY 2Y0SA 4NBFA 2JA6I 5FLXf 3S1QI 2B63I 1VQKZ 2H85A 1YUKA 3M4OI 1L1OC 4BBRI 4NBAA 3I551 3S15I 5FLMI 3G6E1 2P3YA 3IF8A 5C3EI 3G6EZ 2R7ZI 2QR1B 1X0TA 3I56Z 1K83I 1K9M1 4NBDA 4QTTA 3VB9A 1KRLA 1VQ5Z 1ML8A 5C44I 2OTLZ 1USPA 4BY1I 1YIJZ 2AKLA 3OW2Z 1QVGY 2QREB 2JS4A 3S2HI 3GTLI 3CCS1 4A3MI 2RPRA 1S72Z 2K3RA 2RIQA 1VQ8Z 5A2Qf 1VQ61 3CC71 4BBSI 1TWGI 3Q87A 2KI7B 1K9M2 5IP7I 3MZLB 3NFZA 3CCE1 3GKQA 1X3ZA 2RT9A 2BJOA 3CCEZ 5D1OB 3BG1B 1RO2A 1Q821 3EERA 3MONA 1P9NA 1VQ41 1N8R2 2JUBA 3CQZI 1Y1VI 3GTQI 1VLAA 1Z01A 4MD7A 2DE5A 1YJWZ 4A3DI 1RO0A 3CXCZ 1VQ91 3M3YI 4BY7I 3GTMI 1Z02A 3CCQZ 4A3BI 2OTJZ 1KQSZ 1Q812 1TFIA 3F3FC 1W2BZ 4MXUA 2WB1A 4DQYB 3GTGI 2QA41 3CC41 3TE5B 2OOXB 2QA4Z 3G4SZ 1VQ4Z 3CCV1 1RO4A 2O4HA 5T64A 1Y1VS 4A3CI 4AYBA 3NDJA 4E32A 2PK7A 4MD8A 2J6AA 3VMHA 2V8KA 1YJNZ 1M901 3NDIA 2VF1A 3MZKB 2QRDB 4NB9A 1LQLA 1YJ9Z 1KD12 1VQPZ 1I3QI 5IP9I 3I4MI 3NH5A 3BG0B 4RVGA 3CPWY 2KPIA 3IFUA 3J81b 1QYPA 3FQQA 3CMEZ 1VQ9Z 2RBLA 4BXXI 3S2DI 2K5RA 1YI21 3NH4A 3CC21 1VQ81 1YI2Z 3CCQ1 1I50I 3D6WA 1X3WA 3D9XA 4A93I 3S14I 4NBCA 2LIYA 1YUAA 1PFTA 3CCL1 2E2II 3CMAZ 2DE6A 1VQL1 3IX0A 5C4XI 4RS4A 3HOZI 3T4NB 3HOXI 1JJ2Y 4E2XA 3RZDI 1K8A1 2PMZA 2DE7A 1QF8A 4A3KI 2JA5I 4E31A 1NP6A 2E9HA 3CCJZ 2GTIA 4CL1A 3KIFA 2W04A 1VQK1 2NVXI 1YJ91 3JAMf 2M48A 3HOWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFI A;  3S1R I;  2JA6 I;  4NBF A;  4A3E I;  3GTG I;  3GTK I;  3HOV I;  2VUM I;  3ESW A;  3S16 I;  3S1Q I;  2B63 I;  3I07 A;  3PO3 I;  2F4M A;  3M4O I;  4A3J I;  3I4N I;  1L1O C;  4BBR I;  2JNY A;  3H3V J;  4NBG A;  4NBA A;  3S15 I;  2R92 I;  5FLM I;  2P3Y A;  1RO4 A;  5CM2 M;  3GTP I;  1Y1V S;  5C3E I;  3RZO I;  2R7Z I;  4A3C I;  3H0G I;  4MH4 A;  1K83 I;  4NBD A;  4QTT A;  2JA7 I;  3VB9 A;  2NVT I;  3GTM S;  4Y7N I;  1SFO I;  4NBB A;  2PK7 A;  1ML8 A;  2J6A A;  3VMH A;  2F4O A;  5C44 I;  3LUS A;  1I6H I;  4A3L I;  1USP A;  1DL6 A;  2JA8 I;  4NB9 A;  1LQL A;  4BY1 I;  3S17 I;  2AKL A;  1I3Q I;  5IP9 I;  3GTO I;  2NVQ I;  2JS4 A;  3S2H I;  4A3G I;  3HOU I;  3I4M I;  4NBE A;  1NUI A;  3GTL I;  4A3M I;  2KPI A;  1QYP A;  2YU9 I;  4Y52 I;  1USP B;  1ZB8 A;  1N2F A;  2RBL A;  4BXX I;  3S2D I;  3HOY I;  2K5R A;  1Y1W I;  2E2H I;  4X6A I;  3FKI I;  3K7A I;  3S1M I;  1I50 I;  1WW9 A;  3D6W A;  4BBS I;  1TWC I;  1X3W A;  4A3I I;  4QTU A;  3VMI A;  1TWH I;  1ZB9 A;  2E2J I;  1TWG I;  4A93 I;  3Q87 A;  4A3F I;  3S14 I;  4NBC A;  1TWA I;  1WCM I;  1YUA A;  2HF1 A;  1PFT A;  2E2I I;  5IP7 I;  2DE6 A;  4NB8 A;  1RLY A;  3PO3 S;  4NOZ A;  5C4J I;  3GKQ A;  1X3Z A;  3GCF A;  5C4X I;  2BJO A;  3HOZ I;  3HOX I;  3U50 C;  3RZD I;  3EER A;  2NVY I;  4XX2 A;  2DE7 A;  3CQZ I;  1Y1V I;  3GTQ I;  1VLA A;  3S1N I;  4A3K I;  2JA5 I;  2DE5 A;  1TWF I;  2JR6 A;  3VMG A;  3PO2 I;  4A3D I;  3M3Y I;  2NVX I;  4BY7 I;  2R93 I;  3GTM I;  4NBH A;  3GTJ I;  1R9T I;  3HOW I;  4A3B I; 
#chains in the Genus database with same CATH topology
 3S1R I;  4A3E I;  3HOV I;  2VUM I;  1VQ5 1;  4E2Z A;  1VQO 1;  3I07 A;  4RVD A;  2F4M A;  3CC2 Z;  4A3J I;  2JIO A;  2V8I A;  4NBG A;  1RNI A;  3RZO I;  4MH4 A;  2HU9 A;  3CD6 Z;  2NVT I;  4Y7N I;  1SFO I;  3CCS Z;  1VQL Z;  2F4O A;  2Q51 A;  3LUS A;  3CCR 1;  1M1K 2;  1I6H I;  3CCL Z;  1QVF Z;  2JA8 I;  1VQN 1;  3S17 I;  4S1T A;  4E30 A;  3IR7 A;  2NVQ I;  4HGZ A;  4TNU A;  1QXF A;  4E33 A;  3HOU I;  4DGL A;  4NBE A;  1NUI A;  1Q7Y 1;  1K73 2;  2VPW A;  1VQM Z;  1VQM 1;  1YJN 1;  1USP B;  2VPZ A;  4Y52 I;  1ZB8 A;  3CCJ 1;  1KQS Y;  3HOY I;  1YHQ 1;  3J80 b;  2IV2 X;  1YHQ Z;  1YIJ 1;  4E2Y A;  3K7A I;  2IZ3 A;  3S1M I;  3EED A;  1WW9 A;  1TWC I;  2JMO A;  2RHB A;  5AN9 F;  2JIP A;  1ZB9 A;  2QLV B;  1TWA I;  1VQO Z;  3D2L A;  2HF1 A;  1M1K 1;  3G4S 1;  5C4J I;  4EWC A;  4HH4 A;  1S72 1;  2IZ4 A;  3U50 C;  3JAM b;  1Q81 1;  2AYD A;  1JWH C;  4E2W A;  1AA6 A;  2O53 A;  2OTJ 1;  3CPW Z;  3S1N I;  1K8A 2;  2LFU A;  4RV9 A;  2LEX A;  3J81 f;  2M6N A;  2YAD A;  2JR6 A;  3CD6 1;  3CMA 1;  3CC4 Z;  4MD9 A;  5D1P A;  2R93 I;  2QKD A;  1VQN Z;  3CCR Z;  3I55 Z;  1K73 1;  3GTJ I;  2ZAE B;  2OZK A;  1NJI 1;  1KC8 2;  2I3C A;  3CCM Z;  1VQ6 Z;  3I56 1;  3CXC Y;  4MRI A;  3J7A 4;  3F3P C;  3GTK I;  2QEX 1;  3CME 1;  5T67 A;  3ESW A;  3S16 I;  1QVF Y;  3PO3 I;  2R6M A;  4NH1 C;  2GU2 A;  4RVF A;  3TDH B;  3I4N I;  2G2K A;  2JNY A;  1SIW A;  1VQ7 1;  3H3V J;  2Q4Z A;  2R92 I;  1ZH1 A;  5CM2 M;  2OOY B;  1VQP 1;  2JIM A;  3GTP I;  1KD1 1;  5IT9 f;  2P28 A;  3H0G I;  2E7Z A;  1YIT Z;  3OW2 Y;  2JA7 I;  3GTM S;  4NBB A;  1M90 2;  5D1O A;  1Z03 A;  5FLX b;  2W03 A;  2V3V A;  1WII A;  3HKZ A;  3J80 f;  2OTL 1;  4A3L I;  1RQF A;  1DL6 A;  2EGT A;  3CCM 1;  1QVG Z;  3GTO I;  4A3G I;  1KC8 1;  1NJI 2;  2YU9 I;  1N2F A;  3KIH A;  1JJ2 Z;  1Y1W I;  2E2H I;  3QWU A;  5LL6 f;  4X6A I;  1Q86 2;  1S7M A;  3FKI I;  4NFR A;  3CCV Z;  2VUG A;  2QRC B;  4A3I I;  4QTU A;  3VMI A;  1TWH I;  2E2J I;  2QEX Z;  3FQM A;  4A3F I;  1Q82 2;  1WCM I;  4MON A;  1YJW 1;  2PM9 A;  1N8R 1;  1Q7Y 2;  4NB8 A;  1RLY A;  3PO3 S;  3NH8 A;  2JIQ A;  4NOZ A;  5T6B A;  3GCF A;  1Q86 1;  2V8J A;  1VQ7 Z;  3CCU 1;  2NVY I;  5A2Q b;  4XX2 A;  3G71 Z;  1YIT 1;  3CCU Z;  3G71 1;  3P5J B;  1TWF I;  2GTH A;  3VMG A;  3PO2 I;  3VTN A;  4RVH A;  3CC7 Z;  4HGY A;  4NBH A;  5IT9 b;  1R9T I;  4DK1 A;  2WAQ A;  1W2B Y;  2Y0S A;  4NBF A;  2JA6 I;  5FLX f;  3S1Q I;  2B63 I;  1VQK Z;  2H85 A;  1YUK A;  3M4O I;  1L1O C;  4BBR I;  4NBA A;  3I55 1;  3S15 I;  5FLM I;  3G6E 1;  2P3Y A;  3IF8 A;  5C3E I;  3G6E Z;  2R7Z I;  2QR1 B;  1X0T A;  3I56 Z;  1K83 I;  1K9M 1;  4NBD A;  4QTT A;  3VB9 A;  1KRL A;  1VQ5 Z;  1ML8 A;  5C44 I;  2OTL Z;  1USP A;  4BY1 I;  1YIJ Z;  2AKL A;  3OW2 Z;  1QVG Y;  2QRE B;  2JS4 A;  3S2H I;  1WJ2 A;  3GTL I;  3CCS 1;  4A3M I;  2NAP A;  2RPR A;  1S72 Z;  2K3R A;  2RIQ A;  1VQ8 Z;  5A2Q f;  1VQ6 1;  3CC7 1;  4BBS I;  1TWG I;  3Q87 A;  2KI7 B;  1K9M 2;  5IP7 I;  3MZL B;  3NFZ A;  3CCE 1;  3GKQ A;  1X3Z A;  2RT9 A;  2BJO A;  3CCE Z;  5D1O B;  3BG1 B;  1RO2 A;  1Q82 1;  3EER A;  3MON A;  1P9N A;  1VQ4 1;  1N8R 2;  2JUB A;  3CQZ I;  1Y1V I;  3GTQ I;  1VLA A;  1Z01 A;  4MD7 A;  2DE5 A;  1YJW Z;  4A3D I;  1RO0 A;  3CXC Z;  1VQ9 1;  3M3Y I;  4BY7 I;  3GTM I;  1Y8C A;  1Z02 A;  3CCQ Z;  4A3B I;  2OTJ Z;  1KQS Z;  3F3F C;  1TFI A;  1Q81 2;  1W2B Z;  1FDI A;  4MXU A;  2WB1 A;  1FDO A;  4DQY B;  1Q16 A;  3GTG I;  2QA4 1;  3CC4 1;  3TE5 B;  2OOX B;  2QA4 Z;  3G4S Z;  1VQ4 Z;  3CCV 1;  1RO4 A;  2O4H A;  5T64 A;  1Y1V S;  4A3C I;  4AYB A;  3NDJ A;  4E32 A;  2PK7 A;  4MD8 A;  2J6A A;  3VMH A;  2V8K A;  1YJN Z;  1M90 1;  3NDI A;  2VF1 A;  3MZK B;  2QRD B;  4NB9 A;  1LQL A;  1YJ9 Z;  1KD1 2;  1VQP Z;  1I3Q I;  5IP9 I;  3I4M I;  3NH5 A;  3BG0 B;  4RVG A;  3CPW Y;  2JIR A;  2KPI A;  3IFU A;  3J81 b;  1QYP A;  3FQQ A;  3CME Z;  1VQ9 Z;  2RBL A;  4BXX I;  3S2D I;  2K5R A;  1YI2 1;  3NH4 A;  3CC2 1;  1VQ8 1;  1YI2 Z;  3CCQ 1;  1I50 I;  3D6W A;  1X3W A;  3D9X A;  1WZN A;  4A93 I;  3S14 I;  4NBC A;  2LIY A;  1YUA A;  1PFT A;  3CCL 1;  2E2I I;  3CMA Z;  2DE6 A;  1VQL 1;  3IX0 A;  5C4X I;  4RS4 A;  3HOZ I;  3T4N B;  3HOX I;  1JJ2 Y;  4E2X A;  3RZD I;  1K8A 1;  2PMZ A;  2DE7 A;  2VPY A;  2V45 A;  1QF8 A;  4A3K I;  2JA5 I;  4E31 A;  1NP6 A;  2E9H A;  3CCJ Z;  2GTI A;  4CL1 A;  3KIF A;  2W04 A;  1VQK 1;  2NVX I;  1YJ9 1;  3JAM f;  2VPX A;  2M48 A;  3HOW I; 
#chains in the Genus database with same CATH homology
 3S1R I;  4A3E I;  3HOV I;  2VUM I;  1VQ5 1;  4E2Z A;  1VQO 1;  3I07 A;  4RVD A;  2F4M A;  3CC2 Z;  4A3J I;  2V8I A;  4NBG A;  1RNI A;  3RZO I;  4MH4 A;  2HU9 A;  3CD6 Z;  2NVT I;  4Y7N I;  1SFO I;  3CCS Z;  1VQL Z;  2F4O A;  2Q51 A;  3LUS A;  3CCR 1;  1M1K 2;  1I6H I;  3CCL Z;  1QVF Z;  2JA8 I;  1VQN 1;  3S17 I;  4S1T A;  4E30 A;  2NVQ I;  4HGZ A;  4TNU A;  4E33 A;  3HOU I;  4DGL A;  4NBE A;  1NUI A;  1Q7Y 1;  1K73 2;  1VQM Z;  1VQM 1;  1YJN 1;  1USP B;  4Y52 I;  1ZB8 A;  3CCJ 1;  1KQS Y;  3HOY I;  1YHQ 1;  3J80 b;  1YHQ Z;  1YIJ 1;  4E2Y A;  3K7A I;  2IZ3 A;  3S1M I;  3EED A;  1WW9 A;  1TWC I;  2JMO A;  2RHB A;  5AN9 F;  1ZB9 A;  2QLV B;  1TWA I;  1VQO Z;  2HF1 A;  1M1K 1;  3G4S 1;  5C4J I;  4EWC A;  4HH4 A;  1S72 1;  2IZ4 A;  3U50 C;  3JAM b;  1Q81 1;  1JWH C;  4E2W A;  2OTJ 1;  2O53 A;  3CPW Z;  3S1N I;  1K8A 2;  2LFU A;  4RV9 A;  3J81 f;  2M6N A;  2YAD A;  2JR6 A;  3CD6 1;  3CMA 1;  3CC4 Z;  4MD9 A;  5D1P A;  2R93 I;  2QKD A;  1VQN Z;  3CCR Z;  3I55 Z;  1K73 1;  3GTJ I;  2ZAE B;  2OZK A;  1NJI 1;  1KC8 2;  2I3C A;  3CCM Z;  1VQ6 Z;  3I56 1;  3CXC Y;  4MRI A;  3J7A 4;  3F3P C;  3GTK I;  2QEX 1;  3CME 1;  5T67 A;  3ESW A;  3S16 I;  1QVF Y;  3PO3 I;  2R6M A;  4NH1 C;  2GU2 A;  4RVF A;  3TDH B;  3I4N I;  2G2K A;  2JNY A;  1VQ7 1;  3H3V J;  2Q4Z A;  2R92 I;  1ZH1 A;  5CM2 M;  2OOY B;  1VQP 1;  3GTP I;  1KD1 1;  5IT9 f;  2P28 A;  3H0G I;  1YIT Z;  3OW2 Y;  2JA7 I;  3GTM S;  4NBB A;  1M90 2;  5D1O A;  1Z03 A;  5FLX b;  2W03 A;  1WII A;  3HKZ A;  3J80 f;  2OTL 1;  4A3L I;  1RQF A;  1DL6 A;  2EGT A;  3CCM 1;  1QVG Z;  3GTO I;  4A3G I;  1KC8 1;  1NJI 2;  2YU9 I;  1N2F A;  3KIH A;  1JJ2 Z;  1Y1W I;  2E2H I;  3QWU A;  5LL6 f;  4X6A I;  1Q86 2;  1S7M A;  3FKI I;  4NFR A;  3CCV Z;  2VUG A;  2QRC B;  4A3I I;  4QTU A;  3VMI A;  1TWH I;  2E2J I;  2QEX Z;  3FQM A;  4A3F I;  1Q82 2;  1WCM I;  4MON A;  1YJW 1;  2PM9 A;  1N8R 1;  1Q7Y 2;  4NB8 A;  1RLY A;  3PO3 S;  3NH8 A;  4NOZ A;  5T6B A;  3GCF A;  1Q86 1;  2V8J A;  1VQ7 Z;  3CCU 1;  2NVY I;  5A2Q b;  4XX2 A;  3G71 Z;  1YIT 1;  3CCU Z;  3G71 1;  3P5J B;  1TWF I;  2GTH A;  3VMG A;  3PO2 I;  3VTN A;  4RVH A;  3CC7 Z;  4HGY A;  4NBH A;  5IT9 b;  1R9T I;  4DK1 A;  2WAQ A;  1W2B Y;  2Y0S A;  4NBF A;  2JA6 I;  5FLX f;  3S1Q I;  2B63 I;  1VQK Z;  2H85 A;  1YUK A;  3M4O I;  1L1O C;  4BBR I;  4NBA A;  3I55 1;  3S15 I;  5FLM I;  3G6E 1;  2P3Y A;  3IF8 A;  5C3E I;  3G6E Z;  2R7Z I;  2QR1 B;  1X0T A;  3I56 Z;  1K83 I;  1K9M 1;  4NBD A;  4QTT A;  3VB9 A;  1KRL A;  1VQ5 Z;  1ML8 A;  5C44 I;  2OTL Z;  1USP A;  4BY1 I;  1YIJ Z;  2AKL A;  3OW2 Z;  1QVG Y;  2QRE B;  2JS4 A;  3S2H I;  3GTL I;  3CCS 1;  4A3M I;  2RPR A;  1S72 Z;  2K3R A;  2RIQ A;  1VQ8 Z;  5A2Q f;  1VQ6 1;  3CC7 1;  4BBS I;  1TWG I;  3Q87 A;  2KI7 B;  1K9M 2;  5IP7 I;  3MZL B;  3NFZ A;  3CCE 1;  3GKQ A;  1X3Z A;  2RT9 A;  2BJO A;  3CCE Z;  5D1O B;  3BG1 B;  1RO2 A;  1Q82 1;  3EER A;  3MON A;  1P9N A;  1VQ4 1;  1N8R 2;  2JUB A;  3CQZ I;  1Y1V I;  3GTQ I;  1VLA A;  1Z01 A;  4MD7 A;  2DE5 A;  1YJW Z;  4A3D I;  1RO0 A;  3CXC Z;  1VQ9 1;  3M3Y I;  4BY7 I;  3GTM I;  1Z02 A;  3CCQ Z;  4A3B I;  2OTJ Z;  1KQS Z;  1Q81 2;  1TFI A;  3F3F C;  1W2B Z;  4MXU A;  2WB1 A;  4DQY B;  3GTG I;  2QA4 1;  3CC4 1;  3TE5 B;  2OOX B;  2QA4 Z;  3G4S Z;  1VQ4 Z;  3CCV 1;  1RO4 A;  2O4H A;  5T64 A;  1Y1V S;  4A3C I;  4AYB A;  3NDJ A;  4E32 A;  2PK7 A;  4MD8 A;  2J6A A;  3VMH A;  2V8K A;  1YJN Z;  1M90 1;  3NDI A;  2VF1 A;  3MZK B;  2QRD B;  4NB9 A;  1LQL A;  1YJ9 Z;  1KD1 2;  1VQP Z;  1I3Q I;  5IP9 I;  3I4M I;  3NH5 A;  3BG0 B;  4RVG A;  3CPW Y;  2KPI A;  3IFU A;  3J81 b;  1QYP A;  3FQQ A;  3CME Z;  1VQ9 Z;  2RBL A;  4BXX I;  3S2D I;  2K5R A;  1YI2 1;  3NH4 A;  3CC2 1;  1VQ8 1;  1YI2 Z;  3CCQ 1;  1I50 I;  3D6W A;  1X3W A;  3D9X A;  4A93 I;  3S14 I;  4NBC A;  2LIY A;  1YUA A;  1PFT A;  3CCL 1;  2E2I I;  3CMA Z;  2DE6 A;  1VQL 1;  3IX0 A;  5C4X I;  4RS4 A;  3HOZ I;  3T4N B;  3HOX I;  1JJ2 Y;  4E2X A;  3RZD I;  1K8A 1;  2PMZ A;  2DE7 A;  1QF8 A;  4A3K I;  2JA5 I;  4E31 A;  1NP6 A;  2E9H A;  3CCJ Z;  2GTI A;  4CL1 A;  3KIF A;  2W04 A;  1VQK 1;  2NVX I;  1YJ9 1;  3JAM f;  2M48 A;  3HOW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...