2JA7I

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 8
structure length 116
sequence length 116
chains with identical sequence U
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja7I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja7I02
3VB9A 3S1MI 3K7AI 2VUMI 4A3LI 4X6AI 2JA8I 4Y52I 1TWGI 1N2FA 3S1NI 4A3CI 4A3II 5C4JI 1X3ZA 3GTKI 5IP9I 3VMGA 1Y1WI 4NB8A 3GTPI 1I3QI 3HOYI 1ZB8A 3H3VJ 3S2HI 4NB9A 1WCMI 2JS4A 1ML8A 1RO4A 1WW9A 3I07A 2J6AA 4Y7NI 3S1RI 3S16I 1YUAA 2F4OA 2JA6I 1I50I 2DE7A 4A93I 4NBBA 3GTQI 3FKII 2R92I 4BY7I 3H0GI 3I4MI 4NBEA 3GKQA 2HF1A 5FLMI 3S15I 4NBDA 4A3MI 2JA7I 1TWCI 3U50C 2B63I 2K5RA 3PO3I 2DE5A 4XX2A 3HOVI 2AKLA 1L1OC 2F4MA 2NVXI 2P3YA 3GTJI 1X3WA 1PFTA 1USPA 3HOWI 2RBLA 5C4XI 4A3KI 3GTMI 4NBGA 2PK7A 3LUSA 2BJOA 3HOUI 1R9TI 2E2JI 4NOZA 2DE6A 2JNYA 1TWAI 1SFOI 5CM2M 3RZOI 2R7ZI 1QYPA 1ZB9A 2NVTI 3S14I 3VMIA 4BXXI 4QTTA 2R93I 2JA5I 3PO3S 1I6HI 1K83I 1Y1VI 4A3EI 1VLAA 4BBRI 4QTUA 2E2II 1RLYA 2NVQI 4A3FI 2E2HI 4BY1I 1TFIA 3VMHA 3M4OI 3M3YI 4A3JI 1LQLA 3CQZI 3EERA 2NVYI 3S1QI 3Q87A 3I4NI 3RZDI 4NBFA 3S17I 1USPB 4MH4A 5C44I 3GTMS 4NBAA 3GTLI 1TWHI 4NBHA 3GTOI 2YU9I 3HOZI 3GCFA 3GTGI 4A3GI 5C3EI 1TWFI 1Y1VS 3S2DI 4A3DI 3HOXI 4NBCA 1NUIA 5IP7I 3D6WA 2JR6A 4BBSI 2KPIA 3PO2I 1DL6A 4A3BI 3ESWA
chains in the Genus database with same CATH superfamily
2QEXZ 1VQP1 3CME1 3F3FC 2QRDB 4A3LI 3CCU1 2RT9A 1VQOZ 4MXUA 1TWGI 2RHBA 3CCS1 1N2FA 1N8R2 1VQKZ 3S1NI 2I3CA 2RPRA 3CPWZ 1YIJ1 5A2Qf 1K9M2 3G711 2QLVB 3GTPI 4E2WA 1VQM1 4RVGA 3I55Z 1RO4A 4DK1A 1VQ81 2V8KA 4Y7NI 2JA6I 2GTIA 2V45A 3HKZA 1K9M1 2OOXB 3FKII 2OOYB 4DQYB 2K3RA 1VQMZ 4E2YA 3IFUA 3MZKB 5AN9F 5FLMI 3S15I 2JIMA 4A3MI 2AYDA 2JA7I 5IT9b 3PO3I 1RNIA 1ZH1A 4MRIA 1W2BZ 2OTJ1 5T64A 3GTJI 1X3WA 1YITZ 1USPA 2VPXA 5C4XI 3JAMb 2O4HA 4A3KI 2WAQA 2BJOA 3CCRZ 3CC41 2E2JI 2W04A 1TWAI 2VPZA 1YI2Z 1ZB9A 2QRCB 1I6HI 1M1K1 1VLAA 2H85A 1VQ4Z 4E33A 2JIQA 1YHQ1 3NFZA 3M3YI 4RS4A 4A3JI 3CCQZ 1S7MA 3Q87A 2RIQA 3EEDA 3G4S1 2PMZA 3RZDI 2LEXA 1WZNA 2V3VA 3G6EZ 1JJ2Z 3HOZI 1RO0A 2QA4Z 3G4SZ 3HOXI 1Q861 1VQ7Z 4BBSI 2KPIA 2IZ4A 1WJ2A 3FQQA 3VB9A 3I56Z 1YJ91 4X6AI 2IV2X 1VQ5Z 5C4JI 2ZAEB 4MONA 1X3ZA 3CMAZ 3JAMf 3VMGA 3KIFA 4NB8A 3CCJ1 3CCMZ 3CC21 3H3VJ 5T67A 4E32A 1WW9A 1Z02A 3J81f 3S16I 3KIHA 4TNUA 4HGZA 3GTQI 1Q821 1Q811 3CC2Z 2M6NA 3CCE1 2OTL1 4NBEA 3T4NB 5T6BA 5D1PA 5D1OB 3NH5A 2HF1A 1VQN1 2K5RA 1FDOA 1W2BY 1VQPZ 3CMEZ 1VQ91 4HGYA 1L1OC 3CCUZ 1N8R1 3CCSZ 2NVXI 2YADA 1PFTA 2RBLA 2VF1A 1VQNZ 1YIJZ 1VQL1 3J80b 1K732 3GTMI 3G71Z 4NOZA 1RQFA 1SFOI 1M902 1QYPA 2NVTI 1VQ8Z 3S14I 2R93I 2JA5I 1YJN1 4MD8A 4A3EI 4BBRI 4QTUA 1RLYA 2Q4ZA 2WB1A 2E2HI 1TFIA 1KQSZ 1QXFA 3EERA 4E2XA 1VQ61 2GU2A 4DGLA 4MH4A 4NBAA 1Y8CA 1YJNZ 1JJ2Y 2PM9A 4MD7A 3GTOI 2YU9I 2OTJZ 3GCFA 3GTGI 2P28A 5C3EI 1Y1VS 1YUKA 3S2DI 3NH8A 4A3DI 3CCL1 2W03A 5IP7I 4RV9A 3D2LA 2E9HA 2QR1B 1DL6A 3CC4Z 1SIWA 4A3BI 3ESWA 3K7AI 3QWUA 2VUMI 2QREB 2JA8I 3NDJA 1QVGZ 5D1OA 1YHQZ 3GTKI 1QF8A 5IP9I 3J80f 1I3QI 1NJI2 3HOYI 1Q16A 4RVDA 1WCMI 2JS4A 1NP6A 2J6AA 2F4OA 1JWHC 4RVFA 1I50I 5A2Qb 4NBBA 2V8JA 5IT9f 1S721 2JUBA 5FLXb 2JIOA 1NJI1 2R92I 3H0GI 3I4MI 1Z03A 2VPYA 3P5JB 4E2ZA 1KD12 3CC71 2O53A 3IF8A 4MD9A 2DE5A 1QVFY 1YJ9Z 3FQMA 2AKLA 2R6MA 4NFRA 2JIPA 3HOWI 3J7A4 3MONA 3CCJZ 2PK7A 2DE6A 3RZOI 3VMIA 1VQO1 3PO3S 1K83I 2LIYA 3F3PC 2E2II 2NVQI 3NDIA 3VTNA 4BY1I 3VMHA 1KQSY 1QVFZ 3CCEZ 2OTLZ 1LQLA 3S1QI 1AA6A 3I551 1Z01A 3S17I 5C44I 4RVHA 3GTLI 4NBHA 1VQ9Z 1FDIA 3D9XA 5FLXf 2KI7B 1X0TA 1Q7Y2 1NUIA 1K731 3CD61 1K8A2 1VQLZ 2GTHA 3D6WA 2JR6A 2E7ZA 3BG0B 4NH1C 1RO2A 1M901 3S1MI 2Y0SA 1QVGY 4Y52I 2EGTA 2QKDA 1Q7Y1 4CL1A 4A3CI 1YIT1 4A3II 1K8A1 3CD6Z 3IX0A 1KC82 3OW2Y 2NAPA 1Y1WI 3NH4A 3TE5B 3CCR1 1VQ6Z 1ZB8A 3S2HI 4NB9A 1ML8A 1YJW1 1YI21 3I07A 3S1RI 4E31A 1YUAA 2DE7A 4A93I 1KC81 3TDHB 4E30A 1M1K2 1VQ41 4BY7I 4HH4A 3CCQ1 1YJWZ 3J81b 3GKQA 3CCLZ 3CXCY 2LFUA 2VUGA 4NBDA 3G6E1 1TWCI 3U50C 3OW2Z 2B63I 2HU9A 2IZ3A 4XX2A 3HOVI 2F4MA 2P3YA 2QA41 1P9NA 2JMOA 4AYBA 1VQ71 1Q862 2Q51A 4NBGA 5LL6f 3LUSA 3HOUI 1R9TI 2JNYA 5CM2M 2R7ZI 3I561 4BXXI 4QTTA 3CXCZ 1Y1VI 2VPWA 1VQ51 3BG1B 1S72Z 4A3FI 3CMA1 1WIIA 1KRLA 3M4OI 2V8IA 3CCM1 3CQZI 2NVYI 3I4NI 2G2KA 4NBFA 1USPB 3CCV1 1KD11 3GTMS 1TWHI 3CC7Z 3CPWY 3MZLB 2OZKA 2QEX1 4A3GI 1Q822 1Q812 4EWCA 1TWFI 1VQK1 4NBCA 3CCVZ 2M48A 2JIRA 3IR7A 3PO2I 4S1TA
chains in the Genus database with same CATH topology
2QEXZ 1VQP1 3CME1 3F3FC 2QRDB 4A3LI 3CCU1 2RT9A 1VQOZ 4MXUA 1TWGI 2RHBA 3CCS1 1N2FA 1N8R2 1VQKZ 3S1NI 2I3CA 2RPRA 3CPWZ 1YIJ1 5A2Qf 1K9M2 3G711 2QLVB 3GTPI 4E2WA 1VQM1 4RVGA 3I55Z 1RO4A 4DK1A 1VQ81 2V8KA 4Y7NI 2JA6I 2GTIA 3HKZA 1K9M1 2OOXB 3FKII 2OOYB 4DQYB 2K3RA 1VQMZ 4E2YA 3IFUA 3MZKB 5AN9F 5FLMI 3S15I 4A3MI 2JA7I 5IT9b 3PO3I 1RNIA 1ZH1A 4MRIA 1W2BZ 2OTJ1 5T64A 3GTJI 1X3WA 1YITZ 1USPA 5C4XI 3JAMb 2O4HA 4A3KI 2WAQA 2BJOA 3CCRZ 3CC41 2E2JI 2W04A 1TWAI 1YI2Z 1ZB9A 2QRCB 1I6HI 1M1K1 1VLAA 2H85A 1VQ4Z 4E33A 1YHQ1 3NFZA 3M3YI 4RS4A 4A3JI 3CCQZ 1S7MA 3Q87A 2RIQA 3EEDA 3G4S1 2PMZA 3RZDI 3G6EZ 1JJ2Z 3HOZI 1RO0A 2QA4Z 3G4SZ 3HOXI 1Q861 1VQ7Z 4BBSI 2KPIA 2IZ4A 3FQQA 3VB9A 3I56Z 1YJ91 4X6AI 1VQ5Z 5C4JI 2ZAEB 4MONA 1X3ZA 3CMAZ 3JAMf 3VMGA 3KIFA 4NB8A 3CCJ1 3CCMZ 3CC21 3H3VJ 5T67A 4E32A 1WW9A 1Z02A 3J81f 3S16I 3KIHA 4TNUA 4HGZA 3GTQI 1Q821 1Q811 3CC2Z 2M6NA 3CCE1 2OTL1 4NBEA 3T4NB 5T6BA 5D1PA 5D1OB 3NH5A 2HF1A 1VQN1 2K5RA 1W2BY 1VQPZ 3CMEZ 1VQ91 4HGYA 1L1OC 3CCUZ 1N8R1 3CCSZ 2NVXI 2YADA 1PFTA 2RBLA 2VF1A 1VQNZ 1YIJZ 1VQL1 3J80b 1K732 3GTMI 3G71Z 4NOZA 1RQFA 1SFOI 1M902 1QYPA 2NVTI 1VQ8Z 3S14I 2R93I 2JA5I 1YJN1 4MD8A 4A3EI 4BBRI 4QTUA 1RLYA 2Q4ZA 2WB1A 2E2HI 1TFIA 1KQSZ 1VQ61 3EERA 4E2XA 2GU2A 4DGLA 4MH4A 4NBAA 1YJNZ 1JJ2Y 2PM9A 4MD7A 3GTOI 2YU9I 2OTJZ 3GCFA 3GTGI 2P28A 5C3EI 1Y1VS 1YUKA 3S2DI 3NH8A 4A3DI 3CCL1 2W03A 5IP7I 4RV9A 2E9HA 2QR1B 1DL6A 3CC4Z 4A3BI 3ESWA 3K7AI 3QWUA 2VUMI 2QREB 2JA8I 3NDJA 1QVGZ 5D1OA 1YHQZ 3GTKI 1QF8A 5IP9I 3J80f 1I3QI 1NJI2 3HOYI 4RVDA 1WCMI 2JS4A 1NP6A 2J6AA 2F4OA 1JWHC 4RVFA 1I50I 5A2Qb 4NBBA 2V8JA 5IT9f 1S721 2JUBA 5FLXb 1NJI1 2R92I 3H0GI 3I4MI 1Z03A 3P5JB 4E2ZA 1KD12 3CC71 2O53A 3IF8A 4MD9A 2DE5A 1QVFY 1YJ9Z 3FQMA 2AKLA 2R6MA 4NFRA 3HOWI 3J7A4 3MONA 3CCJZ 2PK7A 2DE6A 3RZOI 3VMIA 1VQO1 3PO3S 1K83I 2LIYA 3F3PC 2E2II 2NVQI 3NDIA 3VTNA 4BY1I 3VMHA 1KQSY 1QVFZ 3CCEZ 2OTLZ 1LQLA 3S1QI 3I551 1Z01A 3S17I 5C44I 4RVHA 3GTLI 4NBHA 1VQ9Z 3D9XA 5FLXf 2KI7B 1X0TA 1Q7Y2 1NUIA 1K731 3CD61 1K8A2 1VQLZ 2GTHA 3D6WA 2JR6A 3BG0B 4NH1C 1RO2A 1M901 3S1MI 2Y0SA 1QVGY 4Y52I 2EGTA 2QKDA 1Q7Y1 4CL1A 4A3CI 1YIT1 4A3II 1K8A1 3CD6Z 3IX0A 1KC82 3OW2Y 1Y1WI 3NH4A 3TE5B 3CCR1 1VQ6Z 1ZB8A 3S2HI 4NB9A 1ML8A 1YJW1 1YI21 3I07A 3S1RI 4E31A 1YUAA 2DE7A 4A93I 1KC81 3TDHB 4E30A 1M1K2 1VQ41 4BY7I 4HH4A 3CCQ1 1YJWZ 3J81b 3GKQA 3CCLZ 3CXCY 2LFUA 2VUGA 4NBDA 3G6E1 1TWCI 3U50C 3OW2Z 2B63I 2HU9A 2IZ3A 4XX2A 3HOVI 2F4MA 2P3YA 2QA41 1P9NA 2JMOA 4AYBA 1VQ71 1Q862 2Q51A 4NBGA 5LL6f 3LUSA 3HOUI 1R9TI 2JNYA 5CM2M 2R7ZI 3I561 4BXXI 4QTTA 3CXCZ 1Y1VI 1VQ51 3BG1B 1S72Z 4A3FI 3CMA1 1WIIA 1KRLA 3M4OI 2V8IA 3CCM1 3CQZI 2NVYI 3I4NI 2G2KA 4NBFA 1USPB 3CCV1 1KD11 3GTMS 1TWHI 3CC7Z 3CPWY 3MZLB 2OZKA 2QEX1 4A3GI 1Q822 1Q812 4EWCA 1TWFI 1VQK1 4NBCA 3CCVZ 2M48A 3PO2I 4S1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VB9 A;  3S1M I;  3K7A I;  2VUM I;  4A3L I;  4X6A I;  2JA8 I;  4Y52 I;  1TWG I;  1N2F A;  3S1N I;  4A3C I;  4A3I I;  5C4J I;  1X3Z A;  3GTK I;  5IP9 I;  3VMG A;  1Y1W I;  4NB8 A;  3GTP I;  1I3Q I;  3HOY I;  1ZB8 A;  3H3V J;  3S2H I;  4NB9 A;  1WCM I;  2JS4 A;  1ML8 A;  1RO4 A;  1WW9 A;  3I07 A;  2J6A A;  4Y7N I;  3S1R I;  3S16 I;  1YUA A;  2F4O A;  2JA6 I;  1I50 I;  2DE7 A;  4A93 I;  4NBB A;  3GTQ I;  3FKI I;  2R92 I;  4BY7 I;  3H0G I;  3I4M I;  4NBE A;  3GKQ A;  2HF1 A;  5FLM I;  3S15 I;  4NBD A;  4A3M I;  2JA7 I;  1TWC I;  3U50 C;  2B63 I;  2K5R A;  3PO3 I;  2DE5 A;  4XX2 A;  3HOV I;  2AKL A;  1L1O C;  2F4M A;  2NVX I;  2P3Y A;  3GTJ I;  1X3W A;  1PFT A;  1USP A;  3HOW I;  2RBL A;  5C4X I;  4A3K I;  3GTM I;  4NBG A;  2PK7 A;  3LUS A;  2BJO A;  3HOU I;  1R9T I;  2E2J I;  4NOZ A;  2DE6 A;  2JNY A;  1TWA I;  1SFO I;  5CM2 M;  3RZO I;  2R7Z I;  1QYP A;  1ZB9 A;  2NVT I;  3S14 I;  3VMI A;  4BXX I;  4QTT A;  2R93 I;  2JA5 I;  3PO3 S;  1I6H I;  1K83 I;  1Y1V I;  4A3E I;  1VLA A;  4BBR I;  4QTU A;  2E2I I;  1RLY A;  2NVQ I;  4A3F I;  2E2H I;  4BY1 I;  1TFI A;  3VMH A;  3M4O I;  3M3Y I;  4A3J I;  1LQL A;  3CQZ I;  3EER A;  2NVY I;  3S1Q I;  3Q87 A;  3I4N I;  3RZD I;  4NBF A;  3S17 I;  1USP B;  4MH4 A;  5C44 I;  3GTM S;  4NBA A;  3GTL I;  1TWH I;  4NBH A;  3GTO I;  2YU9 I;  3HOZ I;  3GCF A;  3GTG I;  4A3G I;  5C3E I;  1TWF I;  1Y1V S;  3S2D I;  4A3D I;  3HOX I;  4NBC A;  1NUI A;  5IP7 I;  3D6W A;  2JR6 A;  4BBS I;  2KPI A;  3PO2 I;  1DL6 A;  4A3B I;  3ESW A; 
#chains in the Genus database with same CATH topology
 2QEX Z;  1VQP 1;  3CME 1;  3F3F C;  2QRD B;  4A3L I;  3CCU 1;  2RT9 A;  1VQO Z;  4MXU A;  1TWG I;  2RHB A;  3CCS 1;  1N2F A;  1N8R 2;  1VQK Z;  3S1N I;  2I3C A;  2RPR A;  3CPW Z;  1YIJ 1;  5A2Q f;  1K9M 2;  3G71 1;  2QLV B;  3GTP I;  4E2W A;  1VQM 1;  4RVG A;  3I55 Z;  1RO4 A;  4DK1 A;  1VQ8 1;  2V8K A;  4Y7N I;  2JA6 I;  2GTI A;  2V45 A;  3HKZ A;  1K9M 1;  2OOX B;  3FKI I;  2OOY B;  4DQY B;  2K3R A;  1VQM Z;  4E2Y A;  3IFU A;  3MZK B;  5AN9 F;  5FLM I;  3S15 I;  2JIM A;  4A3M I;  2AYD A;  2JA7 I;  5IT9 b;  3PO3 I;  1RNI A;  1ZH1 A;  4MRI A;  1W2B Z;  2OTJ 1;  5T64 A;  3GTJ I;  1X3W A;  1YIT Z;  1USP A;  2VPX A;  5C4X I;  3JAM b;  2O4H A;  4A3K I;  2WAQ A;  2BJO A;  3CCR Z;  3CC4 1;  2E2J I;  2W04 A;  1TWA I;  2VPZ A;  1YI2 Z;  1ZB9 A;  2QRC B;  1I6H I;  1M1K 1;  1VLA A;  2H85 A;  1VQ4 Z;  4E33 A;  2JIQ A;  1YHQ 1;  3NFZ A;  3M3Y I;  4RS4 A;  4A3J I;  3CCQ Z;  1S7M A;  3Q87 A;  2RIQ A;  3EED A;  3G4S 1;  2PMZ A;  3RZD I;  2LEX A;  1WZN A;  2V3V A;  3G6E Z;  1JJ2 Z;  3HOZ I;  1RO0 A;  2QA4 Z;  3G4S Z;  3HOX I;  1Q86 1;  1VQ7 Z;  4BBS I;  2KPI A;  2IZ4 A;  1WJ2 A;  3FQQ A;  3VB9 A;  3I56 Z;  1YJ9 1;  4X6A I;  2IV2 X;  1VQ5 Z;  5C4J I;  2ZAE B;  4MON A;  1X3Z A;  3CMA Z;  3JAM f;  3VMG A;  3KIF A;  4NB8 A;  3CCJ 1;  3CCM Z;  3CC2 1;  3H3V J;  5T67 A;  4E32 A;  1WW9 A;  1Z02 A;  3J81 f;  3S16 I;  3KIH A;  4TNU A;  4HGZ A;  3GTQ I;  1Q82 1;  1Q81 1;  3CC2 Z;  2M6N A;  3CCE 1;  2OTL 1;  4NBE A;  3T4N B;  5T6B A;  5D1P A;  5D1O B;  3NH5 A;  2HF1 A;  1VQN 1;  2K5R A;  1FDO A;  1W2B Y;  1VQP Z;  3CME Z;  1VQ9 1;  4HGY A;  1L1O C;  3CCU Z;  1N8R 1;  3CCS Z;  2NVX I;  2YAD A;  1PFT A;  2RBL A;  2VF1 A;  1VQN Z;  1YIJ Z;  1VQL 1;  3J80 b;  1K73 2;  3GTM I;  3G71 Z;  4NOZ A;  1RQF A;  1SFO I;  1M90 2;  1QYP A;  2NVT I;  1VQ8 Z;  3S14 I;  2R93 I;  2JA5 I;  1YJN 1;  4MD8 A;  4A3E I;  4BBR I;  4QTU A;  1RLY A;  2Q4Z A;  2WB1 A;  2E2H I;  1TFI A;  1KQS Z;  1QXF A;  3EER A;  4E2X A;  1VQ6 1;  2GU2 A;  4DGL A;  4MH4 A;  4NBA A;  1Y8C A;  1YJN Z;  1JJ2 Y;  2PM9 A;  4MD7 A;  3GTO I;  2YU9 I;  2OTJ Z;  3GCF A;  3GTG I;  2P28 A;  5C3E I;  1Y1V S;  1YUK A;  3S2D I;  3NH8 A;  4A3D I;  3CCL 1;  2W03 A;  5IP7 I;  4RV9 A;  3D2L A;  2E9H A;  2QR1 B;  1DL6 A;  3CC4 Z;  1SIW A;  4A3B I;  3ESW A;  3K7A I;  3QWU A;  2VUM I;  2QRE B;  2JA8 I;  3NDJ A;  1QVG Z;  5D1O A;  1YHQ Z;  3GTK I;  1QF8 A;  5IP9 I;  3J80 f;  1I3Q I;  1NJI 2;  3HOY I;  1Q16 A;  4RVD A;  1WCM I;  2JS4 A;  1NP6 A;  2J6A A;  2F4O A;  1JWH C;  4RVF A;  1I50 I;  5A2Q b;  4NBB A;  2V8J A;  5IT9 f;  1S72 1;  2JUB A;  5FLX b;  2JIO A;  1NJI 1;  2R92 I;  3H0G I;  3I4M I;  1Z03 A;  2VPY A;  3P5J B;  4E2Z A;  1KD1 2;  3CC7 1;  2O53 A;  3IF8 A;  4MD9 A;  2DE5 A;  1QVF Y;  1YJ9 Z;  3FQM A;  2AKL A;  2R6M A;  4NFR A;  2JIP A;  3HOW I;  3J7A 4;  3MON A;  3CCJ Z;  2PK7 A;  2DE6 A;  3RZO I;  3VMI A;  1VQO 1;  3PO3 S;  1K83 I;  2LIY A;  3F3P C;  2E2I I;  2NVQ I;  3NDI A;  3VTN A;  4BY1 I;  3VMH A;  1KQS Y;  1QVF Z;  3CCE Z;  2OTL Z;  1LQL A;  3S1Q I;  1AA6 A;  3I55 1;  1Z01 A;  3S17 I;  5C44 I;  4RVH A;  3GTL I;  4NBH A;  1VQ9 Z;  1FDI A;  3D9X A;  5FLX f;  2KI7 B;  1X0T A;  1Q7Y 2;  1NUI A;  1K73 1;  3CD6 1;  1K8A 2;  1VQL Z;  2GTH A;  3D6W A;  2JR6 A;  2E7Z A;  3BG0 B;  4NH1 C;  1RO2 A;  1M90 1;  3S1M I;  2Y0S A;  1QVG Y;  4Y52 I;  2EGT A;  2QKD A;  1Q7Y 1;  4CL1 A;  4A3C I;  1YIT 1;  4A3I I;  1K8A 1;  3CD6 Z;  3IX0 A;  1KC8 2;  3OW2 Y;  2NAP A;  1Y1W I;  3NH4 A;  3TE5 B;  3CCR 1;  1VQ6 Z;  1ZB8 A;  3S2H I;  4NB9 A;  1ML8 A;  1YJW 1;  1YI2 1;  3I07 A;  3S1R I;  4E31 A;  1YUA A;  2DE7 A;  4A93 I;  1KC8 1;  3TDH B;  4E30 A;  1M1K 2;  1VQ4 1;  4BY7 I;  4HH4 A;  3CCQ 1;  1YJW Z;  3J81 b;  3GKQ A;  3CCL Z;  3CXC Y;  2LFU A;  2VUG A;  4NBD A;  3G6E 1;  1TWC I;  3U50 C;  3OW2 Z;  2B63 I;  2HU9 A;  2IZ3 A;  4XX2 A;  3HOV I;  2F4M A;  2P3Y A;  2QA4 1;  1P9N A;  2JMO A;  4AYB A;  1VQ7 1;  1Q86 2;  2Q51 A;  4NBG A;  5LL6 f;  3LUS A;  3HOU I;  1R9T I;  2JNY A;  5CM2 M;  2R7Z I;  3I56 1;  4BXX I;  4QTT A;  3CXC Z;  1Y1V I;  2VPW A;  1VQ5 1;  3BG1 B;  1S72 Z;  4A3F I;  3CMA 1;  1WII A;  1KRL A;  3M4O I;  2V8I A;  3CCM 1;  3CQZ I;  2NVY I;  3I4N I;  2G2K A;  4NBF A;  1USP B;  3CCV 1;  1KD1 1;  3GTM S;  1TWH I;  3CC7 Z;  3CPW Y;  3MZL B;  2OZK A;  2QEX 1;  4A3G I;  1Q82 2;  1Q81 2;  4EWC A;  1TWF I;  1VQK 1;  4NBC A;  3CCV Z;  2M48 A;  2JIR A;  3IR7 A;  3PO2 I;  4S1T A; 
#chains in the Genus database with same CATH homology
 2QEX Z;  1VQP 1;  3CME 1;  3F3F C;  2QRD B;  4A3L I;  3CCU 1;  2RT9 A;  1VQO Z;  4MXU A;  1TWG I;  2RHB A;  3CCS 1;  1N2F A;  1N8R 2;  1VQK Z;  3S1N I;  2I3C A;  2RPR A;  3CPW Z;  1YIJ 1;  5A2Q f;  1K9M 2;  3G71 1;  2QLV B;  3GTP I;  4E2W A;  1VQM 1;  4RVG A;  3I55 Z;  1RO4 A;  4DK1 A;  1VQ8 1;  2V8K A;  4Y7N I;  2JA6 I;  2GTI A;  3HKZ A;  1K9M 1;  2OOX B;  3FKI I;  2OOY B;  4DQY B;  2K3R A;  1VQM Z;  4E2Y A;  3IFU A;  3MZK B;  5AN9 F;  5FLM I;  3S15 I;  4A3M I;  2JA7 I;  5IT9 b;  3PO3 I;  1RNI A;  1ZH1 A;  4MRI A;  1W2B Z;  2OTJ 1;  5T64 A;  3GTJ I;  1X3W A;  1YIT Z;  1USP A;  5C4X I;  3JAM b;  2O4H A;  4A3K I;  2WAQ A;  2BJO A;  3CCR Z;  3CC4 1;  2E2J I;  2W04 A;  1TWA I;  1YI2 Z;  1ZB9 A;  2QRC B;  1I6H I;  1M1K 1;  1VLA A;  2H85 A;  1VQ4 Z;  4E33 A;  1YHQ 1;  3NFZ A;  3M3Y I;  4RS4 A;  4A3J I;  3CCQ Z;  1S7M A;  3Q87 A;  2RIQ A;  3EED A;  3G4S 1;  2PMZ A;  3RZD I;  3G6E Z;  1JJ2 Z;  3HOZ I;  1RO0 A;  2QA4 Z;  3G4S Z;  3HOX I;  1Q86 1;  1VQ7 Z;  4BBS I;  2KPI A;  2IZ4 A;  3FQQ A;  3VB9 A;  3I56 Z;  1YJ9 1;  4X6A I;  1VQ5 Z;  5C4J I;  2ZAE B;  4MON A;  1X3Z A;  3CMA Z;  3JAM f;  3VMG A;  3KIF A;  4NB8 A;  3CCJ 1;  3CCM Z;  3CC2 1;  3H3V J;  5T67 A;  4E32 A;  1WW9 A;  1Z02 A;  3J81 f;  3S16 I;  3KIH A;  4TNU A;  4HGZ A;  3GTQ I;  1Q82 1;  1Q81 1;  3CC2 Z;  2M6N A;  3CCE 1;  2OTL 1;  4NBE A;  3T4N B;  5T6B A;  5D1P A;  5D1O B;  3NH5 A;  2HF1 A;  1VQN 1;  2K5R A;  1W2B Y;  1VQP Z;  3CME Z;  1VQ9 1;  4HGY A;  1L1O C;  3CCU Z;  1N8R 1;  3CCS Z;  2NVX I;  2YAD A;  1PFT A;  2RBL A;  2VF1 A;  1VQN Z;  1YIJ Z;  1VQL 1;  3J80 b;  1K73 2;  3GTM I;  3G71 Z;  4NOZ A;  1RQF A;  1SFO I;  1M90 2;  1QYP A;  2NVT I;  1VQ8 Z;  3S14 I;  2R93 I;  2JA5 I;  1YJN 1;  4MD8 A;  4A3E I;  4BBR I;  4QTU A;  1RLY A;  2Q4Z A;  2WB1 A;  2E2H I;  1TFI A;  1KQS Z;  1VQ6 1;  3EER A;  4E2X A;  2GU2 A;  4DGL A;  4MH4 A;  4NBA A;  1YJN Z;  1JJ2 Y;  2PM9 A;  4MD7 A;  3GTO I;  2YU9 I;  2OTJ Z;  3GCF A;  3GTG I;  2P28 A;  5C3E I;  1Y1V S;  1YUK A;  3S2D I;  3NH8 A;  4A3D I;  3CCL 1;  2W03 A;  5IP7 I;  4RV9 A;  2E9H A;  2QR1 B;  1DL6 A;  3CC4 Z;  4A3B I;  3ESW A;  3K7A I;  3QWU A;  2VUM I;  2QRE B;  2JA8 I;  3NDJ A;  1QVG Z;  5D1O A;  1YHQ Z;  3GTK I;  1QF8 A;  5IP9 I;  3J80 f;  1I3Q I;  1NJI 2;  3HOY I;  4RVD A;  1WCM I;  2JS4 A;  1NP6 A;  2J6A A;  2F4O A;  1JWH C;  4RVF A;  1I50 I;  5A2Q b;  4NBB A;  2V8J A;  5IT9 f;  1S72 1;  2JUB A;  5FLX b;  1NJI 1;  2R92 I;  3H0G I;  3I4M I;  1Z03 A;  3P5J B;  4E2Z A;  1KD1 2;  3CC7 1;  2O53 A;  3IF8 A;  4MD9 A;  2DE5 A;  1QVF Y;  1YJ9 Z;  3FQM A;  2AKL A;  2R6M A;  4NFR A;  3HOW I;  3J7A 4;  3MON A;  3CCJ Z;  2PK7 A;  2DE6 A;  3RZO I;  3VMI A;  1VQO 1;  3PO3 S;  1K83 I;  2LIY A;  3F3P C;  2E2I I;  2NVQ I;  3NDI A;  3VTN A;  4BY1 I;  3VMH A;  1KQS Y;  1QVF Z;  3CCE Z;  2OTL Z;  1LQL A;  3S1Q I;  3I55 1;  1Z01 A;  3S17 I;  5C44 I;  4RVH A;  3GTL I;  4NBH A;  1VQ9 Z;  3D9X A;  5FLX f;  2KI7 B;  1X0T A;  1Q7Y 2;  1NUI A;  1K73 1;  3CD6 1;  1K8A 2;  1VQL Z;  2GTH A;  3D6W A;  2JR6 A;  3BG0 B;  4NH1 C;  1RO2 A;  1M90 1;  3S1M I;  2Y0S A;  1QVG Y;  4Y52 I;  2EGT A;  2QKD A;  1Q7Y 1;  4CL1 A;  4A3C I;  1YIT 1;  4A3I I;  1K8A 1;  3CD6 Z;  3IX0 A;  1KC8 2;  3OW2 Y;  1Y1W I;  3NH4 A;  3TE5 B;  3CCR 1;  1VQ6 Z;  1ZB8 A;  3S2H I;  4NB9 A;  1ML8 A;  1YJW 1;  1YI2 1;  3I07 A;  3S1R I;  4E31 A;  1YUA A;  2DE7 A;  4A93 I;  1KC8 1;  3TDH B;  4E30 A;  1M1K 2;  1VQ4 1;  4BY7 I;  4HH4 A;  3CCQ 1;  1YJW Z;  3J81 b;  3GKQ A;  3CCL Z;  3CXC Y;  2LFU A;  2VUG A;  4NBD A;  3G6E 1;  1TWC I;  3U50 C;  3OW2 Z;  2B63 I;  2HU9 A;  2IZ3 A;  4XX2 A;  3HOV I;  2F4M A;  2P3Y A;  2QA4 1;  1P9N A;  2JMO A;  4AYB A;  1VQ7 1;  1Q86 2;  2Q51 A;  4NBG A;  5LL6 f;  3LUS A;  3HOU I;  1R9T I;  2JNY A;  5CM2 M;  2R7Z I;  3I56 1;  4BXX I;  4QTT A;  3CXC Z;  1Y1V I;  1VQ5 1;  3BG1 B;  1S72 Z;  4A3F I;  3CMA 1;  1WII A;  1KRL A;  3M4O I;  2V8I A;  3CCM 1;  3CQZ I;  2NVY I;  3I4N I;  2G2K A;  4NBF A;  1USP B;  3CCV 1;  1KD1 1;  3GTM S;  1TWH I;  3CC7 Z;  3CPW Y;  3MZL B;  2OZK A;  2QEX 1;  4A3G I;  1Q82 2;  1Q81 2;  4EWC A;  1TWF I;  1VQK 1;  4NBC A;  3CCV Z;  2M48 A;  3PO2 I;  4S1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...