4QTTA

Structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multifunctional methyltransferase subunit TRM112
publication title Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transferase
total genus 34
structure length 132
sequence length 132
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4qttA00
4A3JI 1TWHI 4Y52I 3D6WA 2P3YA 3U50C 2BJOA 3I4MI 3PO3I 3FKII 3LUSA 5IP9I 2J6AA 2NVTI 1USPB 3GTMI 3I07A 3S14I 2NVQI 2R7ZI 3VMIA 1TWFI 2NVXI 1Y1VI 3GTJI 1TFIA 3CQZI 1TWGI 3GKQA 3PO2I 3VB9A 3HOZI 4A3CI 4NBCA 3HOUI 3GCFA 4Y7NI 2VUMI 3HOWI 3I4NI 4NBAA 4MH4A 1Y1WI 4A3DI 1ML8A 2DE5A 1PFTA 3GTLI 4BY1I 2R93I 2YU9I 2NVYI 3RZOI 1TWAI 1I50I 3VMGA 1I6HI 3HOYI 2JR6A 3S2DI 4BXXI 5C4XI 3S17I 4A3LI 4A3EI 2DE7A 1NUIA 2HF1A 4NBEA 1X3ZA 3S1NI 1YUAA 4A3MI 1USPA 4A3GI 1DL6A 1I3QI 1WW9A 3GTPI 3K7AI 4A3FI 3Q87A 2F4MA 5C44I 3EERA 2E2JI 3S2HI 5IP7I 5FLMI 5C3EI 4NBDA 2JNYA 1SFOI 3S1MI 2DE6A 1L1OC 3H3VJ 1LQLA 3VMHA 3GTKI 3S16I 4QTTA 3GTQI 1QYPA 1WCMI 3M4OI 2R92I 4X6AI 4NOZA 2JA5I 3H0GI 4NBFA 4A3II 4XX2A 2JA7I 4A3BI 4A93I 2KPIA 1RLYA 3HOXI 4NBHA 1VLAA 3S1RI 1ZB8A 2JA8I 1N2FA 3S1QI 3PO3S 1K83I 2K5RA 2JA6I 2RBLA 2B63I 3GTMS 1R9TI 2E2HI 4QTUA 2AKLA 5CM2M 4NBBA 1Y1VS 3GTGI 3GTOI 4BBRI 4NB9A 4NB8A 1TWCI 3ESWA 4A3KI 3S15I 4BY7I 3RZDI 3M3YI 4NBGA 3HOVI 1ZB9A 2JS4A 1X3WA 2F4OA 5C4JI 2PK7A 1RO4A 2E2II 4BBSI
chains in the Genus database with same CATH superfamily
4AYBA 1QVGZ 2QEXZ 2P3YA 2V8IA 3I56Z 3IR7A 5IP9I 3GTMI 3I07A 3S14I 3CMAZ 2NVXI 1TFIA 1KRLA 1TWGI 3FQMA 3HOZI 2I3CA 1NP6A 2E9HA 4Y7NI 2H85A 3CCMZ 2LIYA 4RVGA 2JUBA 3I4NI 1YI2Z 4A3DI 4BY1I 3NFZA 4MONA 4EWCA 1Q821 3VMGA 4BXXI 1YIT1 2JIOA 1M902 3CCRZ 3S17I 2JIQA 4A3EI 1S7MA 1NUIA 1YHQ1 2JMOA 4MRIA 2WB1A 4S1TA 2ZAEB 1K9M1 2PM9A 1KD11 1I3QI 3GTPI 3J81f 3K7AI 4A3FI 2GTHA 3EERA 5IP7I 1K8A2 3TDHB 3CCVZ 1VQPZ 3IF8A 4E2ZA 1Z03A 1LQLA 3CCSZ 1YJNZ 2QRCB 4QTTA 3HKZA 1AA6A 1VQ5Z 2OZKA 5AN9F 3MONA 4NOZA 1Q16A 2IZ4A 4XX2A 4A3BI 1RLYA 4NBHA 5D1PA 1KC82 1VQ71 3S1RI 1VQNZ 3G71Z 4HGYA 1K83I 3I551 2JA6I 3CCJZ 1Q862 1R9TI 1W2BZ 1QF8A 1ZH1A 2AKLA 3GTGI 4BBRI 4NB9A 1Q811 3I561 3P5JB 4DGLA 1K732 1VQ61 3TE5B 3G4S1 2JS4A 2RIQA 1QVFY 2M48A 4E2YA 1VQ41 1RO4A 1VQ8Z 4MD7A 1NJI1 1FDIA 3D6WA 2BJOA 3PO3I 3VTNA 4RS4A 5IT9b 1YI21 3CC4Z 3CC2Z 2NVQI 2RT9A 2RPRA 1TWFI 1Y1VI 3JAMb 2K3RA 3PO2I 2PMZA 3VB9A 3QWUA 2QA4Z 3HOUI 3CCL1 2VUMI 2W04A 4CL1A 4NBAA 4MH4A 1Y1WI 3GTLI 1VQO1 1RO2A 1TWAI 3CCU1 3F3PC 2VPXA 1Q822 5D1OB 1VQP1 2HF1A 1X3ZA 2VUGA 1QVGY 3CME1 3J7A4 1DL6A 1WIIA 3G6E1 3Q87A 2AYDA 1K9M2 5C44I 2LEXA 2E2JI 2OTJ1 5C3EI 1Q7Y2 3S1MI 1L1OC 3D9XA 3VMHA 3GTKI 1VQN1 1X0TA 2VF1A 1YJ91 2Q51A 3CCEZ 1S72Z 1JJ2Z 4X6AI 2O4HA 2VPZA 3H0GI 5D1OA 1VQL1 2KPIA 2QREB 3HOXI 1WJ2A 2Q4ZA 1ZB8A 1YJWZ 3F3FC 1JJ2Y 2B63I 2E2HI 4QTUA 3J80b 5CM2M 2OOXB 1SIWA 4NB8A 4E30A 1TWCI 3ESWA 3CC41 4A3KI 4BY7I 3M3YI 1Q812 3CXCZ 2P28A 1JWHC 5LL6f 2O53A 3FQQA 4BBSI 1M901 4A3JI 1TWHI 4Y52I 3U50C 3FKII 3LUSA 2J6AA 1KQSZ 3MZKB 2OOYB 2V3VA 1VQM1 5FLXf 2EGTA 3VMIA 2QEX1 4MD8A 3CQZI 1YUKA 2V45A 4A3CI 5A2Qf 1K8A1 3CD6Z 3CMA1 3GCFA 1W2BY 2G2KA 2VPWA 1VQ9Z 5T6BA 2DE5A 2R93I 2YU9I 1YHQZ 1M1K2 3RZOI 1I50I 3CCM1 2JR6A 4A3LI 2DE7A 1Z01A 4NBEA 2V8JA 3CCR1 3D2LA 1WW9A 4DK1A 2OTLZ 1YIJZ 4HH4A 2F4MA 4E2WA 1Q861 3S2HI 5FLMI 2QKDA 2KI7B 3BG1B 2JNYA 1N8R1 2DE6A 2W03A 3H3VJ 2GU2A 3CCV1 1K731 4NFRA 1WCMI 1VQ7Z 2R92I 1YJN1 3CCS1 3CCQZ 2JA5I 4NBFA 4A3II 3I55Z 4A93I 1VQ51 3CC7Z 1VLAA 3NH4A 1KD12 3JAMf 3BG0B 1N2FA 3S1QI 3NH5A 4MXUA 3GTMS 3J81b 4DQYB 3EEDA 3KIHA 4NBBA 3G711 1VQ6Z 3GTOI 3G4SZ 5T67A 2YADA 4HGZA 1VQ4Z 3CCJ1 2JIMA 3S15I 2HU9A 2JIRA 1ZB9A 4E33A 1X3WA 2F4OA 1FDOA 4RVFA 2M6NA 2JA7I 2E2II 2Y0SA 3CD61 3I4MI 3OW2Z 1VQ91 1USPB 2NVTI 1VQ81 2R7ZI 4RVDA 3CCLZ 3GTJI 3GKQA 1VQKZ 3OW2Y 4NBCA 1VQOZ 3CC21 1Q7Y1 5FLXb 3HOWI 4MD9A 3CCUZ 1ML8A 2IV2X 2QA41 1PFTA 5A2Qb 4NH1C 2OTL1 2NVYI 1YIJ1 1I6HI 3HOYI 1P9NA 3NH8A 1RQFA 4TNUA 3S2DI 3CMEZ 2E7ZA 5T64A 1WZNA 4RV9A 5C4XI 3CXCY 1NJI2 2QRDB 2V8KA 3CPWZ 3G6EZ 2OTJZ 2WAQA 3S1NI 1YUAA 4A3MI 1USPA 4A3GI 4RVHA 2RHBA 2R6MA 3J80f 1KQSY 2NAPA 2LFUA 1YITZ 3CCQ1 3CPWY 4NBDA 3KIFA 1YJ9Z 3NDJA 1SFOI 1Z02A 3CC71 3S16I 1QVFZ 1N8R2 1VQLZ 3GTQI 1QYPA 3NDIA 4E2XA 3M4OI 1RNIA 2JIPA 1KC81 2QR1B 1QXFA 3CCE1 1S721 4E31A 2IZ3A 3MZLB 2JA8I 3PO3S 2K5RA 2RBLA 1Y8CA 1YJW1 1RO0A 1Y1VS 2QLVB 2VPYA 3T4NB 4NBGA 3RZDI 3HOVI 5IT9f 3IFUA 4E32A 1M1K1 5C4JI 3IX0A 2PK7A 1VQMZ 2GTIA 1VQK1
chains in the Genus database with same CATH topology
4AYBA 1QVGZ 2QEXZ 2P3YA 2V8IA 3I56Z 5IP9I 3GTMI 3I07A 3S14I 3CMAZ 2NVXI 1TFIA 1KRLA 1TWGI 3FQMA 3HOZI 2I3CA 1NP6A 2E9HA 4Y7NI 2H85A 3CCMZ 2LIYA 4RVGA 2JUBA 3I4NI 1YI2Z 4A3DI 4BY1I 3NFZA 4MONA 4EWCA 1Q821 3VMGA 4BXXI 1YIT1 1M902 3CCRZ 3S17I 4A3EI 1S7MA 1NUIA 1YHQ1 2JMOA 4MRIA 2WB1A 4S1TA 2ZAEB 1K9M1 2PM9A 1KD11 1I3QI 3GTPI 3J81f 3K7AI 4A3FI 2GTHA 3EERA 5IP7I 1K8A2 3TDHB 3CCVZ 1VQPZ 3IF8A 4E2ZA 1Z03A 1LQLA 3CCSZ 1YJNZ 2QRCB 4QTTA 3HKZA 1VQ5Z 2OZKA 5AN9F 3MONA 4NOZA 2IZ4A 4XX2A 4A3BI 1RLYA 4NBHA 5D1PA 1KC82 1VQ71 3S1RI 1VQNZ 3G71Z 4HGYA 1K83I 3I551 2JA6I 3CCJZ 1Q862 1R9TI 1W2BZ 1QF8A 1ZH1A 2AKLA 3GTGI 4BBRI 4NB9A 1Q811 3I561 3P5JB 4DGLA 1K732 1VQ61 3TE5B 3G4S1 2JS4A 2RIQA 1QVFY 2M48A 4E2YA 1VQ41 1RO4A 1VQ8Z 4MD7A 1NJI1 3D6WA 2BJOA 3PO3I 3VTNA 4RS4A 5IT9b 1YI21 3CC4Z 3CC2Z 2NVQI 2RT9A 2RPRA 1TWFI 1Y1VI 3JAMb 2K3RA 3PO2I 2PMZA 3VB9A 3QWUA 2QA4Z 3HOUI 3CCL1 2VUMI 2W04A 4CL1A 4NBAA 4MH4A 1Y1WI 3GTLI 1VQO1 1RO2A 1TWAI 3CCU1 3F3PC 1Q822 5D1OB 1VQP1 2HF1A 1X3ZA 2VUGA 1QVGY 3CME1 3J7A4 1DL6A 1WIIA 3G6E1 3Q87A 1K9M2 2OTJ1 5C44I 2E2JI 5C3EI 1Q7Y2 3S1MI 1L1OC 3D9XA 3VMHA 3GTKI 1VQN1 1X0TA 2VF1A 1YJ91 2Q51A 3CCEZ 1S72Z 1JJ2Z 4X6AI 2O4HA 3H0GI 5D1OA 1VQL1 2KPIA 2QREB 3HOXI 2Q4ZA 1ZB8A 1YJWZ 3F3FC 1JJ2Y 2B63I 2E2HI 4QTUA 3J80b 5CM2M 2OOXB 4NB8A 4E30A 1TWCI 3ESWA 3CC41 4A3KI 4BY7I 3M3YI 1Q812 3CXCZ 2P28A 1JWHC 5LL6f 2O53A 3FQQA 4BBSI 1M901 4A3JI 1TWHI 4Y52I 3U50C 3FKII 3LUSA 2J6AA 1KQSZ 3MZKB 2OOYB 1VQM1 5FLXf 2EGTA 3VMIA 2QEX1 4MD8A 3CQZI 1YUKA 4A3CI 5A2Qf 1K8A1 3CD6Z 3CMA1 3GCFA 1W2BY 2G2KA 1VQ9Z 5T6BA 2DE5A 2R93I 2YU9I 1YHQZ 1M1K2 3RZOI 1I50I 3CCM1 2JR6A 4A3LI 2DE7A 1Z01A 4NBEA 2V8JA 3CCR1 1WW9A 4DK1A 2OTLZ 1YIJZ 4HH4A 2F4MA 4E2WA 1Q861 3S2HI 5FLMI 2QKDA 2KI7B 3BG1B 2JNYA 1N8R1 2DE6A 2W03A 3H3VJ 2GU2A 3CCV1 1K731 4NFRA 1WCMI 1VQ7Z 2R92I 1YJN1 3CCS1 3CCQZ 2JA5I 4NBFA 4A3II 3I55Z 4A93I 1VQ51 3CC7Z 1VLAA 3NH4A 1KD12 3JAMf 3BG0B 1N2FA 3S1QI 3NH5A 4MXUA 3GTMS 3J81b 4DQYB 3EEDA 3KIHA 4NBBA 3G711 1VQ6Z 3GTOI 3G4SZ 5T67A 2YADA 4HGZA 1VQ4Z 3CCJ1 3S15I 2HU9A 1ZB9A 4E33A 1X3WA 2F4OA 4RVFA 2M6NA 2JA7I 2E2II 2Y0SA 3CD61 3I4MI 3OW2Z 1VQ91 1USPB 2NVTI 1VQ81 2R7ZI 4RVDA 3CCLZ 3GTJI 3GKQA 1VQKZ 3OW2Y 4NBCA 1VQOZ 3CC21 1Q7Y1 5FLXb 3HOWI 4MD9A 3CCUZ 1ML8A 2QA41 1PFTA 5A2Qb 4NH1C 2OTL1 2NVYI 1YIJ1 1I6HI 3HOYI 1P9NA 3NH8A 1RQFA 4TNUA 3S2DI 3CMEZ 5T64A 4RV9A 5C4XI 1NJI2 3CXCY 2QRDB 2V8KA 3CPWZ 3G6EZ 2OTJZ 2WAQA 3S1NI 1YUAA 4A3MI 1USPA 4A3GI 4RVHA 2RHBA 2R6MA 3J80f 1KQSY 2LFUA 1YITZ 3CCQ1 3CPWY 4NBDA 3KIFA 1YJ9Z 3NDJA 1SFOI 1Z02A 3CC71 3S16I 1QVFZ 1N8R2 1VQLZ 3GTQI 1QYPA 3NDIA 4E2XA 3M4OI 1RNIA 1KC81 2QR1B 3CCE1 1S721 4E31A 2IZ3A 3MZLB 2JA8I 3PO3S 2K5RA 2RBLA 1YJW1 1RO0A 1Y1VS 2QLVB 3T4NB 3RZDI 4NBGA 3HOVI 5IT9f 3IFUA 4E32A 1M1K1 5C4JI 3IX0A 2PK7A 1VQMZ 2GTIA 1VQK1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3J I;  1TWH I;  4Y52 I;  3D6W A;  2P3Y A;  3U50 C;  2BJO A;  3I4M I;  3PO3 I;  3FKI I;  3LUS A;  5IP9 I;  2J6A A;  2NVT I;  1USP B;  3GTM I;  3I07 A;  3S14 I;  2NVQ I;  2R7Z I;  3VMI A;  1TWF I;  2NVX I;  1Y1V I;  3GTJ I;  1TFI A;  3CQZ I;  1TWG I;  3GKQ A;  3PO2 I;  3VB9 A;  3HOZ I;  4A3C I;  4NBC A;  3HOU I;  3GCF A;  4Y7N I;  2VUM I;  3HOW I;  3I4N I;  4NBA A;  4MH4 A;  1Y1W I;  4A3D I;  1ML8 A;  2DE5 A;  1PFT A;  3GTL I;  4BY1 I;  2R93 I;  2YU9 I;  2NVY I;  3RZO I;  1TWA I;  1I50 I;  3VMG A;  1I6H I;  3HOY I;  2JR6 A;  3S2D I;  4BXX I;  5C4X I;  3S17 I;  4A3L I;  4A3E I;  2DE7 A;  1NUI A;  2HF1 A;  4NBE A;  1X3Z A;  3S1N I;  1YUA A;  4A3M I;  1USP A;  4A3G I;  1DL6 A;  1I3Q I;  1WW9 A;  3GTP I;  3K7A I;  4A3F I;  3Q87 A;  2F4M A;  5C44 I;  3EER A;  2E2J I;  3S2H I;  5IP7 I;  5FLM I;  5C3E I;  4NBD A;  2JNY A;  1SFO I;  3S1M I;  2DE6 A;  1L1O C;  3H3V J;  1LQL A;  3VMH A;  3GTK I;  3S16 I;  4QTT A;  3GTQ I;  1QYP A;  1WCM I;  3M4O I;  2R92 I;  4X6A I;  4NOZ A;  2JA5 I;  3H0G I;  4NBF A;  4A3I I;  4XX2 A;  2JA7 I;  4A3B I;  4A93 I;  2KPI A;  1RLY A;  3HOX I;  4NBH A;  1VLA A;  3S1R I;  1ZB8 A;  2JA8 I;  1N2F A;  3S1Q I;  3PO3 S;  1K83 I;  2K5R A;  2JA6 I;  2RBL A;  2B63 I;  3GTM S;  1R9T I;  2E2H I;  4QTU A;  2AKL A;  5CM2 M;  4NBB A;  1Y1V S;  3GTG I;  3GTO I;  4BBR I;  4NB9 A;  4NB8 A;  1TWC I;  3ESW A;  4A3K I;  3S15 I;  4BY7 I;  3RZD I;  3M3Y I;  4NBG A;  3HOV I;  1ZB9 A;  2JS4 A;  1X3W A;  2F4O A;  5C4J I;  2PK7 A;  1RO4 A;  2E2I I;  4BBS I; 
#chains in the Genus database with same CATH topology
 4AYB A;  1QVG Z;  2QEX Z;  2P3Y A;  2V8I A;  3I56 Z;  3IR7 A;  5IP9 I;  3GTM I;  3I07 A;  3S14 I;  3CMA Z;  2NVX I;  1TFI A;  1KRL A;  1TWG I;  3FQM A;  3HOZ I;  2I3C A;  1NP6 A;  2E9H A;  4Y7N I;  2H85 A;  3CCM Z;  2LIY A;  4RVG A;  2JUB A;  3I4N I;  1YI2 Z;  4A3D I;  4BY1 I;  3NFZ A;  4MON A;  4EWC A;  1Q82 1;  3VMG A;  4BXX I;  1YIT 1;  2JIO A;  1M90 2;  3CCR Z;  3S17 I;  2JIQ A;  4A3E I;  1S7M A;  1NUI A;  1YHQ 1;  2JMO A;  4MRI A;  2WB1 A;  4S1T A;  2ZAE B;  1K9M 1;  2PM9 A;  1KD1 1;  1I3Q I;  3GTP I;  3J81 f;  3K7A I;  4A3F I;  2GTH A;  3EER A;  5IP7 I;  1K8A 2;  3TDH B;  3CCV Z;  1VQP Z;  3IF8 A;  4E2Z A;  1Z03 A;  1LQL A;  3CCS Z;  1YJN Z;  2QRC B;  4QTT A;  3HKZ A;  1AA6 A;  1VQ5 Z;  2OZK A;  5AN9 F;  3MON A;  4NOZ A;  1Q16 A;  2IZ4 A;  4XX2 A;  4A3B I;  1RLY A;  4NBH A;  5D1P A;  1KC8 2;  1VQ7 1;  3S1R I;  1VQN Z;  3G71 Z;  4HGY A;  1K83 I;  3I55 1;  2JA6 I;  3CCJ Z;  1Q86 2;  1R9T I;  1W2B Z;  1QF8 A;  1ZH1 A;  2AKL A;  3GTG I;  4BBR I;  4NB9 A;  1Q81 1;  3I56 1;  3P5J B;  4DGL A;  1K73 2;  1VQ6 1;  3TE5 B;  3G4S 1;  2JS4 A;  2RIQ A;  1QVF Y;  2M48 A;  4E2Y A;  1VQ4 1;  1RO4 A;  1VQ8 Z;  4MD7 A;  1NJI 1;  1FDI A;  3D6W A;  2BJO A;  3PO3 I;  3VTN A;  4RS4 A;  5IT9 b;  1YI2 1;  3CC4 Z;  3CC2 Z;  2NVQ I;  2RT9 A;  2RPR A;  1TWF I;  1Y1V I;  3JAM b;  2K3R A;  3PO2 I;  2PMZ A;  3VB9 A;  3QWU A;  2QA4 Z;  3HOU I;  3CCL 1;  2VUM I;  2W04 A;  4CL1 A;  4NBA A;  4MH4 A;  1Y1W I;  3GTL I;  1VQO 1;  1RO2 A;  1TWA I;  3CCU 1;  3F3P C;  2VPX A;  1Q82 2;  5D1O B;  1VQP 1;  2HF1 A;  1X3Z A;  2VUG A;  1QVG Y;  3CME 1;  3J7A 4;  1DL6 A;  1WII A;  3G6E 1;  3Q87 A;  2AYD A;  1K9M 2;  5C44 I;  2LEX A;  2E2J I;  2OTJ 1;  5C3E I;  1Q7Y 2;  3S1M I;  1L1O C;  3D9X A;  3VMH A;  3GTK I;  1VQN 1;  1X0T A;  2VF1 A;  1YJ9 1;  2Q51 A;  3CCE Z;  1S72 Z;  1JJ2 Z;  4X6A I;  2O4H A;  2VPZ A;  3H0G I;  5D1O A;  1VQL 1;  2KPI A;  2QRE B;  3HOX I;  1WJ2 A;  2Q4Z A;  1ZB8 A;  1YJW Z;  3F3F C;  1JJ2 Y;  2B63 I;  2E2H I;  4QTU A;  3J80 b;  5CM2 M;  2OOX B;  1SIW A;  4NB8 A;  4E30 A;  1TWC I;  3ESW A;  3CC4 1;  4A3K I;  4BY7 I;  3M3Y I;  1Q81 2;  3CXC Z;  2P28 A;  1JWH C;  5LL6 f;  2O53 A;  3FQQ A;  4BBS I;  1M90 1;  4A3J I;  1TWH I;  4Y52 I;  3U50 C;  3FKI I;  3LUS A;  2J6A A;  1KQS Z;  3MZK B;  2OOY B;  2V3V A;  1VQM 1;  5FLX f;  2EGT A;  3VMI A;  2QEX 1;  4MD8 A;  3CQZ I;  1YUK A;  2V45 A;  4A3C I;  5A2Q f;  1K8A 1;  3CD6 Z;  3CMA 1;  3GCF A;  1W2B Y;  2G2K A;  2VPW A;  1VQ9 Z;  5T6B A;  2DE5 A;  2R93 I;  2YU9 I;  1YHQ Z;  1M1K 2;  3RZO I;  1I50 I;  3CCM 1;  2JR6 A;  4A3L I;  2DE7 A;  1Z01 A;  4NBE A;  2V8J A;  3CCR 1;  3D2L A;  1WW9 A;  4DK1 A;  2OTL Z;  1YIJ Z;  4HH4 A;  2F4M A;  4E2W A;  1Q86 1;  3S2H I;  5FLM I;  2QKD A;  2KI7 B;  3BG1 B;  2JNY A;  1N8R 1;  2DE6 A;  2W03 A;  3H3V J;  2GU2 A;  3CCV 1;  1K73 1;  4NFR A;  1WCM I;  1VQ7 Z;  2R92 I;  1YJN 1;  3CCS 1;  3CCQ Z;  2JA5 I;  4NBF A;  4A3I I;  3I55 Z;  4A93 I;  1VQ5 1;  3CC7 Z;  1VLA A;  3NH4 A;  1KD1 2;  3JAM f;  3BG0 B;  1N2F A;  3S1Q I;  3NH5 A;  4MXU A;  3GTM S;  3J81 b;  4DQY B;  3EED A;  3KIH A;  4NBB A;  3G71 1;  1VQ6 Z;  3GTO I;  3G4S Z;  5T67 A;  2YAD A;  4HGZ A;  1VQ4 Z;  3CCJ 1;  2JIM A;  3S15 I;  2HU9 A;  2JIR A;  1ZB9 A;  4E33 A;  1X3W A;  2F4O A;  1FDO A;  4RVF A;  2M6N A;  2JA7 I;  2E2I I;  2Y0S A;  3CD6 1;  3I4M I;  3OW2 Z;  1VQ9 1;  1USP B;  2NVT I;  1VQ8 1;  2R7Z I;  4RVD A;  3CCL Z;  3GTJ I;  3GKQ A;  1VQK Z;  3OW2 Y;  4NBC A;  1VQO Z;  3CC2 1;  1Q7Y 1;  5FLX b;  3HOW I;  4MD9 A;  3CCU Z;  1ML8 A;  2IV2 X;  2QA4 1;  1PFT A;  5A2Q b;  4NH1 C;  2OTL 1;  2NVY I;  1YIJ 1;  1I6H I;  3HOY I;  1P9N A;  3NH8 A;  1RQF A;  4TNU A;  3S2D I;  3CME Z;  2E7Z A;  5T64 A;  1WZN A;  4RV9 A;  5C4X I;  3CXC Y;  1NJI 2;  2QRD B;  2V8K A;  3CPW Z;  3G6E Z;  2OTJ Z;  2WAQ A;  3S1N I;  1YUA A;  4A3M I;  1USP A;  4A3G I;  4RVH A;  2RHB A;  2R6M A;  3J80 f;  1KQS Y;  2NAP A;  2LFU A;  1YIT Z;  3CCQ 1;  3CPW Y;  4NBD A;  3KIF A;  1YJ9 Z;  3NDJ A;  1SFO I;  1Z02 A;  3CC7 1;  3S16 I;  1QVF Z;  1N8R 2;  1VQL Z;  3GTQ I;  1QYP A;  3NDI A;  4E2X A;  3M4O I;  1RNI A;  2JIP A;  1KC8 1;  2QR1 B;  1QXF A;  3CCE 1;  1S72 1;  4E31 A;  2IZ3 A;  3MZL B;  2JA8 I;  3PO3 S;  2K5R A;  2RBL A;  1Y8C A;  1YJW 1;  1RO0 A;  1Y1V S;  2QLV B;  2VPY A;  3T4N B;  4NBG A;  3RZD I;  3HOV I;  5IT9 f;  3IFU A;  4E32 A;  1M1K 1;  5C4J I;  3IX0 A;  2PK7 A;  1VQM Z;  2GTI A;  1VQK 1; 
#chains in the Genus database with same CATH homology
 4AYB A;  1QVG Z;  2QEX Z;  2P3Y A;  2V8I A;  3I56 Z;  5IP9 I;  3GTM I;  3I07 A;  3S14 I;  3CMA Z;  2NVX I;  1TFI A;  1KRL A;  1TWG I;  3FQM A;  3HOZ I;  2I3C A;  1NP6 A;  2E9H A;  4Y7N I;  2H85 A;  3CCM Z;  2LIY A;  4RVG A;  2JUB A;  3I4N I;  1YI2 Z;  4A3D I;  4BY1 I;  3NFZ A;  4MON A;  4EWC A;  1Q82 1;  3VMG A;  4BXX I;  1YIT 1;  1M90 2;  3CCR Z;  3S17 I;  4A3E I;  1S7M A;  1NUI A;  1YHQ 1;  2JMO A;  4MRI A;  2WB1 A;  4S1T A;  2ZAE B;  1K9M 1;  2PM9 A;  1KD1 1;  1I3Q I;  3GTP I;  3J81 f;  3K7A I;  4A3F I;  2GTH A;  3EER A;  5IP7 I;  1K8A 2;  3TDH B;  3CCV Z;  1VQP Z;  3IF8 A;  4E2Z A;  1Z03 A;  1LQL A;  3CCS Z;  1YJN Z;  2QRC B;  4QTT A;  3HKZ A;  1VQ5 Z;  2OZK A;  5AN9 F;  3MON A;  4NOZ A;  2IZ4 A;  4XX2 A;  4A3B I;  1RLY A;  4NBH A;  5D1P A;  1KC8 2;  1VQ7 1;  3S1R I;  1VQN Z;  3G71 Z;  4HGY A;  1K83 I;  3I55 1;  2JA6 I;  3CCJ Z;  1Q86 2;  1R9T I;  1W2B Z;  1QF8 A;  1ZH1 A;  2AKL A;  3GTG I;  4BBR I;  4NB9 A;  1Q81 1;  3I56 1;  3P5J B;  4DGL A;  1K73 2;  1VQ6 1;  3TE5 B;  3G4S 1;  2JS4 A;  2RIQ A;  1QVF Y;  2M48 A;  4E2Y A;  1VQ4 1;  1RO4 A;  1VQ8 Z;  4MD7 A;  1NJI 1;  3D6W A;  2BJO A;  3PO3 I;  3VTN A;  4RS4 A;  5IT9 b;  1YI2 1;  3CC4 Z;  3CC2 Z;  2NVQ I;  2RT9 A;  2RPR A;  1TWF I;  1Y1V I;  3JAM b;  2K3R A;  3PO2 I;  2PMZ A;  3VB9 A;  3QWU A;  2QA4 Z;  3HOU I;  3CCL 1;  2VUM I;  2W04 A;  4CL1 A;  4NBA A;  4MH4 A;  1Y1W I;  3GTL I;  1VQO 1;  1RO2 A;  1TWA I;  3CCU 1;  3F3P C;  1Q82 2;  5D1O B;  1VQP 1;  2HF1 A;  1X3Z A;  2VUG A;  1QVG Y;  3CME 1;  3J7A 4;  1DL6 A;  1WII A;  3G6E 1;  3Q87 A;  1K9M 2;  2OTJ 1;  5C44 I;  2E2J I;  5C3E I;  1Q7Y 2;  3S1M I;  1L1O C;  3D9X A;  3VMH A;  3GTK I;  1VQN 1;  1X0T A;  2VF1 A;  1YJ9 1;  2Q51 A;  3CCE Z;  1S72 Z;  1JJ2 Z;  4X6A I;  2O4H A;  3H0G I;  5D1O A;  1VQL 1;  2KPI A;  2QRE B;  3HOX I;  2Q4Z A;  1ZB8 A;  1YJW Z;  3F3F C;  1JJ2 Y;  2B63 I;  2E2H I;  4QTU A;  3J80 b;  5CM2 M;  2OOX B;  4NB8 A;  4E30 A;  1TWC I;  3ESW A;  3CC4 1;  4A3K I;  4BY7 I;  3M3Y I;  1Q81 2;  3CXC Z;  2P28 A;  1JWH C;  5LL6 f;  2O53 A;  3FQQ A;  4BBS I;  1M90 1;  4A3J I;  1TWH I;  4Y52 I;  3U50 C;  3FKI I;  3LUS A;  2J6A A;  1KQS Z;  3MZK B;  2OOY B;  1VQM 1;  5FLX f;  2EGT A;  3VMI A;  2QEX 1;  4MD8 A;  3CQZ I;  1YUK A;  4A3C I;  5A2Q f;  1K8A 1;  3CD6 Z;  3CMA 1;  3GCF A;  1W2B Y;  2G2K A;  1VQ9 Z;  5T6B A;  2DE5 A;  2R93 I;  2YU9 I;  1YHQ Z;  1M1K 2;  3RZO I;  1I50 I;  3CCM 1;  2JR6 A;  4A3L I;  2DE7 A;  1Z01 A;  4NBE A;  2V8J A;  3CCR 1;  1WW9 A;  4DK1 A;  2OTL Z;  1YIJ Z;  4HH4 A;  2F4M A;  4E2W A;  1Q86 1;  3S2H I;  5FLM I;  2QKD A;  2KI7 B;  3BG1 B;  2JNY A;  1N8R 1;  2DE6 A;  2W03 A;  3H3V J;  2GU2 A;  3CCV 1;  1K73 1;  4NFR A;  1WCM I;  1VQ7 Z;  2R92 I;  1YJN 1;  3CCS 1;  3CCQ Z;  2JA5 I;  4NBF A;  4A3I I;  3I55 Z;  4A93 I;  1VQ5 1;  3CC7 Z;  1VLA A;  3NH4 A;  1KD1 2;  3JAM f;  3BG0 B;  1N2F A;  3S1Q I;  3NH5 A;  4MXU A;  3GTM S;  3J81 b;  4DQY B;  3EED A;  3KIH A;  4NBB A;  3G71 1;  1VQ6 Z;  3GTO I;  3G4S Z;  5T67 A;  2YAD A;  4HGZ A;  1VQ4 Z;  3CCJ 1;  3S15 I;  2HU9 A;  1ZB9 A;  4E33 A;  1X3W A;  2F4O A;  4RVF A;  2M6N A;  2JA7 I;  2E2I I;  2Y0S A;  3CD6 1;  3I4M I;  3OW2 Z;  1VQ9 1;  1USP B;  2NVT I;  1VQ8 1;  2R7Z I;  4RVD A;  3CCL Z;  3GTJ I;  3GKQ A;  1VQK Z;  3OW2 Y;  4NBC A;  1VQO Z;  3CC2 1;  1Q7Y 1;  5FLX b;  3HOW I;  4MD9 A;  3CCU Z;  1ML8 A;  2QA4 1;  1PFT A;  5A2Q b;  4NH1 C;  2OTL 1;  2NVY I;  1YIJ 1;  1I6H I;  3HOY I;  1P9N A;  3NH8 A;  1RQF A;  4TNU A;  3S2D I;  3CME Z;  5T64 A;  4RV9 A;  5C4X I;  1NJI 2;  3CXC Y;  2QRD B;  2V8K A;  3CPW Z;  3G6E Z;  2OTJ Z;  2WAQ A;  3S1N I;  1YUA A;  4A3M I;  1USP A;  4A3G I;  4RVH A;  2RHB A;  2R6M A;  3J80 f;  1KQS Y;  2LFU A;  1YIT Z;  3CCQ 1;  3CPW Y;  4NBD A;  3KIF A;  1YJ9 Z;  3NDJ A;  1SFO I;  1Z02 A;  3CC7 1;  3S16 I;  1QVF Z;  1N8R 2;  1VQL Z;  3GTQ I;  1QYP A;  3NDI A;  4E2X A;  3M4O I;  1RNI A;  1KC8 1;  2QR1 B;  3CCE 1;  1S72 1;  4E31 A;  2IZ3 A;  3MZL B;  2JA8 I;  3PO3 S;  2K5R A;  2RBL A;  1YJW 1;  1RO0 A;  1Y1V S;  2QLV B;  3T4N B;  3RZD I;  4NBG A;  3HOV I;  5IT9 f;  3IFU A;  4E32 A;  1M1K 1;  5C4J I;  3IX0 A;  2PK7 A;  1VQM Z;  2GTI A;  1VQK 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...