2QR1B

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
QYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 4
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qr1B01
3TDHB 2QLVB 2QRCB 3TE5B 2QRDB 3T4NB 2QR1B 2OOYB 2OOXB 2QREB
chains in the Genus database with same CATH superfamily
3J80b 2LFUA 1VQ8Z 1YJWZ 1VQL1 4MD7A 2V45A 1VQ7Z 5A2Qb 2IZ4A 4HH4A 4DK1A 2W03A 4A3KI 4A3JI 1NJI1 2QR1B 4A3BI 1FDIA 3CC4Z 4A3CI 1Q862 5C4JI 1YUAA 2V8KA 1Y1VI 2QRCB 2E2JI 1FDOA 3P5JB 1VQLZ 3CXCY 2OOYB 4BY7I 3CME1 4A93I 2QA4Z 3HOVI 1JWHC 1M1K2 3PO2I 2OOXB 2RPRA 1WJ2A 3F3PC 3F3FC 1KRLA 1ZH1A 2JA8I 3CCEZ 1VQK1 1Q7Y2 3CCU1 4NBAA 4RVFA 2RIQA 2NVYI 3GTOI 2QEX1 2WB1A 1TFIA 2E2HI 1VQMZ 1YHQ1 3I55Z 1ZB8A 3QWUA 4BBRI 3NDJA 2YU9I 5D1OB 2P3YA 3S17I 1QYPA 1K732 3CC2Z 1X0TA 4DQYB 1K8A2 2GU2A 3S16I 1PFTA 2PMZA 4E33A 2F4OA 4E2WA 2E9HA 3IFUA 3D2LA 4A3FI 1YHQZ 3J81f 1X3ZA 3S1QI 1YUKA 1SFOI 1K83I 3J81b 3NH4A 3CC7Z 4E2YA 4NB8A 2JA6I 2JS4A 1USPA 1Z01A 1KC81 3GTMS 2VPZA 1YI21 2G2KA 1KD12 3MZLB 4NBBA 2OTJZ 4NBGA 2Y0SA 3BG0B 2JNYA 2KI7B 1W2BY 1TWHI 1QVFZ 1K9M2 3GTMI 2Q4ZA 3GKQA 3ESWA 3CCJ1 2F4MA 3CPWZ 4BXXI 3HOZI 3RZOI 1VQP1 1YI2Z 3S14I 1Q822 2HU9A 5IT9f 1Z03A 2AKLA 2PM9A 4Y7NI 2K3RA 1WZNA 1YJNZ 1Z02A 3EEDA 1Q811 4AYBA 2VPXA 3H3VJ 1S721 5IT9b 3VTNA 2O4HA 4RVGA 2JIQA 3CCJZ 1Y1VS 1VQ41 3JAMf 1L1OC 2DE7A 2JMOA 3FQQA 2VUGA 2GTIA 3Q87A 5C44I 3CCQ1 3JAMb 3J7A4 1TWCI 1Q7Y1 1S72Z 2R92I 3VMGA 1KQSZ 1YIJ1 2IZ3A 5D1PA 2RT9A 4NBEA 4NOZA 3K7AI 2W04A 1LQLA 2LIYA 2E2II 1VQ61 1YJ91 1K731 3G4S1 3TDHB 4BY1I 3CPWY 1VQ51 2NAPA 1P9NA 2NVQI 1YIJZ 3I07A 4NBFA 3CMEZ 2OTL1 1QVGZ 3PO3S 3OW2Y 1VQO1 1DL6A 4RV9A 4E2ZA 1M902 4E2XA 4MH4A 1YJ9Z 5FLXf 3MONA 3G4SZ 1VQKZ 3CCUZ 1SIWA 2YADA 1JJ2Z 4EWCA 3I4NI 2QEXZ 3GTPI 1TWAI 2GTHA 5FLXb 2LEXA 3CCV1 3PO3I 4A3GI 2VPWA 3S2DI 3S1NI 2OTLZ 1X3WA 1R9TI 4Y52I 3NFZA 1KQSY 2JA5I 3D6WA 3H0GI 3G711 1AA6A 3S1RI 4A3II 2DE6A 1N8R2 3CQZI 1WCMI 4MONA 4E30A 1NP6A 2O53A 4TNUA 2VF1A 2ZAEB 2R6MA 3M4OI 2JIMA 3HOXI 3G71Z 3CMA1 3NH8A 3CCS1 1RLYA 3CCM1 4S1TA 1RO4A 3FQMA 2J6AA 3D9XA 2WAQA 4RVHA 1Q16A 3CCR1 1JJ2Y 1I50I 3NDIA 2R93I 1RNIA 3T4NB 2EGTA 3HOWI 4NH1C 1Q861 2V8IA 1VQ91 3HOYI 1I3QI 3G6E1 1VQN1 3CCL1 3CCSZ 5CM2M 1YJW1 1VQ81 1QF8A 1RO2A 2HF1A 4MXUA 2V3VA 2VPYA 4QTTA 1WIIA 2M6NA 3LUSA 1VQPZ 2NVTI 4HGYA 1M1K1 3CCRZ 3M3YI 3NH5A 3S1MI 3U50C 3CD61 3CC41 1RO0A 5AN9F 1VLAA 2JIPA 5T67A 4QTUA 2RHBA 3GCFA 2M48A 3CCLZ 2R7ZI 3GTJI 1VQ4Z 3S15I 2QA41 1RQFA 4NBHA 3MZKB 5C4XI 3CD6Z 1M901 1QVFY 2BJOA 2QLVB 3CCE1 2B63I 3CCQZ 1K8A1 1Q812 2P28A 4BBSI 2H85A 1TWGI 1YIT1 2OZKA 3TE5B 1VQM1 5D1OA 5LL6f 4HGZA 1I6HI 2NVXI 3I551 1TWFI 3RZDI 1NJI2 4NFRA 4NB9A 3IF8A 1VQ6Z 3CC21 4A3MI 2PK7A 4MRIA 2VUMI 4MD8A 1VQ5Z 1YITZ 2QKDA 2JA7I 5T64A 1N8R1 4CL1A 4X6AI 2JUBA 1N2FA 3VB9A 1W2BZ 3IX0A 1VQOZ 4XX2A 1KD11 3I4MI 2I3CA 3CC71 3IR7A 1ZB9A 3GTKI 3VMHA 2IV2X 2QREB 1K9M1 3CCVZ 1S7MA 4E31A 1ML8A 5IP7I 2V8JA 4NBDA 2QRDB 1Q821 2OTJ1 1NUIA 3GTGI 2Q51A 3HKZA 2K5RA 3FKII 5C3EI 4RS4A 3EERA 3I561 3S2HI 3KIFA 1Y8CA 1QVGY 5IP9I 4RVDA 4A3DI 3BG1B 3HOUI 4A3LI 5FLMI 3CXCZ 3G6EZ 2AYDA 4MD9A 1USPB 2KPIA 2E7ZA 2RBLA 4NBCA 1YJN1 1Y1WI 2JIRA 3I56Z 3CMAZ 3CCMZ 1VQ71 1QXFA 4DGLA 1KC82 3VMIA 2DE5A 2JR6A 1WW9A 3J80f 2JIOA 4E32A 3GTLI 3KIHA 5A2Qf 3OW2Z 1VQ9Z 5T6BA 1VQNZ 4A3EI 3GTQI
chains in the Genus database with same CATH topology
3J80b 2LFUA 1VQ8Z 1YJWZ 1VQL1 4MD7A 1VQ7Z 5A2Qb 2IZ4A 4HH4A 4DK1A 2W03A 4A3KI 4A3JI 1NJI1 2QR1B 4A3BI 3CC4Z 4A3CI 1Q862 5C4JI 1YUAA 2V8KA 1Y1VI 2QRCB 2E2JI 3P5JB 1VQLZ 3CXCY 2OOYB 4BY7I 3CME1 4A93I 2QA4Z 3HOVI 1JWHC 1M1K2 3PO2I 2OOXB 2RPRA 3F3PC 3F3FC 1KRLA 1ZH1A 2JA8I 3CCEZ 1VQK1 1Q7Y2 3CCU1 4NBAA 4RVFA 2RIQA 2NVYI 3GTOI 2QEX1 2WB1A 1TFIA 2E2HI 1VQMZ 1YHQ1 3I55Z 1ZB8A 3QWUA 4BBRI 3NDJA 2YU9I 5D1OB 2P3YA 3S17I 1QYPA 1K732 3CC2Z 1X0TA 4DQYB 1K8A2 2GU2A 3S16I 1PFTA 2PMZA 4E33A 2F4OA 4E2WA 2E9HA 3IFUA 4A3FI 1YHQZ 3J81f 1X3ZA 3S1QI 1YUKA 1SFOI 1K83I 3J81b 3NH4A 3CC7Z 4E2YA 4NB8A 2JA6I 2JS4A 1USPA 1Z01A 1KC81 3GTMS 1YI21 2G2KA 1KD12 3MZLB 4NBBA 2OTJZ 4NBGA 2Y0SA 3BG0B 2JNYA 2KI7B 1W2BY 1TWHI 1QVFZ 1K9M2 3GTMI 2Q4ZA 3GKQA 3ESWA 3CCJ1 2F4MA 3CPWZ 4BXXI 3HOZI 3RZOI 1VQP1 1YI2Z 3S14I 1Q822 2HU9A 5IT9f 1Z03A 2AKLA 2PM9A 4Y7NI 2K3RA 1YJNZ 1Z02A 3EEDA 1Q811 4AYBA 3H3VJ 5IT9b 1S721 3VTNA 2O4HA 4RVGA 3CCJZ 1Y1VS 1VQ41 3JAMf 1L1OC 2DE7A 2JMOA 3FQQA 2VUGA 2GTIA 3Q87A 5C44I 3CCQ1 3JAMb 3J7A4 1TWCI 1Q7Y1 1S72Z 2R92I 3VMGA 1KQSZ 1YIJ1 2IZ3A 5D1PA 2RT9A 4NBEA 4NOZA 3K7AI 2W04A 1LQLA 2LIYA 2E2II 1VQ61 1YJ91 1K731 3G4S1 3TDHB 4BY1I 3CPWY 1VQ51 1P9NA 2NVQI 1YIJZ 3I07A 4NBFA 3CMEZ 2OTL1 1QVGZ 3PO3S 3OW2Y 1VQO1 1DL6A 4RV9A 4E2ZA 1M902 4E2XA 4MH4A 1YJ9Z 5FLXf 3MONA 3G4SZ 1VQKZ 3CCUZ 2YADA 1JJ2Z 4EWCA 3I4NI 2QEXZ 3GTPI 1TWAI 2GTHA 5FLXb 3CCV1 3PO3I 4A3GI 3S2DI 3S1NI 2OTLZ 1X3WA 1R9TI 4Y52I 3NFZA 1KQSY 2JA5I 3D6WA 3H0GI 3G711 3S1RI 4A3II 2DE6A 1N8R2 3CQZI 1WCMI 4MONA 4E30A 1NP6A 2O53A 4TNUA 2VF1A 2ZAEB 2R6MA 3M4OI 3HOXI 3G71Z 3CMA1 3NH8A 3CCS1 1RLYA 3CCM1 4S1TA 1RO4A 3FQMA 2J6AA 3D9XA 2WAQA 4RVHA 3CCR1 1JJ2Y 1I50I 3NDIA 2R93I 1RNIA 3T4NB 2EGTA 3HOWI 4NH1C 1Q861 2V8IA 1VQ91 3HOYI 1I3QI 3G6E1 1VQN1 3CCL1 3CCSZ 5CM2M 1YJW1 1VQ81 1QF8A 1RO2A 2HF1A 4MXUA 4QTTA 1WIIA 2M6NA 3LUSA 1VQPZ 2NVTI 4HGYA 1M1K1 3CCRZ 3M3YI 3NH5A 3S1MI 3U50C 3CD61 3CC41 1RO0A 5AN9F 1VLAA 5T67A 4QTUA 2RHBA 3GCFA 2M48A 3CCLZ 2R7ZI 3GTJI 1VQ4Z 3S15I 2QA41 1RQFA 4NBHA 3MZKB 5C4XI 3CD6Z 1M901 1QVFY 2BJOA 2QLVB 3CCE1 2B63I 3CCQZ 1K8A1 1Q812 2P28A 4BBSI 2H85A 1TWGI 1YIT1 2OZKA 3TE5B 1VQM1 5D1OA 5LL6f 4HGZA 1I6HI 2NVXI 3I551 1TWFI 3RZDI 1NJI2 4NFRA 4NB9A 3IF8A 1VQ6Z 3CC21 4A3MI 2PK7A 4MRIA 2VUMI 4MD8A 1VQ5Z 1YITZ 2QKDA 2JA7I 5T64A 1N8R1 4CL1A 4X6AI 2JUBA 1N2FA 3VB9A 1W2BZ 3IX0A 1VQOZ 4XX2A 1KD11 3I4MI 2I3CA 3CC71 1ZB9A 3GTKI 3VMHA 2QREB 1K9M1 3CCVZ 1S7MA 4E31A 1ML8A 5IP7I 2V8JA 4NBDA 2QRDB 1Q821 2OTJ1 1NUIA 3GTGI 2Q51A 3HKZA 2K5RA 3FKII 5C3EI 4RS4A 3EERA 3I561 3S2HI 3KIFA 1QVGY 5IP9I 4RVDA 4A3DI 3BG1B 3HOUI 4A3LI 5FLMI 3CXCZ 3G6EZ 4MD9A 1USPB 2KPIA 2RBLA 4NBCA 1YJN1 1Y1WI 3I56Z 3CMAZ 3CCMZ 1VQ71 4DGLA 1KC82 3VMIA 2DE5A 2JR6A 1WW9A 3J80f 4E32A 3GTLI 3KIHA 5A2Qf 3OW2Z 1VQ9Z 5T6BA 1VQNZ 4A3EI 3GTQI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDH B;  2QLV B;  2QRC B;  3TE5 B;  2QRD B;  3T4N B;  2QR1 B;  2OOY B;  2OOX B;  2QRE B; 
#chains in the Genus database with same CATH topology
 3J80 b;  2LFU A;  1VQ8 Z;  1YJW Z;  1VQL 1;  4MD7 A;  2V45 A;  1VQ7 Z;  5A2Q b;  2IZ4 A;  4HH4 A;  4DK1 A;  2W03 A;  4A3K I;  4A3J I;  1NJI 1;  2QR1 B;  4A3B I;  1FDI A;  3CC4 Z;  4A3C I;  1Q86 2;  5C4J I;  1YUA A;  2V8K A;  1Y1V I;  2QRC B;  2E2J I;  1FDO A;  3P5J B;  1VQL Z;  3CXC Y;  2OOY B;  4BY7 I;  3CME 1;  4A93 I;  2QA4 Z;  3HOV I;  1JWH C;  1M1K 2;  3PO2 I;  2OOX B;  2RPR A;  1WJ2 A;  3F3P C;  3F3F C;  1KRL A;  1ZH1 A;  2JA8 I;  3CCE Z;  1VQK 1;  1Q7Y 2;  3CCU 1;  4NBA A;  4RVF A;  2RIQ A;  2NVY I;  3GTO I;  2QEX 1;  2WB1 A;  1TFI A;  2E2H I;  1VQM Z;  1YHQ 1;  3I55 Z;  1ZB8 A;  3QWU A;  4BBR I;  3NDJ A;  2YU9 I;  5D1O B;  2P3Y A;  3S17 I;  1QYP A;  1K73 2;  3CC2 Z;  1X0T A;  4DQY B;  1K8A 2;  2GU2 A;  3S16 I;  1PFT A;  2PMZ A;  4E33 A;  2F4O A;  4E2W A;  2E9H A;  3IFU A;  3D2L A;  4A3F I;  1YHQ Z;  3J81 f;  1X3Z A;  3S1Q I;  1YUK A;  1SFO I;  1K83 I;  3J81 b;  3NH4 A;  3CC7 Z;  4E2Y A;  4NB8 A;  2JA6 I;  2JS4 A;  1USP A;  1Z01 A;  1KC8 1;  3GTM S;  2VPZ A;  1YI2 1;  2G2K A;  1KD1 2;  3MZL B;  4NBB A;  2OTJ Z;  4NBG A;  2Y0S A;  3BG0 B;  2JNY A;  2KI7 B;  1W2B Y;  1TWH I;  1QVF Z;  1K9M 2;  3GTM I;  2Q4Z A;  3GKQ A;  3ESW A;  3CCJ 1;  2F4M A;  3CPW Z;  4BXX I;  3HOZ I;  3RZO I;  1VQP 1;  1YI2 Z;  3S14 I;  1Q82 2;  2HU9 A;  5IT9 f;  1Z03 A;  2AKL A;  2PM9 A;  4Y7N I;  2K3R A;  1WZN A;  1YJN Z;  1Z02 A;  3EED A;  1Q81 1;  4AYB A;  2VPX A;  3H3V J;  1S72 1;  5IT9 b;  3VTN A;  2O4H A;  4RVG A;  2JIQ A;  3CCJ Z;  1Y1V S;  1VQ4 1;  3JAM f;  1L1O C;  2DE7 A;  2JMO A;  3FQQ A;  2VUG A;  2GTI A;  3Q87 A;  5C44 I;  3CCQ 1;  3JAM b;  3J7A 4;  1TWC I;  1Q7Y 1;  1S72 Z;  2R92 I;  3VMG A;  1KQS Z;  1YIJ 1;  2IZ3 A;  5D1P A;  2RT9 A;  4NBE A;  4NOZ A;  3K7A I;  2W04 A;  1LQL A;  2LIY A;  2E2I I;  1VQ6 1;  1YJ9 1;  1K73 1;  3G4S 1;  3TDH B;  4BY1 I;  3CPW Y;  1VQ5 1;  2NAP A;  1P9N A;  2NVQ I;  1YIJ Z;  3I07 A;  4NBF A;  3CME Z;  2OTL 1;  1QVG Z;  3PO3 S;  3OW2 Y;  1VQO 1;  1DL6 A;  4RV9 A;  4E2Z A;  1M90 2;  4E2X A;  4MH4 A;  1YJ9 Z;  5FLX f;  3MON A;  3G4S Z;  1VQK Z;  3CCU Z;  1SIW A;  2YAD A;  1JJ2 Z;  4EWC A;  3I4N I;  2QEX Z;  3GTP I;  1TWA I;  2GTH A;  5FLX b;  2LEX A;  3CCV 1;  3PO3 I;  4A3G I;  2VPW A;  3S2D I;  3S1N I;  2OTL Z;  1X3W A;  1R9T I;  4Y52 I;  3NFZ A;  1KQS Y;  2JA5 I;  3D6W A;  3H0G I;  3G71 1;  1AA6 A;  3S1R I;  4A3I I;  2DE6 A;  1N8R 2;  3CQZ I;  1WCM I;  4MON A;  4E30 A;  1NP6 A;  2O53 A;  4TNU A;  2VF1 A;  2ZAE B;  2R6M A;  3M4O I;  2JIM A;  3HOX I;  3G71 Z;  3CMA 1;  3NH8 A;  3CCS 1;  1RLY A;  3CCM 1;  4S1T A;  1RO4 A;  3FQM A;  2J6A A;  3D9X A;  2WAQ A;  4RVH A;  1Q16 A;  3CCR 1;  1JJ2 Y;  1I50 I;  3NDI A;  2R93 I;  1RNI A;  3T4N B;  2EGT A;  3HOW I;  4NH1 C;  1Q86 1;  2V8I A;  1VQ9 1;  3HOY I;  1I3Q I;  3G6E 1;  1VQN 1;  3CCL 1;  3CCS Z;  5CM2 M;  1YJW 1;  1VQ8 1;  1QF8 A;  1RO2 A;  2HF1 A;  4MXU A;  2V3V A;  2VPY A;  4QTT A;  1WII A;  2M6N A;  3LUS A;  1VQP Z;  2NVT I;  4HGY A;  1M1K 1;  3CCR Z;  3M3Y I;  3NH5 A;  3S1M I;  3U50 C;  3CD6 1;  3CC4 1;  1RO0 A;  5AN9 F;  1VLA A;  2JIP A;  5T67 A;  4QTU A;  2RHB A;  3GCF A;  2M48 A;  3CCL Z;  2R7Z I;  3GTJ I;  1VQ4 Z;  3S15 I;  2QA4 1;  1RQF A;  4NBH A;  3MZK B;  5C4X I;  3CD6 Z;  1M90 1;  1QVF Y;  2BJO A;  2QLV B;  3CCE 1;  2B63 I;  3CCQ Z;  1K8A 1;  1Q81 2;  2P28 A;  4BBS I;  2H85 A;  1TWG I;  1YIT 1;  2OZK A;  3TE5 B;  1VQM 1;  5D1O A;  5LL6 f;  4HGZ A;  1I6H I;  2NVX I;  3I55 1;  1TWF I;  3RZD I;  1NJI 2;  4NFR A;  4NB9 A;  3IF8 A;  1VQ6 Z;  3CC2 1;  4A3M I;  2PK7 A;  4MRI A;  2VUM I;  4MD8 A;  1VQ5 Z;  1YIT Z;  2QKD A;  2JA7 I;  5T64 A;  1N8R 1;  4CL1 A;  4X6A I;  2JUB A;  1N2F A;  3VB9 A;  1W2B Z;  3IX0 A;  1VQO Z;  4XX2 A;  1KD1 1;  3I4M I;  2I3C A;  3CC7 1;  3IR7 A;  1ZB9 A;  3GTK I;  3VMH A;  2IV2 X;  2QRE B;  1K9M 1;  3CCV Z;  1S7M A;  4E31 A;  1ML8 A;  5IP7 I;  2V8J A;  4NBD A;  2QRD B;  1Q82 1;  2OTJ 1;  1NUI A;  3GTG I;  2Q51 A;  3HKZ A;  2K5R A;  3FKI I;  5C3E I;  4RS4 A;  3EER A;  3I56 1;  3S2H I;  3KIF A;  1Y8C A;  1QVG Y;  5IP9 I;  4RVD A;  4A3D I;  3BG1 B;  3HOU I;  4A3L I;  5FLM I;  3CXC Z;  3G6E Z;  2AYD A;  4MD9 A;  1USP B;  2KPI A;  2E7Z A;  2RBL A;  4NBC A;  1YJN 1;  1Y1W I;  2JIR A;  3I56 Z;  3CMA Z;  3CCM Z;  1VQ7 1;  1QXF A;  4DGL A;  1KC8 2;  3VMI A;  2DE5 A;  2JR6 A;  1WW9 A;  3J80 f;  2JIO A;  4E32 A;  3GTL I;  3KIH A;  5A2Q f;  3OW2 Z;  1VQ9 Z;  5T6B A;  1VQN Z;  4A3E I;  3GTQ I; 
#chains in the Genus database with same CATH homology
 3J80 b;  2LFU A;  1VQ8 Z;  1YJW Z;  1VQL 1;  4MD7 A;  1VQ7 Z;  5A2Q b;  2IZ4 A;  4HH4 A;  4DK1 A;  2W03 A;  4A3K I;  4A3J I;  1NJI 1;  2QR1 B;  4A3B I;  3CC4 Z;  4A3C I;  1Q86 2;  5C4J I;  1YUA A;  2V8K A;  1Y1V I;  2QRC B;  2E2J I;  3P5J B;  1VQL Z;  3CXC Y;  2OOY B;  4BY7 I;  3CME 1;  4A93 I;  2QA4 Z;  3HOV I;  1JWH C;  1M1K 2;  3PO2 I;  2OOX B;  2RPR A;  3F3P C;  3F3F C;  1KRL A;  1ZH1 A;  2JA8 I;  3CCE Z;  1VQK 1;  1Q7Y 2;  3CCU 1;  4NBA A;  4RVF A;  2RIQ A;  2NVY I;  3GTO I;  2QEX 1;  2WB1 A;  1TFI A;  2E2H I;  1VQM Z;  1YHQ 1;  3I55 Z;  1ZB8 A;  3QWU A;  4BBR I;  3NDJ A;  2YU9 I;  5D1O B;  2P3Y A;  3S17 I;  1QYP A;  1K73 2;  3CC2 Z;  1X0T A;  4DQY B;  1K8A 2;  2GU2 A;  3S16 I;  1PFT A;  2PMZ A;  4E33 A;  2F4O A;  4E2W A;  2E9H A;  3IFU A;  4A3F I;  1YHQ Z;  3J81 f;  1X3Z A;  3S1Q I;  1YUK A;  1SFO I;  1K83 I;  3J81 b;  3NH4 A;  3CC7 Z;  4E2Y A;  4NB8 A;  2JA6 I;  2JS4 A;  1USP A;  1Z01 A;  1KC8 1;  3GTM S;  1YI2 1;  2G2K A;  1KD1 2;  3MZL B;  4NBB A;  2OTJ Z;  4NBG A;  2Y0S A;  3BG0 B;  2JNY A;  2KI7 B;  1W2B Y;  1TWH I;  1QVF Z;  1K9M 2;  3GTM I;  2Q4Z A;  3GKQ A;  3ESW A;  3CCJ 1;  2F4M A;  3CPW Z;  4BXX I;  3HOZ I;  3RZO I;  1VQP 1;  1YI2 Z;  3S14 I;  1Q82 2;  2HU9 A;  5IT9 f;  1Z03 A;  2AKL A;  2PM9 A;  4Y7N I;  2K3R A;  1YJN Z;  1Z02 A;  3EED A;  1Q81 1;  4AYB A;  3H3V J;  5IT9 b;  1S72 1;  3VTN A;  2O4H A;  4RVG A;  3CCJ Z;  1Y1V S;  1VQ4 1;  3JAM f;  1L1O C;  2DE7 A;  2JMO A;  3FQQ A;  2VUG A;  2GTI A;  3Q87 A;  5C44 I;  3CCQ 1;  3JAM b;  3J7A 4;  1TWC I;  1Q7Y 1;  1S72 Z;  2R92 I;  3VMG A;  1KQS Z;  1YIJ 1;  2IZ3 A;  5D1P A;  2RT9 A;  4NBE A;  4NOZ A;  3K7A I;  2W04 A;  1LQL A;  2LIY A;  2E2I I;  1VQ6 1;  1YJ9 1;  1K73 1;  3G4S 1;  3TDH B;  4BY1 I;  3CPW Y;  1VQ5 1;  1P9N A;  2NVQ I;  1YIJ Z;  3I07 A;  4NBF A;  3CME Z;  2OTL 1;  1QVG Z;  3PO3 S;  3OW2 Y;  1VQO 1;  1DL6 A;  4RV9 A;  4E2Z A;  1M90 2;  4E2X A;  4MH4 A;  1YJ9 Z;  5FLX f;  3MON A;  3G4S Z;  1VQK Z;  3CCU Z;  2YAD A;  1JJ2 Z;  4EWC A;  3I4N I;  2QEX Z;  3GTP I;  1TWA I;  2GTH A;  5FLX b;  3CCV 1;  3PO3 I;  4A3G I;  3S2D I;  3S1N I;  2OTL Z;  1X3W A;  1R9T I;  4Y52 I;  3NFZ A;  1KQS Y;  2JA5 I;  3D6W A;  3H0G I;  3G71 1;  3S1R I;  4A3I I;  2DE6 A;  1N8R 2;  3CQZ I;  1WCM I;  4MON A;  4E30 A;  1NP6 A;  2O53 A;  4TNU A;  2VF1 A;  2ZAE B;  2R6M A;  3M4O I;  3HOX I;  3G71 Z;  3CMA 1;  3NH8 A;  3CCS 1;  1RLY A;  3CCM 1;  4S1T A;  1RO4 A;  3FQM A;  2J6A A;  3D9X A;  2WAQ A;  4RVH A;  3CCR 1;  1JJ2 Y;  1I50 I;  3NDI A;  2R93 I;  1RNI A;  3T4N B;  2EGT A;  3HOW I;  4NH1 C;  1Q86 1;  2V8I A;  1VQ9 1;  3HOY I;  1I3Q I;  3G6E 1;  1VQN 1;  3CCL 1;  3CCS Z;  5CM2 M;  1YJW 1;  1VQ8 1;  1QF8 A;  1RO2 A;  2HF1 A;  4MXU A;  4QTT A;  1WII A;  2M6N A;  3LUS A;  1VQP Z;  2NVT I;  4HGY A;  1M1K 1;  3CCR Z;  3M3Y I;  3NH5 A;  3S1M I;  3U50 C;  3CD6 1;  3CC4 1;  1RO0 A;  5AN9 F;  1VLA A;  5T67 A;  4QTU A;  2RHB A;  3GCF A;  2M48 A;  3CCL Z;  2R7Z I;  3GTJ I;  1VQ4 Z;  3S15 I;  2QA4 1;  1RQF A;  4NBH A;  3MZK B;  5C4X I;  3CD6 Z;  1M90 1;  1QVF Y;  2BJO A;  2QLV B;  3CCE 1;  2B63 I;  3CCQ Z;  1K8A 1;  1Q81 2;  2P28 A;  4BBS I;  2H85 A;  1TWG I;  1YIT 1;  2OZK A;  3TE5 B;  1VQM 1;  5D1O A;  5LL6 f;  4HGZ A;  1I6H I;  2NVX I;  3I55 1;  1TWF I;  3RZD I;  1NJI 2;  4NFR A;  4NB9 A;  3IF8 A;  1VQ6 Z;  3CC2 1;  4A3M I;  2PK7 A;  4MRI A;  2VUM I;  4MD8 A;  1VQ5 Z;  1YIT Z;  2QKD A;  2JA7 I;  5T64 A;  1N8R 1;  4CL1 A;  4X6A I;  2JUB A;  1N2F A;  3VB9 A;  1W2B Z;  3IX0 A;  1VQO Z;  4XX2 A;  1KD1 1;  3I4M I;  2I3C A;  3CC7 1;  1ZB9 A;  3GTK I;  3VMH A;  2QRE B;  1K9M 1;  3CCV Z;  1S7M A;  4E31 A;  1ML8 A;  5IP7 I;  2V8J A;  4NBD A;  2QRD B;  1Q82 1;  2OTJ 1;  1NUI A;  3GTG I;  2Q51 A;  3HKZ A;  2K5R A;  3FKI I;  5C3E I;  4RS4 A;  3EER A;  3I56 1;  3S2H I;  3KIF A;  1QVG Y;  5IP9 I;  4RVD A;  4A3D I;  3BG1 B;  3HOU I;  4A3L I;  5FLM I;  3CXC Z;  3G6E Z;  4MD9 A;  1USP B;  2KPI A;  2RBL A;  4NBC A;  1YJN 1;  1Y1W I;  3I56 Z;  3CMA Z;  3CCM Z;  1VQ7 1;  4DGL A;  1KC8 2;  3VMI A;  2DE5 A;  2JR6 A;  1WW9 A;  3J80 f;  4E32 A;  3GTL I;  3KIH A;  5A2Q f;  3OW2 Z;  1VQ9 Z;  5T6B A;  1VQN Z;  4A3E I;  3GTQ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...