4QTTA

Structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
MKFLTTNFLKCSVKACDTSNDNFPLQYDGSKCQLVQDESIEFNPEFLLNIVDRVDWPAVLTVAAELGNNALPPTKPSFPSSIQELTDDDMAILNDLHTLLLQTSIAEGEMKCRNCGHIYYIKNGIPNLLLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Multifunctional methyltransferase subunit TRM112
publication title Structural and functional studies of Bud23-Trm112 reveal 18S rRNA N7-G1575 methylation occurs on late 40S precursor ribosomes
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Transferase
total genus 34
structure length 132
sequence length 132
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03966 Trm112p Trm112p-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4qttA00
3GTJI 4Y52I 3S2HI 3HOUI 2YU9I 2JA6I 5C44I 1TWCI 2NVXI 3S2DI 1I50I 1TFIA 2JR6A 4NBBA 3S16I 1TWHI 2VUMI 1X3WA 3RZOI 2JNYA 1TWAI 2B63I 4A3MI 3GTQI 5CM2M 1TWFI 1Y1WI 3VMGA 1Y1VS 2R93I 3GTMI 4A3FI 3K7AI 3LUSA 4MH4A 4NBGA 2DE7A 4BBSI 4BXXI 3CQZI 3FKII 4A93I 1USPA 4A3GI 3VMHA 2J6AA 4QTTA 5IP9I 1ZB8A 1NUIA 5FLMI 3VMIA 4NBFA 3PO3S 2AKLA 1PFTA 3S14I 3S15I 2NVTI 1X3ZA 2NVQI 3S1RI 3HOWI 2KPIA 1ZB9A 3HOYI 5IP7I 3PO2I 3M3YI 3I4NI 4BY7I 2E2II 3GKQA 1N2FA 5C4JI 4NBDA 1WCMI 3GTKI 2JA8I 1I6HI 2JA5I 3GTGI 2F4OA 4A3DI 2JS4A 4NBAA 3S17I 2DE6A 3D6WA 4XX2A 3HOXI 1L1OC 1SFOI 4NB8A 3EERA 3Q87A 3HOZI 2HF1A 4BBRI 3S1QI 4QTUA 2BJOA 2P3YA 2RBLA 2PK7A 4Y7NI 1YUAA 1RLYA 2F4MA 2E2HI 2JA7I 3I4MI 3M4OI 3PO3I 1TWGI 4A3LI 4A3CI 3U50C 1R9TI 3ESWA 2DE5A 3S1MI 2NVYI 3GTLI 3HOVI 2K5RA 2R7ZI 5C4XI 1Y1VI 3S1NI 1K83I 1ML8A 1RO4A 4A3BI 1VLAA 4A3KI 4A3JI 1QYPA 3H3VJ 2E2JI 1USPB 1LQLA 1I3QI 1WW9A 4NBCA 3GTOI 4A3EI 4X6AI 4BY1I 3GTPI 1DL6A 3H0GI 4A3II 3GCFA 3RZDI 4NOZA 3VB9A 4NBHA 5C3EI 2R92I 3GTMS 4NBEA 3I07A 4NB9A
chains in the Genus database with same CATH superfamily
4E2XA 3GTJI 2YU9I 3NH8A 5C44I 2RPRA 5FLXf 1S7MA 4HGZA 4NBBA 4RVGA 1N8R2 1TWAI 3I561 1TWFI 1K9M2 3GTMI 3LUSA 3I56Z 3FQQA 1K8A2 1RQFA 4RV9A 3NFZA 1NUIA 1K9M1 4TNUA 3VMIA 4S1TA 3NDJA 2NVTI 1M1K1 1K8A1 2E7ZA 3HOYI 5IP7I 4BY7I 1M902 1VQO1 2M6NA 5C4JI 1YIJ1 3GTKI 1VQ81 2JA5I 2JS4A 2W03A 4RVHA 4XX2A 2KI7B 3HOXI 1VQ8Z 1L1OC 1VQK1 1SFOI 2HF1A 4E31A 4EWCA 1VQKZ 2BJOA 2H85A 3I4MI 2JA7I 2HU9A 1RO2A 2EGTA 3CCJ1 5T64A 2RHBA 3HKZA 4NH1C 3ESWA 1NJI1 3CCV1 2DE5A 2NVYI 3CCJZ 3GTLI 1WZNA 3CCVZ 1W2BY 2R7ZI 2QA41 3CPWZ 2YADA 1K83I 1RO4A 3NH4A 3CPWY 5IT9b 2QA4Z 3CXCZ 3H3VJ 2AYDA 3CXCY 3CCL1 2E2JI 1LQLA 1I3QI 1WW9A 5T67A 1SIWA 4X6AI 3CCLZ 4BY1I 3GCFA 4CL1A 4NOZA 2QRDB 5C3EI 2R92I 4NBEA 2QREB 2GTHA 2JMOA 4DK1A 5IT9f 1X0TA 5LL6f 1I50I 3CC21 1JWHC 2VUMI 3CC2Z 1Q16A 2VF1A 3TDHB 2LEXA 2JNYA 2OOYB 4MD7A 3G711 3F3PC 4NBGA 1VQM1 4BXXI 3CD61 3CQZI 4A93I 3G71Z 1YJN1 2V3VA 3VMHA 4QTTA 5T6BA 1VQMZ 3CD6Z 1YJNZ 1KC82 4RVDA 3BG0B 4NBFA 3PO3S 3S15I 1X3ZA 4MD8A 3CC41 4HH4A 2K3RA 2LIYA 3I55Z 1YJWZ 3CC4Z 3CC71 4A3DI 3GTGI 4E2ZA 1N8R1 2WAQA 3CC7Z 2VPWA 3EERA 3Q87A 3HOZI 4BBRI 4AYBA 2JIQA 3QWUA 3S1QI 5D1OB 2P3YA 1VQ61 3M4OI 1RLYA 2E2HI 4DGLA 1RNIA 3CCUZ 1VQ6Z 1Q862 2O53A 3P5JB 2JIPA 2K5RA 5C4XI 1Y1VI 4A3BI 1Q861 4A3KI 2IZ4A 1M901 3J81b 4E2WA 2PMZA 3G4SZ 1DL6A 2OTJ1 2JIMA 2LFUA 3GTMS 4RS4A 4NB9A 1JJ2Z 1WJ2A 2OTJZ 1JJ2Y 4Y52I 3S2HI 3D9XA 1QVGZ 3HOUI 1K732 3J81f 2NVXI 1TWCI 3S2DI 1VQL1 3MONA 2JR6A 4RVFA 2IZ3A 4MONA 1VQ41 1VQLZ 3S16I 1TWHI 3TE5B 1Q822 1VQ4Z 3RZOI 1Q7Y2 3GTQI 5CM2M 1Y1WI 3F3FC 1Y1VS 2R93I 4A3FI 3K7AI 2V45A 4MH4A 2DE7A 4BBSI 2OOXB 3J80b 3FKII 1Q812 2WB1A 5D1OA 1USPA 5IP9I 5FLMI 2VPZA 1VQP1 2AKLA 2IV2X 2NVQI 3IX0A 1WIIA 2Q51A 4MRIA 3NDIA 1VQPZ 2E2II 3GKQA 1YIT1 2G2KA 1KD12 4NBDA 3J80f 1VQN1 1WCMI 2F4OA 3IF8A 2V8JA 1YITZ 3FQMA 1VQNZ 1KRLA 4MD9A 3EEDA 1Y8CA 1KD11 1YI21 4QTUA 2QEX1 4Y7NI 2F4MA 3JAMf 3KIFA 1YI2Z 1TWGI 4A3LI 2QEXZ 3I551 1YJW1 4E2YA 2VPYA 2M48A 3J7A4 1KC81 3S1MI 3CCM1 3MZKB 4E33A 2RIQA 3HOVI 2GU2A 2Y0SA 3CCMZ 3S1NI 5A2Qf 1ML8A 3MZLB 4A3JI 1QF8A 1QYPA 1Z02A 3CCU1 1ZH1A 1USPB 3G6E1 4NBCA 4A3EI 2QR1B 1YHQ1 2QRCB 4A3II 3G6EZ 3RZDI 3VB9A 1KQSZ 3IFUA 1KQSY 2RT9A 1YHQZ 2JIOA 2GTIA 1M1K2 2VUGA 2JA6I 1YUKA 1TFIA 4HGYA 2I3CA 3IR7A 3G4S1 2Q4ZA 3D2LA 1X3WA 4NFRA 3CCS1 2B63I 4A3MI 2O4HA 2P28A 3VMGA 3CCSZ 1VQOZ 1QXFA 5AN9F 3CCE1 1YIJZ 1Z01A 2JUBA 4A3GI 1FDOA 2J6AA 1QVGY 3CCEZ 1ZB8A 1NJI2 1S721 3S14I 1PFTA 3S1RI 3HOWI 4E30A 2OTL1 2KPIA 2QLVB 1ZB9A 3BG1B 1S72Z 1FDIA 1K731 1Z03A 4DQYB 3M3YI 3PO2I 3I4NI 3NH5A 2OTLZ 3CME1 3T4NB 1W2BZ 1N2FA 2JA8I 1I6HI 3CMEZ 5D1PA 4NBAA 3S17I 2DE6A 3D6WA 1Q821 3CCR1 4MXUA 4NB8A 3KIHA 1Q7Y1 3CCRZ 2JIRA 2RBLA 2PK7A 1YUAA 3PO3I 1NP6A 1P9NA 2OZKA 1Q811 4A3CI 1VQ91 3U50C 3CCQ1 1R9TI 1VQ71 3CMA1 3JAMb 2VPXA 2W04A 1VQ9Z 3OW2Z 2V8KA 3CCQZ 1VQ7Z 3OW2Y 3CMAZ 4E32A 1VLAA 2V8IA 2ZAEB 2R6MA 1YJ91 2E9HA 2PM9A 1QVFZ 5A2Qb 1QVFY 5FLXb 1YJ9Z 3GTOI 1RO0A 1AA6A 3GTPI 1VQ51 3H0GI 2QKDA 4NBHA 3VTNA 3I07A 1VQ5Z 2NAPA
chains in the Genus database with same CATH topology
4E2XA 3GTJI 2YU9I 3NH8A 5C44I 2RPRA 5FLXf 1S7MA 4HGZA 4NBBA 4RVGA 1N8R2 1TWAI 3I561 1TWFI 1K9M2 3GTMI 3LUSA 3I56Z 3FQQA 1K8A2 1RQFA 4RV9A 3NFZA 1NUIA 1K9M1 4TNUA 3VMIA 4S1TA 3NDJA 2NVTI 1M1K1 1K8A1 3HOYI 5IP7I 4BY7I 1M902 1VQO1 2M6NA 5C4JI 1YIJ1 3GTKI 1VQ81 2JA5I 2JS4A 2W03A 4RVHA 4XX2A 2KI7B 3HOXI 1VQ8Z 1L1OC 1VQK1 1SFOI 2HF1A 4E31A 4EWCA 1VQKZ 2BJOA 2H85A 3I4MI 2JA7I 2HU9A 1RO2A 2EGTA 3CCJ1 5T64A 2RHBA 3HKZA 4NH1C 3ESWA 1NJI1 3CCV1 2DE5A 2NVYI 3CCJZ 3GTLI 3CCVZ 1W2BY 2R7ZI 2QA41 3CPWZ 2YADA 1K83I 1RO4A 3NH4A 3CPWY 5IT9b 2QA4Z 3CXCZ 3H3VJ 3CXCY 3CCL1 2E2JI 1LQLA 1I3QI 1WW9A 5T67A 4X6AI 3CCLZ 4BY1I 3GCFA 4CL1A 4NOZA 2QRDB 5C3EI 2R92I 4NBEA 2QREB 2GTHA 2JMOA 4DK1A 5IT9f 1X0TA 5LL6f 1I50I 3CC21 1JWHC 2VUMI 3CC2Z 2VF1A 3TDHB 2JNYA 2OOYB 4MD7A 3G711 3F3PC 4NBGA 1VQM1 4BXXI 3CD61 3CQZI 4A93I 3G71Z 1YJN1 3VMHA 4QTTA 5T6BA 1VQMZ 3CD6Z 1YJNZ 1KC82 4RVDA 3BG0B 4NBFA 3PO3S 3S15I 1X3ZA 4MD8A 3CC41 4HH4A 2K3RA 2LIYA 3I55Z 1YJWZ 3CC4Z 3CC71 4A3DI 3GTGI 4E2ZA 1N8R1 2WAQA 3CC7Z 3EERA 3Q87A 3HOZI 4BBRI 4AYBA 3S1QI 3QWUA 5D1OB 2P3YA 1VQ61 3M4OI 1RLYA 2E2HI 4DGLA 1RNIA 3CCUZ 1VQ6Z 1Q862 2O53A 3P5JB 2K5RA 5C4XI 1Y1VI 4A3BI 1Q861 4A3KI 2IZ4A 1M901 3J81b 4E2WA 2PMZA 3G4SZ 1DL6A 2OTJ1 2LFUA 3GTMS 4RS4A 4NB9A 1JJ2Z 2OTJZ 1JJ2Y 4Y52I 3S2HI 3D9XA 1QVGZ 3HOUI 1K732 3J81f 2NVXI 1TWCI 3S2DI 1VQL1 3MONA 2JR6A 4RVFA 2IZ3A 4MONA 1VQ41 1VQLZ 3S16I 1TWHI 3TE5B 1Q822 1VQ4Z 3RZOI 1Q7Y2 3GTQI 5CM2M 1Y1WI 3F3FC 1Y1VS 2R93I 4A3FI 3K7AI 4MH4A 2DE7A 4BBSI 2OOXB 3FKII 3J80b 1Q812 2WB1A 5D1OA 1USPA 5IP9I 5FLMI 1VQP1 2AKLA 2NVQI 3IX0A 1WIIA 2Q51A 4MRIA 3NDIA 1VQPZ 2E2II 3GKQA 1YIT1 2G2KA 1KD12 4NBDA 3J80f 1VQN1 1WCMI 2F4OA 3IF8A 2V8JA 1YITZ 3FQMA 1VQNZ 1KRLA 4MD9A 3EEDA 1KD11 1YI21 4QTUA 2QEX1 4Y7NI 2F4MA 3JAMf 3KIFA 1YI2Z 1TWGI 4A3LI 2QEXZ 3I551 1YJW1 4E2YA 2M48A 3J7A4 1KC81 3S1MI 3CCM1 3MZKB 4E33A 2RIQA 3HOVI 2GU2A 2Y0SA 3CCMZ 3S1NI 5A2Qf 1ML8A 3MZLB 4A3JI 1QF8A 1QYPA 1Z02A 3CCU1 1ZH1A 1USPB 3G6E1 4NBCA 4A3EI 2QR1B 1YHQ1 2QRCB 3RZDI 4A3II 3G6EZ 3VB9A 1KQSZ 3IFUA 1KQSY 2RT9A 1YHQZ 2GTIA 1M1K2 2VUGA 2JA6I 1YUKA 1TFIA 4HGYA 2I3CA 3G4S1 2Q4ZA 1X3WA 4NFRA 3CCS1 2B63I 4A3MI 2O4HA 2P28A 3VMGA 3CCSZ 1VQOZ 5AN9F 3CCE1 1YIJZ 1Z01A 2JUBA 4A3GI 2J6AA 1QVGY 3CCEZ 1ZB8A 1NJI2 1S721 3S14I 1PFTA 3S1RI 3HOWI 4E30A 2OTL1 2KPIA 2QLVB 1ZB9A 3BG1B 1S72Z 1K731 1Z03A 4DQYB 3M3YI 3PO2I 3I4NI 3NH5A 2OTLZ 3CME1 3T4NB 1W2BZ 1N2FA 2JA8I 1I6HI 3CMEZ 5D1PA 4NBAA 3S17I 2DE6A 3D6WA 1Q821 3CCR1 4MXUA 4NB8A 3KIHA 1Q7Y1 3CCRZ 2RBLA 2PK7A 1YUAA 3PO3I 1NP6A 1P9NA 2OZKA 1Q811 4A3CI 1VQ91 3U50C 3CCQ1 1R9TI 1VQ71 3CMA1 3JAMb 2W04A 1VQ9Z 3OW2Z 2V8KA 3CCQZ 1VQ7Z 3OW2Y 3CMAZ 4E32A 1VLAA 2V8IA 2ZAEB 2R6MA 1YJ91 2E9HA 2PM9A 1QVFZ 5A2Qb 1QVFY 5FLXb 1YJ9Z 3GTOI 1RO0A 3GTPI 1VQ51 3H0GI 2QKDA 4NBHA 3VTNA 3I07A 1VQ5Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ I;  4Y52 I;  3S2H I;  3HOU I;  2YU9 I;  2JA6 I;  5C44 I;  1TWC I;  2NVX I;  3S2D I;  1I50 I;  1TFI A;  2JR6 A;  4NBB A;  3S16 I;  1TWH I;  2VUM I;  1X3W A;  3RZO I;  2JNY A;  1TWA I;  2B63 I;  4A3M I;  3GTQ I;  5CM2 M;  1TWF I;  1Y1W I;  3VMG A;  1Y1V S;  2R93 I;  3GTM I;  4A3F I;  3K7A I;  3LUS A;  4MH4 A;  4NBG A;  2DE7 A;  4BBS I;  4BXX I;  3CQZ I;  3FKI I;  4A93 I;  1USP A;  4A3G I;  3VMH A;  2J6A A;  4QTT A;  5IP9 I;  1ZB8 A;  1NUI A;  5FLM I;  3VMI A;  4NBF A;  3PO3 S;  2AKL A;  1PFT A;  3S14 I;  3S15 I;  2NVT I;  1X3Z A;  2NVQ I;  3S1R I;  3HOW I;  2KPI A;  1ZB9 A;  3HOY I;  5IP7 I;  3PO2 I;  3M3Y I;  3I4N I;  4BY7 I;  2E2I I;  3GKQ A;  1N2F A;  5C4J I;  4NBD A;  1WCM I;  3GTK I;  2JA8 I;  1I6H I;  2JA5 I;  3GTG I;  2F4O A;  4A3D I;  2JS4 A;  4NBA A;  3S17 I;  2DE6 A;  3D6W A;  4XX2 A;  3HOX I;  1L1O C;  1SFO I;  4NB8 A;  3EER A;  3Q87 A;  3HOZ I;  2HF1 A;  4BBR I;  3S1Q I;  4QTU A;  2BJO A;  2P3Y A;  2RBL A;  2PK7 A;  4Y7N I;  1YUA A;  1RLY A;  2F4M A;  2E2H I;  2JA7 I;  3I4M I;  3M4O I;  3PO3 I;  1TWG I;  4A3L I;  4A3C I;  3U50 C;  1R9T I;  3ESW A;  2DE5 A;  3S1M I;  2NVY I;  3GTL I;  3HOV I;  2K5R A;  2R7Z I;  5C4X I;  1Y1V I;  3S1N I;  1K83 I;  1ML8 A;  1RO4 A;  4A3B I;  1VLA A;  4A3K I;  4A3J I;  1QYP A;  3H3V J;  2E2J I;  1USP B;  1LQL A;  1I3Q I;  1WW9 A;  4NBC A;  3GTO I;  4A3E I;  4X6A I;  4BY1 I;  3GTP I;  1DL6 A;  3H0G I;  4A3I I;  3GCF A;  3RZD I;  4NOZ A;  3VB9 A;  4NBH A;  5C3E I;  2R92 I;  3GTM S;  4NBE A;  3I07 A;  4NB9 A; 
#chains in the Genus database with same CATH topology
 4E2X A;  3GTJ I;  2YU9 I;  3NH8 A;  5C44 I;  2RPR A;  5FLX f;  1S7M A;  4HGZ A;  4NBB A;  4RVG A;  1N8R 2;  1TWA I;  3I56 1;  1TWF I;  1K9M 2;  3GTM I;  3LUS A;  3I56 Z;  3FQQ A;  1K8A 2;  1RQF A;  4RV9 A;  3NFZ A;  1NUI A;  1K9M 1;  4TNU A;  3VMI A;  4S1T A;  3NDJ A;  2NVT I;  1M1K 1;  1K8A 1;  2E7Z A;  3HOY I;  5IP7 I;  4BY7 I;  1M90 2;  1VQO 1;  2M6N A;  5C4J I;  1YIJ 1;  3GTK I;  1VQ8 1;  2JA5 I;  2JS4 A;  2W03 A;  4RVH A;  4XX2 A;  2KI7 B;  3HOX I;  1VQ8 Z;  1L1O C;  1VQK 1;  1SFO I;  2HF1 A;  4E31 A;  4EWC A;  1VQK Z;  2BJO A;  2H85 A;  3I4M I;  2JA7 I;  2HU9 A;  1RO2 A;  2EGT A;  3CCJ 1;  5T64 A;  2RHB A;  3HKZ A;  4NH1 C;  3ESW A;  1NJI 1;  3CCV 1;  2DE5 A;  2NVY I;  3CCJ Z;  3GTL I;  1WZN A;  3CCV Z;  1W2B Y;  2R7Z I;  2QA4 1;  3CPW Z;  2YAD A;  1K83 I;  1RO4 A;  3NH4 A;  3CPW Y;  5IT9 b;  2QA4 Z;  3CXC Z;  3H3V J;  2AYD A;  3CXC Y;  3CCL 1;  2E2J I;  1LQL A;  1I3Q I;  1WW9 A;  5T67 A;  1SIW A;  4X6A I;  3CCL Z;  4BY1 I;  3GCF A;  4CL1 A;  4NOZ A;  2QRD B;  5C3E I;  2R92 I;  4NBE A;  2QRE B;  2GTH A;  2JMO A;  4DK1 A;  5IT9 f;  1X0T A;  5LL6 f;  1I50 I;  3CC2 1;  1JWH C;  2VUM I;  3CC2 Z;  1Q16 A;  2VF1 A;  3TDH B;  2LEX A;  2JNY A;  2OOY B;  4MD7 A;  3G71 1;  3F3P C;  4NBG A;  1VQM 1;  4BXX I;  3CD6 1;  3CQZ I;  4A93 I;  3G71 Z;  1YJN 1;  2V3V A;  3VMH A;  4QTT A;  5T6B A;  1VQM Z;  3CD6 Z;  1YJN Z;  1KC8 2;  4RVD A;  3BG0 B;  4NBF A;  3PO3 S;  3S15 I;  1X3Z A;  4MD8 A;  3CC4 1;  4HH4 A;  2K3R A;  2LIY A;  3I55 Z;  1YJW Z;  3CC4 Z;  3CC7 1;  4A3D I;  3GTG I;  4E2Z A;  1N8R 1;  2WAQ A;  3CC7 Z;  2VPW A;  3EER A;  3Q87 A;  3HOZ I;  4BBR I;  4AYB A;  2JIQ A;  3QWU A;  3S1Q I;  5D1O B;  2P3Y A;  1VQ6 1;  3M4O I;  1RLY A;  2E2H I;  4DGL A;  1RNI A;  3CCU Z;  1VQ6 Z;  1Q86 2;  2O53 A;  3P5J B;  2JIP A;  2K5R A;  5C4X I;  1Y1V I;  4A3B I;  1Q86 1;  4A3K I;  2IZ4 A;  1M90 1;  3J81 b;  4E2W A;  2PMZ A;  3G4S Z;  1DL6 A;  2OTJ 1;  2JIM A;  2LFU A;  3GTM S;  4RS4 A;  4NB9 A;  1JJ2 Z;  1WJ2 A;  2OTJ Z;  1JJ2 Y;  4Y52 I;  3S2H I;  3D9X A;  1QVG Z;  3HOU I;  1K73 2;  3J81 f;  2NVX I;  1TWC I;  3S2D I;  1VQL 1;  3MON A;  2JR6 A;  4RVF A;  2IZ3 A;  4MON A;  1VQ4 1;  1VQL Z;  3S16 I;  1TWH I;  3TE5 B;  1Q82 2;  1VQ4 Z;  3RZO I;  1Q7Y 2;  3GTQ I;  5CM2 M;  1Y1W I;  3F3F C;  1Y1V S;  2R93 I;  4A3F I;  3K7A I;  2V45 A;  4MH4 A;  2DE7 A;  4BBS I;  2OOX B;  3J80 b;  3FKI I;  1Q81 2;  2WB1 A;  5D1O A;  1USP A;  5IP9 I;  5FLM I;  2VPZ A;  1VQP 1;  2AKL A;  2IV2 X;  2NVQ I;  3IX0 A;  1WII A;  2Q51 A;  4MRI A;  3NDI A;  1VQP Z;  2E2I I;  3GKQ A;  1YIT 1;  2G2K A;  1KD1 2;  4NBD A;  3J80 f;  1VQN 1;  1WCM I;  2F4O A;  3IF8 A;  2V8J A;  1YIT Z;  3FQM A;  1VQN Z;  1KRL A;  4MD9 A;  3EED A;  1Y8C A;  1KD1 1;  1YI2 1;  4QTU A;  2QEX 1;  4Y7N I;  2F4M A;  3JAM f;  3KIF A;  1YI2 Z;  1TWG I;  4A3L I;  2QEX Z;  3I55 1;  1YJW 1;  4E2Y A;  2VPY A;  2M48 A;  3J7A 4;  1KC8 1;  3S1M I;  3CCM 1;  3MZK B;  4E33 A;  2RIQ A;  3HOV I;  2GU2 A;  2Y0S A;  3CCM Z;  3S1N I;  5A2Q f;  1ML8 A;  3MZL B;  4A3J I;  1QF8 A;  1QYP A;  1Z02 A;  3CCU 1;  1ZH1 A;  1USP B;  3G6E 1;  4NBC A;  4A3E I;  2QR1 B;  1YHQ 1;  2QRC B;  4A3I I;  3G6E Z;  3RZD I;  3VB9 A;  1KQS Z;  3IFU A;  1KQS Y;  2RT9 A;  1YHQ Z;  2JIO A;  2GTI A;  1M1K 2;  2VUG A;  2JA6 I;  1YUK A;  1TFI A;  4HGY A;  2I3C A;  3IR7 A;  3G4S 1;  2Q4Z A;  3D2L A;  1X3W A;  4NFR A;  3CCS 1;  2B63 I;  4A3M I;  2O4H A;  2P28 A;  3VMG A;  3CCS Z;  1VQO Z;  1QXF A;  5AN9 F;  3CCE 1;  1YIJ Z;  1Z01 A;  2JUB A;  4A3G I;  1FDO A;  2J6A A;  1QVG Y;  3CCE Z;  1ZB8 A;  1NJI 2;  1S72 1;  3S14 I;  1PFT A;  3S1R I;  3HOW I;  4E30 A;  2OTL 1;  2KPI A;  2QLV B;  1ZB9 A;  3BG1 B;  1S72 Z;  1FDI A;  1K73 1;  1Z03 A;  4DQY B;  3M3Y I;  3PO2 I;  3I4N I;  3NH5 A;  2OTL Z;  3CME 1;  3T4N B;  1W2B Z;  1N2F A;  2JA8 I;  1I6H I;  3CME Z;  5D1P A;  4NBA A;  3S17 I;  2DE6 A;  3D6W A;  1Q82 1;  3CCR 1;  4MXU A;  4NB8 A;  3KIH A;  1Q7Y 1;  3CCR Z;  2JIR A;  2RBL A;  2PK7 A;  1YUA A;  3PO3 I;  1NP6 A;  1P9N A;  2OZK A;  1Q81 1;  4A3C I;  1VQ9 1;  3U50 C;  3CCQ 1;  1R9T I;  1VQ7 1;  3CMA 1;  3JAM b;  2VPX A;  2W04 A;  1VQ9 Z;  3OW2 Z;  2V8K A;  3CCQ Z;  1VQ7 Z;  3OW2 Y;  3CMA Z;  4E32 A;  1VLA A;  2V8I A;  2ZAE B;  2R6M A;  1YJ9 1;  2E9H A;  2PM9 A;  1QVF Z;  5A2Q b;  1QVF Y;  5FLX b;  1YJ9 Z;  3GTO I;  1RO0 A;  1AA6 A;  3GTP I;  1VQ5 1;  3H0G I;  2QKD A;  4NBH A;  3VTN A;  3I07 A;  1VQ5 Z;  2NAP A; 
#chains in the Genus database with same CATH homology
 4E2X A;  3GTJ I;  2YU9 I;  3NH8 A;  5C44 I;  2RPR A;  5FLX f;  1S7M A;  4HGZ A;  4NBB A;  4RVG A;  1N8R 2;  1TWA I;  3I56 1;  1TWF I;  1K9M 2;  3GTM I;  3LUS A;  3I56 Z;  3FQQ A;  1K8A 2;  1RQF A;  4RV9 A;  3NFZ A;  1NUI A;  1K9M 1;  4TNU A;  3VMI A;  4S1T A;  3NDJ A;  2NVT I;  1M1K 1;  1K8A 1;  3HOY I;  5IP7 I;  4BY7 I;  1M90 2;  1VQO 1;  2M6N A;  5C4J I;  1YIJ 1;  3GTK I;  1VQ8 1;  2JA5 I;  2JS4 A;  2W03 A;  4RVH A;  4XX2 A;  2KI7 B;  3HOX I;  1VQ8 Z;  1L1O C;  1VQK 1;  1SFO I;  2HF1 A;  4E31 A;  4EWC A;  1VQK Z;  2BJO A;  2H85 A;  3I4M I;  2JA7 I;  2HU9 A;  1RO2 A;  2EGT A;  3CCJ 1;  5T64 A;  2RHB A;  3HKZ A;  4NH1 C;  3ESW A;  1NJI 1;  3CCV 1;  2DE5 A;  2NVY I;  3CCJ Z;  3GTL I;  3CCV Z;  1W2B Y;  2R7Z I;  2QA4 1;  3CPW Z;  2YAD A;  1K83 I;  1RO4 A;  3NH4 A;  3CPW Y;  5IT9 b;  2QA4 Z;  3CXC Z;  3H3V J;  3CXC Y;  3CCL 1;  2E2J I;  1LQL A;  1I3Q I;  1WW9 A;  5T67 A;  4X6A I;  3CCL Z;  4BY1 I;  3GCF A;  4CL1 A;  4NOZ A;  2QRD B;  5C3E I;  2R92 I;  4NBE A;  2QRE B;  2GTH A;  2JMO A;  4DK1 A;  5IT9 f;  1X0T A;  5LL6 f;  1I50 I;  3CC2 1;  1JWH C;  2VUM I;  3CC2 Z;  2VF1 A;  3TDH B;  2JNY A;  2OOY B;  4MD7 A;  3G71 1;  3F3P C;  4NBG A;  1VQM 1;  4BXX I;  3CD6 1;  3CQZ I;  4A93 I;  3G71 Z;  1YJN 1;  3VMH A;  4QTT A;  5T6B A;  1VQM Z;  3CD6 Z;  1YJN Z;  1KC8 2;  4RVD A;  3BG0 B;  4NBF A;  3PO3 S;  3S15 I;  1X3Z A;  4MD8 A;  3CC4 1;  4HH4 A;  2K3R A;  2LIY A;  3I55 Z;  1YJW Z;  3CC4 Z;  3CC7 1;  4A3D I;  3GTG I;  4E2Z A;  1N8R 1;  2WAQ A;  3CC7 Z;  3EER A;  3Q87 A;  3HOZ I;  4BBR I;  4AYB A;  3S1Q I;  3QWU A;  5D1O B;  2P3Y A;  1VQ6 1;  3M4O I;  1RLY A;  2E2H I;  4DGL A;  1RNI A;  3CCU Z;  1VQ6 Z;  1Q86 2;  2O53 A;  3P5J B;  2K5R A;  5C4X I;  1Y1V I;  4A3B I;  1Q86 1;  4A3K I;  2IZ4 A;  1M90 1;  3J81 b;  4E2W A;  2PMZ A;  3G4S Z;  1DL6 A;  2OTJ 1;  2LFU A;  3GTM S;  4RS4 A;  4NB9 A;  1JJ2 Z;  2OTJ Z;  1JJ2 Y;  4Y52 I;  3S2H I;  3D9X A;  1QVG Z;  3HOU I;  1K73 2;  3J81 f;  2NVX I;  1TWC I;  3S2D I;  1VQL 1;  3MON A;  2JR6 A;  4RVF A;  2IZ3 A;  4MON A;  1VQ4 1;  1VQL Z;  3S16 I;  1TWH I;  3TE5 B;  1Q82 2;  1VQ4 Z;  3RZO I;  1Q7Y 2;  3GTQ I;  5CM2 M;  1Y1W I;  3F3F C;  1Y1V S;  2R93 I;  4A3F I;  3K7A I;  4MH4 A;  2DE7 A;  4BBS I;  2OOX B;  3FKI I;  3J80 b;  1Q81 2;  2WB1 A;  5D1O A;  1USP A;  5IP9 I;  5FLM I;  1VQP 1;  2AKL A;  2NVQ I;  3IX0 A;  1WII A;  2Q51 A;  4MRI A;  3NDI A;  1VQP Z;  2E2I I;  3GKQ A;  1YIT 1;  2G2K A;  1KD1 2;  4NBD A;  3J80 f;  1VQN 1;  1WCM I;  2F4O A;  3IF8 A;  2V8J A;  1YIT Z;  3FQM A;  1VQN Z;  1KRL A;  4MD9 A;  3EED A;  1KD1 1;  1YI2 1;  4QTU A;  2QEX 1;  4Y7N I;  2F4M A;  3JAM f;  3KIF A;  1YI2 Z;  1TWG I;  4A3L I;  2QEX Z;  3I55 1;  1YJW 1;  4E2Y A;  2M48 A;  3J7A 4;  1KC8 1;  3S1M I;  3CCM 1;  3MZK B;  4E33 A;  2RIQ A;  3HOV I;  2GU2 A;  2Y0S A;  3CCM Z;  3S1N I;  5A2Q f;  1ML8 A;  3MZL B;  4A3J I;  1QF8 A;  1QYP A;  1Z02 A;  3CCU 1;  1ZH1 A;  1USP B;  3G6E 1;  4NBC A;  4A3E I;  2QR1 B;  1YHQ 1;  2QRC B;  3RZD I;  4A3I I;  3G6E Z;  3VB9 A;  1KQS Z;  3IFU A;  1KQS Y;  2RT9 A;  1YHQ Z;  2GTI A;  1M1K 2;  2VUG A;  2JA6 I;  1YUK A;  1TFI A;  4HGY A;  2I3C A;  3G4S 1;  2Q4Z A;  1X3W A;  4NFR A;  3CCS 1;  2B63 I;  4A3M I;  2O4H A;  2P28 A;  3VMG A;  3CCS Z;  1VQO Z;  5AN9 F;  3CCE 1;  1YIJ Z;  1Z01 A;  2JUB A;  4A3G I;  2J6A A;  1QVG Y;  3CCE Z;  1ZB8 A;  1NJI 2;  1S72 1;  3S14 I;  1PFT A;  3S1R I;  3HOW I;  4E30 A;  2OTL 1;  2KPI A;  2QLV B;  1ZB9 A;  3BG1 B;  1S72 Z;  1K73 1;  1Z03 A;  4DQY B;  3M3Y I;  3PO2 I;  3I4N I;  3NH5 A;  2OTL Z;  3CME 1;  3T4N B;  1W2B Z;  1N2F A;  2JA8 I;  1I6H I;  3CME Z;  5D1P A;  4NBA A;  3S17 I;  2DE6 A;  3D6W A;  1Q82 1;  3CCR 1;  4MXU A;  4NB8 A;  3KIH A;  1Q7Y 1;  3CCR Z;  2RBL A;  2PK7 A;  1YUA A;  3PO3 I;  1NP6 A;  1P9N A;  2OZK A;  1Q81 1;  4A3C I;  1VQ9 1;  3U50 C;  3CCQ 1;  1R9T I;  1VQ7 1;  3CMA 1;  3JAM b;  2W04 A;  1VQ9 Z;  3OW2 Z;  2V8K A;  3CCQ Z;  1VQ7 Z;  3OW2 Y;  3CMA Z;  4E32 A;  1VLA A;  2V8I A;  2ZAE B;  2R6M A;  1YJ9 1;  2E9H A;  2PM9 A;  1QVF Z;  5A2Q b;  1QVF Y;  5FLX b;  1YJ9 Z;  3GTO I;  1RO0 A;  3GTP I;  1VQ5 1;  3H0G I;  2QKD A;  4NBH A;  3VTN A;  3I07 A;  1VQ5 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...