1VQN1

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vqn100
1YJNZ 2OTLZ 1K731 3G4S1 3CCJZ 1NJI1 1VQ71 1JJ2Z 1M902 3G4SZ 1VQ7Z 3OW2Z 1Q7Y2 3CC41 3CXCZ 1QVFY 1N8R2 1VQN1 1KC81 1KQSZ 2OTJZ 1YJW1 1QVGZ 3I561 1VQ51 3CCS1 3I56Z 1YJN1 1VQ5Z 1M901 3CCSZ 1W2BY 2QA41 2OTL1 1KD12 1Q822 3CCJ1 1YI21 2QA4Z 3G71Z 1JJ2Y 1YI2Z 1VQO1 3OW2Y 1Q862 1VQOZ 1M1K1 3CMEZ 3G6E1 1K8A1 1VQL1 1Q812 3CC21 3G6EZ 2OTJ1 3CCEZ 1VQLZ 1YIJ1 3CC2Z 1QVGY 1VQ6Z 1VQ4Z 1Q821 3CPWZ 1VQ9Z 1YIJZ 1K9M2 1VQ8Z 3G711 1Q7Y1 3CCL1 3CCM1 1YHQ1 1N8R1 3CCQ1 3CCLZ 1Q811 1NJI2 3CCMZ 3CME1 1YHQZ 3CCQZ 3CCU1 3CXCY 1S72Z 3CMA1 3CCE1 3I55Z 3CCUZ 3CCRZ 3CMAZ 1VQ61 1VQ41 1YJ9Z 1KQSY 2QEX1 1VQ91 1VQK1 1KD11 2QEXZ 1KC82 1VQMZ 1W2BZ 1VQPZ 1VQ81 1VQKZ 3CCV1 1Q861 3CCVZ 1K732 1YIT1 3CC71 3CC4Z 1S721 1QVFZ 1YITZ 3CC7Z 3I551 3CD61 3CCR1 1VQNZ 1M1K2 3CD6Z 1YJ91 1K8A2 1K9M1 1YJWZ 1VQM1 3CPWY 1VQP1
chains in the Genus database with same CATH superfamily
4E2WA 4RVDA 4MH4A 2HF1A 1K731 1LQLA 1VQ71 1NJI1 1DL6A 1VQ7Z 5FLMI 2NVYI 2VPZA 1N8R2 1N2FA 4NBBA 2QRCB 5IT9f 1KC81 1QYPA 3BG1B 3I561 4A3II 2GTHA 4HGYA 3I56Z 4E2YA 5LL6f 1KD12 2AYDA 3G71Z 1JJ2Y 2JMOA 2ZAEB 3GTGI 2V8KA 4NBFA 5C4XI 3OW2Y 3NFZA 1USPA 2LIYA 3LUSA 4E30A 2B63I 4NFRA 2NVXI 3CCEZ 1Y8CA 3HOWI 1L1OC 1FDIA 2H85A 5IP9I 1VQ4Z 3CPWZ 5CM2M 4A3GI 1X3WA 2KI7B 2RIQA 4NH1C 2I3CA 2YU9I 1AA6A 2HU9A 1TFIA 2VPWA 1YHQ1 1N8R1 5C3EI 3F3PC 3Q87A 3CME1 1YHQZ 4A3MI 2JA7I 2R6MA 3CQZI 1S72Z 3I07A 3NH5A 2IZ3A 2OOYB 2JR6A 1VQ91 4A3KI 2JNYA 1RQFA 1VLAA 1KD11 3J81b 5FLXb 1VQ81 2JA6I 2E2II 3KIFA 1R9TI 1YUKA 2VUGA 2WB1A 1K732 4MD8A 1YIT1 2GU2A 3H0GI 3QWUA 3CC4Z 1WZNA 1QVFZ 1FDOA 1YITZ 3CCR1 1VQNZ 1M1K2 4QTTA 4A3LI 1K8A2 1NUIA 1QF8A 1SIWA 2VF1A 1YJWZ 1VQM1 3TDHB 2RT9A 4A3BI 4A3FI 1YJNZ 4S1TA 3CCJZ 4DK1A 1ZB9A 3S14I 5IT9b 4A3JI 2Q4ZA 2M48A 2OTJZ 3M4OI 4TNUA 3CCS1 4A93I 4E2XA 2PM9A 4QTUA 1M901 3CCSZ 1YI21 3S2DI 3D2LA 1YI2Z 1I50I 1VQO1 1Q862 2JA5I 1VQOZ 3HOZI 2AKLA 1M1K1 3G6E1 1K8A1 1VQL1 4NBAA 2IZ4A 3G6EZ 2NAPA 1VQLZ 1QVGY 4RVGA 2JIOA 2V45A 1JWHC 5T67A 1K9M2 2V3VA 2P28A 2JIMA 3G711 2NVTI 5A2Qf 3HOVI 4E2ZA 4BBSI 2JA8I 2Y0SA 4AYBA 2O4HA 2JIQA 3VB9A 3CCQ1 1Q811 3CCQZ 3CXCY 3GTMS 4CL1A 2F4MA 2OOXB 3I55Z 3CCE1 5T64A 2VUMI 2NVQI 4BY1I 1VQ41 5D1PA 1YJ9Z 1KQSY 2WAQA 4NBCA 3MONA 4Y52I 1WJ2A 2VPYA 1SFOI 2K5RA 2LEXA 3JAMf 1Q861 3F3FC 1USPB 3ESWA 2YADA 2W03A 4XX2A 3CC71 1S721 2R93I 3CC7Z 1Y1WI 3CD61 3GTQI 3KIHA 2M6NA 4BBRI 3CD6Z 1QXFA 3U50C 1K9M1 1RO0A 3BG0B 3FKII 4A3DI 2E9HA 2OTLZ 2RPRA 2O53A 1JJ2Z 1M902 2GTIA 3OW2Z 5T6BA 3CC41 1TWCI 3IF8A 3TE5B 3CXCZ 3H3VJ 3GTMI 3S17I 2RBLA 1VQN1 1KQSZ 2QR1B 4MONA 1YJW1 1VQ51 4MRIA 1YJN1 1VQ5Z 1K83I 1W2BY 2QA41 2DE5A 1WCMI 1I6HI 1RO4A 1TWAI 3CCJ1 3NH8A 2QA4Z 3S1RI 4BY7I 3T4NB 2PMZA 1P9NA 2R7ZI 2VPXA 4DGLA 1Q812 2E2JI 2OTJ1 1VQ6Z 4NOZA 1Q821 1PFTA 2V8JA 3GTJI 5A2Qb 3EERA 3I4NI 3GTKI 5D1OB 3CCM1 2J6AA 1ZB8A 4RS4A 3VTNA 2E7ZA 3CCMZ 4RVHA 3NDIA 3D9XA 3GKQA 3S1NI 3PO2I 1X3ZA 3J80f 1WIIA 2QREB 1X0TA 4MD9A 3EEDA 1RLYA 2W04A 1W2BZ 1VQPZ 3NH4A 2V8IA 4HH4A 1ZH1A 3JAMb 3CCV1 3IR7A 3HOUI 3CCVZ 4NB9A 4MD7A 2P3YA 1Y1VS 3I551 2IV2X 4NBDA 3P5JB 1YJ91 3I4MI 1TWGI 4HGZA 3S2HI 4X6AI 2JIRA 2QKDA 3FQQA 3VMGA 3G4S1 3GTLI 3G4SZ 2E2HI 2RHBA 2Q51A 3MZKB 1Z03A 5C44I 4A3CI 1Q7Y2 2JS4A 1QVFY 3S15I 3S1MI 1TWHI 2DE6A 3D6WA 4RVFA 3HOYI 1S7MA 3FQMA 3HOXI 1QVGZ 1RNIA 2JUBA 3S16I 3RZDI 5AN9F 2OTL1 3VMIA 1Q822 5IP7I 3VMHA 2JIPA 2DE7A 3GTOI 3NDJA 3GCFA 3J7A4 1Y1VI 3CMEZ 2K3RA 1KRLA 2LFUA 4BXXI 3M3YI 2KPIA 3CC21 2EGTA 1YIJ1 2QRDB 3CC2Z 5C4JI 1VQ9Z 1YIJZ 3PO3S 1Q16A 2F4OA 1VQ8Z 4DQYB 1Q7Y1 3CCL1 3K7AI 2OZKA 3CCLZ 1NJI2 1RO2A 3MZLB 3IFUA 1ML8A 3CCU1 1WW9A 4E33A 2BJOA 1I3QI 3CMA1 4NB8A 3CCUZ 3J80b 3CCRZ 4E32A 3CMAZ 1VQ61 2QEX1 4Y7NI 3GTPI 1VQK1 4RV9A 4EWCA 2QEXZ 1YUAA 1KC82 4NBHA 1VQMZ 3HKZA 1VQKZ 3J81f 2QLVB 3IX0A 5FLXf 2R92I 3S1QI 1Z01A 4NBGA 4NBEA 1TWFI 3RZOI 5D1OA 2G2KA 2PK7A 1Z02A 4A3EI 4E31A 3PO3I 3CPWY 1VQP1 4MXUA 1NP6A
chains in the Genus database with same CATH topology
4E2WA 4RVDA 4MH4A 2HF1A 1K731 1LQLA 1VQ71 1NJI1 1DL6A 1VQ7Z 5FLMI 2NVYI 1N8R2 1N2FA 4NBBA 2QRCB 5IT9f 1KC81 1QYPA 3BG1B 3I561 4A3II 2GTHA 4HGYA 3I56Z 4E2YA 5LL6f 1KD12 3G71Z 1JJ2Y 2JMOA 2ZAEB 3GTGI 2V8KA 4NBFA 5C4XI 3OW2Y 3NFZA 1USPA 2LIYA 3LUSA 4E30A 2B63I 4NFRA 2NVXI 3CCEZ 3HOWI 1L1OC 2H85A 5IP9I 1VQ4Z 3CPWZ 5CM2M 4A3GI 1X3WA 2KI7B 2RIQA 4NH1C 2I3CA 2YU9I 2HU9A 1TFIA 1YHQ1 1N8R1 5C3EI 3F3PC 3Q87A 3CME1 1YHQZ 4A3MI 2JA7I 2R6MA 3CQZI 1S72Z 3I07A 3NH5A 2IZ3A 2OOYB 2JR6A 1VQ91 4A3KI 2JNYA 1RQFA 1VLAA 1KD11 3J81b 5FLXb 1VQ81 2JA6I 2E2II 3KIFA 1R9TI 1YUKA 2VUGA 2WB1A 1K732 4MD8A 1YIT1 2GU2A 3H0GI 3QWUA 3CC4Z 1QVFZ 1YITZ 3CCR1 1VQNZ 1M1K2 4QTTA 4A3LI 1K8A2 1NUIA 1QF8A 2VF1A 1YJWZ 1VQM1 3TDHB 2RT9A 4A3BI 4A3FI 1YJNZ 4S1TA 3CCJZ 4DK1A 1ZB9A 3S14I 5IT9b 4A3JI 2Q4ZA 2M48A 2OTJZ 3M4OI 4TNUA 3CCS1 4A93I 4E2XA 2PM9A 4QTUA 1M901 3CCSZ 1YI21 3S2DI 1YI2Z 1I50I 1VQO1 1Q862 2JA5I 1VQOZ 3HOZI 2AKLA 1M1K1 3G6E1 1K8A1 1VQL1 4NBAA 2IZ4A 3G6EZ 1VQLZ 1QVGY 4RVGA 5T67A 1JWHC 1K9M2 2P28A 3G711 2NVTI 5A2Qf 3HOVI 4E2ZA 4BBSI 2JA8I 2Y0SA 4AYBA 2O4HA 3VB9A 3CCQ1 1Q811 3CCQZ 3CXCY 3GTMS 4CL1A 2F4MA 2OOXB 3I55Z 3CCE1 5T64A 2VUMI 2NVQI 4BY1I 1VQ41 5D1PA 1YJ9Z 1KQSY 2WAQA 4NBCA 3MONA 4Y52I 1SFOI 2K5RA 3JAMf 1Q861 3F3FC 1USPB 3ESWA 2YADA 2W03A 4XX2A 3CC71 1S721 2R93I 3CC7Z 1Y1WI 3CD61 3GTQI 3KIHA 2M6NA 4BBRI 3CD6Z 3U50C 1K9M1 1RO0A 3BG0B 3FKII 4A3DI 2E9HA 2OTLZ 2RPRA 2O53A 1JJ2Z 1M902 2GTIA 3OW2Z 5T6BA 3CC41 1TWCI 3IF8A 3TE5B 3CXCZ 3H3VJ 3GTMI 3S17I 2RBLA 1VQN1 1KQSZ 2QR1B 4MONA 1YJW1 1VQ51 4MRIA 1YJN1 1VQ5Z 1K83I 1W2BY 2QA41 2DE5A 1WCMI 1I6HI 1RO4A 1TWAI 3CCJ1 3NH8A 2QA4Z 3S1RI 4BY7I 3T4NB 2PMZA 1P9NA 2R7ZI 4DGLA 1Q812 2E2JI 2OTJ1 1VQ6Z 4NOZA 1Q821 1PFTA 2V8JA 3GTJI 5A2Qb 3EERA 3I4NI 3GTKI 5D1OB 3CCM1 2J6AA 1ZB8A 4RS4A 3VTNA 3CCMZ 4RVHA 3NDIA 3D9XA 3GKQA 3S1NI 3PO2I 1X3ZA 3J80f 1WIIA 2QREB 1X0TA 4MD9A 3EEDA 1RLYA 2W04A 1W2BZ 1VQPZ 3NH4A 2V8IA 4HH4A 1ZH1A 3JAMb 3CCV1 3HOUI 3CCVZ 4NB9A 4MD7A 2P3YA 1Y1VS 3I551 4NBDA 3P5JB 1YJ91 3I4MI 1TWGI 4HGZA 3S2HI 4X6AI 2QKDA 3FQQA 3VMGA 3G4S1 3GTLI 3G4SZ 2E2HI 2RHBA 2Q51A 3MZKB 1Z03A 5C44I 4A3CI 1Q7Y2 2JS4A 1QVFY 3S15I 3S1MI 1TWHI 2DE6A 3D6WA 4RVFA 3HOYI 1S7MA 3FQMA 3HOXI 1QVGZ 1RNIA 2JUBA 3S16I 3RZDI 5AN9F 2OTL1 3VMIA 1Q822 5IP7I 3VMHA 2DE7A 3GTOI 3NDJA 3GCFA 3J7A4 1Y1VI 3CMEZ 2K3RA 1KRLA 2LFUA 4BXXI 3M3YI 2KPIA 3CC21 2EGTA 1YIJ1 2QRDB 3CC2Z 5C4JI 1VQ9Z 1YIJZ 3PO3S 2F4OA 1VQ8Z 4DQYB 1Q7Y1 3CCL1 3K7AI 2OZKA 3CCLZ 1NJI2 1RO2A 3MZLB 3IFUA 1ML8A 3CCU1 1WW9A 4E33A 2BJOA 1I3QI 3CMA1 4NB8A 3CCUZ 3J80b 3CCRZ 4E32A 3CMAZ 1VQ61 2QEX1 4Y7NI 3GTPI 1VQK1 4RV9A 4EWCA 2QEXZ 1YUAA 1KC82 4NBHA 1VQMZ 3HKZA 1VQKZ 3J81f 2QLVB 3IX0A 5FLXf 2R92I 3S1QI 1Z01A 4NBGA 4NBEA 1TWFI 3RZOI 5D1OA 2G2KA 2PK7A 1Z02A 4A3EI 4E31A 3PO3I 3CPWY 1VQP1 4MXUA 1NP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN Z;  2OTL Z;  1K73 1;  3G4S 1;  3CCJ Z;  1NJI 1;  1VQ7 1;  1JJ2 Z;  1M90 2;  3G4S Z;  1VQ7 Z;  3OW2 Z;  1Q7Y 2;  3CC4 1;  3CXC Z;  1QVF Y;  1N8R 2;  1VQN 1;  1KC8 1;  1KQS Z;  2OTJ Z;  1YJW 1;  1QVG Z;  3I56 1;  1VQ5 1;  3CCS 1;  3I56 Z;  1YJN 1;  1VQ5 Z;  1M90 1;  3CCS Z;  1W2B Y;  2QA4 1;  2OTL 1;  1KD1 2;  1Q82 2;  3CCJ 1;  1YI2 1;  2QA4 Z;  3G71 Z;  1JJ2 Y;  1YI2 Z;  1VQO 1;  3OW2 Y;  1Q86 2;  1VQO Z;  1M1K 1;  3CME Z;  3G6E 1;  1K8A 1;  1VQL 1;  1Q81 2;  3CC2 1;  3G6E Z;  2OTJ 1;  3CCE Z;  1VQL Z;  1YIJ 1;  3CC2 Z;  1QVG Y;  1VQ6 Z;  1VQ4 Z;  1Q82 1;  3CPW Z;  1VQ9 Z;  1YIJ Z;  1K9M 2;  1VQ8 Z;  3G71 1;  1Q7Y 1;  3CCL 1;  3CCM 1;  1YHQ 1;  1N8R 1;  3CCQ 1;  3CCL Z;  1Q81 1;  1NJI 2;  3CCM Z;  3CME 1;  1YHQ Z;  3CCQ Z;  3CCU 1;  3CXC Y;  1S72 Z;  3CMA 1;  3CCE 1;  3I55 Z;  3CCU Z;  3CCR Z;  3CMA Z;  1VQ6 1;  1VQ4 1;  1YJ9 Z;  1KQS Y;  2QEX 1;  1VQ9 1;  1VQK 1;  1KD1 1;  2QEX Z;  1KC8 2;  1VQM Z;  1W2B Z;  1VQP Z;  1VQ8 1;  1VQK Z;  3CCV 1;  1Q86 1;  3CCV Z;  1K73 2;  1YIT 1;  3CC7 1;  3CC4 Z;  1S72 1;  1QVF Z;  1YIT Z;  3CC7 Z;  3I55 1;  3CD6 1;  3CCR 1;  1VQN Z;  1M1K 2;  3CD6 Z;  1YJ9 1;  1K8A 2;  1K9M 1;  1YJW Z;  1VQM 1;  3CPW Y;  1VQP 1; 
#chains in the Genus database with same CATH topology
 4E2W A;  4RVD A;  4MH4 A;  2HF1 A;  1K73 1;  1LQL A;  1VQ7 1;  1NJI 1;  1DL6 A;  1VQ7 Z;  5FLM I;  2NVY I;  2VPZ A;  1N8R 2;  1N2F A;  4NBB A;  2QRC B;  5IT9 f;  1KC8 1;  1QYP A;  3BG1 B;  3I56 1;  4A3I I;  2GTH A;  4HGY A;  3I56 Z;  4E2Y A;  5LL6 f;  1KD1 2;  2AYD A;  3G71 Z;  1JJ2 Y;  2JMO A;  2ZAE B;  3GTG I;  2V8K A;  4NBF A;  5C4X I;  3OW2 Y;  3NFZ A;  1USP A;  2LIY A;  3LUS A;  4E30 A;  2B63 I;  4NFR A;  2NVX I;  3CCE Z;  1Y8C A;  3HOW I;  1L1O C;  1FDI A;  2H85 A;  5IP9 I;  1VQ4 Z;  3CPW Z;  5CM2 M;  4A3G I;  1X3W A;  2KI7 B;  2RIQ A;  4NH1 C;  2I3C A;  2YU9 I;  1AA6 A;  2HU9 A;  1TFI A;  2VPW A;  1YHQ 1;  1N8R 1;  5C3E I;  3F3P C;  3Q87 A;  3CME 1;  1YHQ Z;  4A3M I;  2JA7 I;  2R6M A;  3CQZ I;  1S72 Z;  3I07 A;  3NH5 A;  2IZ3 A;  2OOY B;  2JR6 A;  1VQ9 1;  4A3K I;  2JNY A;  1RQF A;  1VLA A;  1KD1 1;  3J81 b;  5FLX b;  1VQ8 1;  2JA6 I;  2E2I I;  3KIF A;  1R9T I;  1YUK A;  2VUG A;  2WB1 A;  1K73 2;  4MD8 A;  1YIT 1;  2GU2 A;  3H0G I;  3QWU A;  3CC4 Z;  1WZN A;  1QVF Z;  1FDO A;  1YIT Z;  3CCR 1;  1VQN Z;  1M1K 2;  4QTT A;  4A3L I;  1K8A 2;  1NUI A;  1QF8 A;  1SIW A;  2VF1 A;  1YJW Z;  1VQM 1;  3TDH B;  2RT9 A;  4A3B I;  4A3F I;  1YJN Z;  4S1T A;  3CCJ Z;  4DK1 A;  1ZB9 A;  3S14 I;  5IT9 b;  4A3J I;  2Q4Z A;  2M48 A;  2OTJ Z;  3M4O I;  4TNU A;  3CCS 1;  4A93 I;  4E2X A;  2PM9 A;  4QTU A;  1M90 1;  3CCS Z;  1YI2 1;  3S2D I;  3D2L A;  1YI2 Z;  1I50 I;  1VQO 1;  1Q86 2;  2JA5 I;  1VQO Z;  3HOZ I;  2AKL A;  1M1K 1;  3G6E 1;  1K8A 1;  1VQL 1;  4NBA A;  2IZ4 A;  3G6E Z;  2NAP A;  1VQL Z;  1QVG Y;  4RVG A;  2JIO A;  2V45 A;  1JWH C;  5T67 A;  1K9M 2;  2V3V A;  2P28 A;  2JIM A;  3G71 1;  2NVT I;  5A2Q f;  3HOV I;  4E2Z A;  4BBS I;  2JA8 I;  2Y0S A;  4AYB A;  2O4H A;  2JIQ A;  3VB9 A;  3CCQ 1;  1Q81 1;  3CCQ Z;  3CXC Y;  3GTM S;  4CL1 A;  2F4M A;  2OOX B;  3I55 Z;  3CCE 1;  5T64 A;  2VUM I;  2NVQ I;  4BY1 I;  1VQ4 1;  5D1P A;  1YJ9 Z;  1KQS Y;  2WAQ A;  4NBC A;  3MON A;  4Y52 I;  1WJ2 A;  2VPY A;  1SFO I;  2K5R A;  2LEX A;  3JAM f;  1Q86 1;  3F3F C;  1USP B;  3ESW A;  2YAD A;  2W03 A;  4XX2 A;  3CC7 1;  1S72 1;  2R93 I;  3CC7 Z;  1Y1W I;  3CD6 1;  3GTQ I;  3KIH A;  2M6N A;  4BBR I;  3CD6 Z;  1QXF A;  3U50 C;  1K9M 1;  1RO0 A;  3BG0 B;  3FKI I;  4A3D I;  2E9H A;  2OTL Z;  2RPR A;  2O53 A;  1JJ2 Z;  1M90 2;  2GTI A;  3OW2 Z;  5T6B A;  3CC4 1;  1TWC I;  3IF8 A;  3TE5 B;  3CXC Z;  3H3V J;  3GTM I;  3S17 I;  2RBL A;  1VQN 1;  1KQS Z;  2QR1 B;  4MON A;  1YJW 1;  1VQ5 1;  4MRI A;  1YJN 1;  1VQ5 Z;  1K83 I;  1W2B Y;  2QA4 1;  2DE5 A;  1WCM I;  1I6H I;  1RO4 A;  1TWA I;  3CCJ 1;  3NH8 A;  2QA4 Z;  3S1R I;  4BY7 I;  3T4N B;  2PMZ A;  1P9N A;  2R7Z I;  2VPX A;  4DGL A;  1Q81 2;  2E2J I;  2OTJ 1;  1VQ6 Z;  4NOZ A;  1Q82 1;  1PFT A;  2V8J A;  3GTJ I;  5A2Q b;  3EER A;  3I4N I;  3GTK I;  5D1O B;  3CCM 1;  2J6A A;  1ZB8 A;  4RS4 A;  3VTN A;  2E7Z A;  3CCM Z;  4RVH A;  3NDI A;  3D9X A;  3GKQ A;  3S1N I;  3PO2 I;  1X3Z A;  3J80 f;  1WII A;  2QRE B;  1X0T A;  4MD9 A;  3EED A;  1RLY A;  2W04 A;  1W2B Z;  1VQP Z;  3NH4 A;  2V8I A;  4HH4 A;  1ZH1 A;  3JAM b;  3CCV 1;  3IR7 A;  3HOU I;  3CCV Z;  4NB9 A;  4MD7 A;  2P3Y A;  1Y1V S;  3I55 1;  2IV2 X;  4NBD A;  3P5J B;  1YJ9 1;  3I4M I;  1TWG I;  4HGZ A;  3S2H I;  4X6A I;  2JIR A;  2QKD A;  3FQQ A;  3VMG A;  3G4S 1;  3GTL I;  3G4S Z;  2E2H I;  2RHB A;  2Q51 A;  3MZK B;  1Z03 A;  5C44 I;  4A3C I;  1Q7Y 2;  2JS4 A;  1QVF Y;  3S15 I;  3S1M I;  1TWH I;  2DE6 A;  3D6W A;  4RVF A;  3HOY I;  1S7M A;  3FQM A;  3HOX I;  1QVG Z;  1RNI A;  2JUB A;  3S16 I;  3RZD I;  5AN9 F;  2OTL 1;  3VMI A;  1Q82 2;  5IP7 I;  3VMH A;  2JIP A;  2DE7 A;  3GTO I;  3NDJ A;  3GCF A;  3J7A 4;  1Y1V I;  3CME Z;  2K3R A;  1KRL A;  2LFU A;  4BXX I;  3M3Y I;  2KPI A;  3CC2 1;  2EGT A;  1YIJ 1;  2QRD B;  3CC2 Z;  5C4J I;  1VQ9 Z;  1YIJ Z;  3PO3 S;  1Q16 A;  2F4O A;  1VQ8 Z;  4DQY B;  1Q7Y 1;  3CCL 1;  3K7A I;  2OZK A;  3CCL Z;  1NJI 2;  1RO2 A;  3MZL B;  3IFU A;  1ML8 A;  3CCU 1;  1WW9 A;  4E33 A;  2BJO A;  1I3Q I;  3CMA 1;  4NB8 A;  3CCU Z;  3J80 b;  3CCR Z;  4E32 A;  3CMA Z;  1VQ6 1;  2QEX 1;  4Y7N I;  3GTP I;  1VQK 1;  4RV9 A;  4EWC A;  2QEX Z;  1YUA A;  1KC8 2;  4NBH A;  1VQM Z;  3HKZ A;  1VQK Z;  3J81 f;  2QLV B;  3IX0 A;  5FLX f;  2R92 I;  3S1Q I;  1Z01 A;  4NBG A;  4NBE A;  1TWF I;  3RZO I;  5D1O A;  2G2K A;  2PK7 A;  1Z02 A;  4A3E I;  4E31 A;  3PO3 I;  3CPW Y;  1VQP 1;  4MXU A;  1NP6 A; 
#chains in the Genus database with same CATH homology
 4E2W A;  4RVD A;  4MH4 A;  2HF1 A;  1K73 1;  1LQL A;  1VQ7 1;  1NJI 1;  1DL6 A;  1VQ7 Z;  5FLM I;  2NVY I;  1N8R 2;  1N2F A;  4NBB A;  2QRC B;  5IT9 f;  1KC8 1;  1QYP A;  3BG1 B;  3I56 1;  4A3I I;  2GTH A;  4HGY A;  3I56 Z;  4E2Y A;  5LL6 f;  1KD1 2;  3G71 Z;  1JJ2 Y;  2JMO A;  2ZAE B;  3GTG I;  2V8K A;  4NBF A;  5C4X I;  3OW2 Y;  3NFZ A;  1USP A;  2LIY A;  3LUS A;  4E30 A;  2B63 I;  4NFR A;  2NVX I;  3CCE Z;  3HOW I;  1L1O C;  2H85 A;  5IP9 I;  1VQ4 Z;  3CPW Z;  5CM2 M;  4A3G I;  1X3W A;  2KI7 B;  2RIQ A;  4NH1 C;  2I3C A;  2YU9 I;  2HU9 A;  1TFI A;  1YHQ 1;  1N8R 1;  5C3E I;  3F3P C;  3Q87 A;  3CME 1;  1YHQ Z;  4A3M I;  2JA7 I;  2R6M A;  3CQZ I;  1S72 Z;  3I07 A;  3NH5 A;  2IZ3 A;  2OOY B;  2JR6 A;  1VQ9 1;  4A3K I;  2JNY A;  1RQF A;  1VLA A;  1KD1 1;  3J81 b;  5FLX b;  1VQ8 1;  2JA6 I;  2E2I I;  3KIF A;  1R9T I;  1YUK A;  2VUG A;  2WB1 A;  1K73 2;  4MD8 A;  1YIT 1;  2GU2 A;  3H0G I;  3QWU A;  3CC4 Z;  1QVF Z;  1YIT Z;  3CCR 1;  1VQN Z;  1M1K 2;  4QTT A;  4A3L I;  1K8A 2;  1NUI A;  1QF8 A;  2VF1 A;  1YJW Z;  1VQM 1;  3TDH B;  2RT9 A;  4A3B I;  4A3F I;  1YJN Z;  4S1T A;  3CCJ Z;  4DK1 A;  1ZB9 A;  3S14 I;  5IT9 b;  4A3J I;  2Q4Z A;  2M48 A;  2OTJ Z;  3M4O I;  4TNU A;  3CCS 1;  4A93 I;  4E2X A;  2PM9 A;  4QTU A;  1M90 1;  3CCS Z;  1YI2 1;  3S2D I;  1YI2 Z;  1I50 I;  1VQO 1;  1Q86 2;  2JA5 I;  1VQO Z;  3HOZ I;  2AKL A;  1M1K 1;  3G6E 1;  1K8A 1;  1VQL 1;  4NBA A;  2IZ4 A;  3G6E Z;  1VQL Z;  1QVG Y;  4RVG A;  5T67 A;  1JWH C;  1K9M 2;  2P28 A;  3G71 1;  2NVT I;  5A2Q f;  3HOV I;  4E2Z A;  4BBS I;  2JA8 I;  2Y0S A;  4AYB A;  2O4H A;  3VB9 A;  3CCQ 1;  1Q81 1;  3CCQ Z;  3CXC Y;  3GTM S;  4CL1 A;  2F4M A;  2OOX B;  3I55 Z;  3CCE 1;  5T64 A;  2VUM I;  2NVQ I;  4BY1 I;  1VQ4 1;  5D1P A;  1YJ9 Z;  1KQS Y;  2WAQ A;  4NBC A;  3MON A;  4Y52 I;  1SFO I;  2K5R A;  3JAM f;  1Q86 1;  3F3F C;  1USP B;  3ESW A;  2YAD A;  2W03 A;  4XX2 A;  3CC7 1;  1S72 1;  2R93 I;  3CC7 Z;  1Y1W I;  3CD6 1;  3GTQ I;  3KIH A;  2M6N A;  4BBR I;  3CD6 Z;  3U50 C;  1K9M 1;  1RO0 A;  3BG0 B;  3FKI I;  4A3D I;  2E9H A;  2OTL Z;  2RPR A;  2O53 A;  1JJ2 Z;  1M90 2;  2GTI A;  3OW2 Z;  5T6B A;  3CC4 1;  1TWC I;  3IF8 A;  3TE5 B;  3CXC Z;  3H3V J;  3GTM I;  3S17 I;  2RBL A;  1VQN 1;  1KQS Z;  2QR1 B;  4MON A;  1YJW 1;  1VQ5 1;  4MRI A;  1YJN 1;  1VQ5 Z;  1K83 I;  1W2B Y;  2QA4 1;  2DE5 A;  1WCM I;  1I6H I;  1RO4 A;  1TWA I;  3CCJ 1;  3NH8 A;  2QA4 Z;  3S1R I;  4BY7 I;  3T4N B;  2PMZ A;  1P9N A;  2R7Z I;  4DGL A;  1Q81 2;  2E2J I;  2OTJ 1;  1VQ6 Z;  4NOZ A;  1Q82 1;  1PFT A;  2V8J A;  3GTJ I;  5A2Q b;  3EER A;  3I4N I;  3GTK I;  5D1O B;  3CCM 1;  2J6A A;  1ZB8 A;  4RS4 A;  3VTN A;  3CCM Z;  4RVH A;  3NDI A;  3D9X A;  3GKQ A;  3S1N I;  3PO2 I;  1X3Z A;  3J80 f;  1WII A;  2QRE B;  1X0T A;  4MD9 A;  3EED A;  1RLY A;  2W04 A;  1W2B Z;  1VQP Z;  3NH4 A;  2V8I A;  4HH4 A;  1ZH1 A;  3JAM b;  3CCV 1;  3HOU I;  3CCV Z;  4NB9 A;  4MD7 A;  2P3Y A;  1Y1V S;  3I55 1;  4NBD A;  3P5J B;  1YJ9 1;  3I4M I;  1TWG I;  4HGZ A;  3S2H I;  4X6A I;  2QKD A;  3FQQ A;  3VMG A;  3G4S 1;  3GTL I;  3G4S Z;  2E2H I;  2RHB A;  2Q51 A;  3MZK B;  1Z03 A;  5C44 I;  4A3C I;  1Q7Y 2;  2JS4 A;  1QVF Y;  3S15 I;  3S1M I;  1TWH I;  2DE6 A;  3D6W A;  4RVF A;  3HOY I;  1S7M A;  3FQM A;  3HOX I;  1QVG Z;  1RNI A;  2JUB A;  3S16 I;  3RZD I;  5AN9 F;  2OTL 1;  3VMI A;  1Q82 2;  5IP7 I;  3VMH A;  2DE7 A;  3GTO I;  3NDJ A;  3GCF A;  3J7A 4;  1Y1V I;  3CME Z;  2K3R A;  1KRL A;  2LFU A;  4BXX I;  3M3Y I;  2KPI A;  3CC2 1;  2EGT A;  1YIJ 1;  2QRD B;  3CC2 Z;  5C4J I;  1VQ9 Z;  1YIJ Z;  3PO3 S;  2F4O A;  1VQ8 Z;  4DQY B;  1Q7Y 1;  3CCL 1;  3K7A I;  2OZK A;  3CCL Z;  1NJI 2;  1RO2 A;  3MZL B;  3IFU A;  1ML8 A;  3CCU 1;  1WW9 A;  4E33 A;  2BJO A;  1I3Q I;  3CMA 1;  4NB8 A;  3CCU Z;  3J80 b;  3CCR Z;  4E32 A;  3CMA Z;  1VQ6 1;  2QEX 1;  4Y7N I;  3GTP I;  1VQK 1;  4RV9 A;  4EWC A;  2QEX Z;  1YUA A;  1KC8 2;  4NBH A;  1VQM Z;  3HKZ A;  1VQK Z;  3J81 f;  2QLV B;  3IX0 A;  5FLX f;  2R92 I;  3S1Q I;  1Z01 A;  4NBG A;  4NBE A;  1TWF I;  3RZO I;  5D1O A;  2G2K A;  2PK7 A;  1Z02 A;  4A3E I;  4E31 A;  3PO3 I;  3CPW Y;  1VQP 1;  4MXU A;  1NP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...