2QR1B

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
QYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 4
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qr1B01
2QREB 2OOYB 2QR1B 3TDHB 3TE5B 2QRDB 2QLVB 3T4NB 2OOXB 2QRCB
chains in the Genus database with same CATH superfamily
1VQ4Z 2AYDA 5C44I 1QVFZ 4NBCA 3CCQZ 2QR1B 2NVXI 3NDIA 1VQ71 4NBBA 3GTOI 1YIT1 1RO2A 4NBFA 3RZOI 1RLYA 1VQ7Z 1W2BY 2R6MA 3G4SZ 3GTMS 1YITZ 4NOZA 4MRIA 5C4XI 3CD6Z 2W03A 3G711 3I551 3RZDI 1YI2Z 1N8R2 1Y8CA 3S2HI 3J80b 2O4HA 1KC81 1Q812 3S17I 5D1OB 2E9HA 3G71Z 3S1RI 4NH1C 2HF1A 1YJ9Z 2B63I 4RV9A 4E31A 1K83I 5D1PA 1ML8A 3CCM1 2E7ZA 2KI7B 3CCJZ 2OTJZ 3CCRZ 5IT9b 4NBGA 3GTGI 4A3EI 3EERA 1VQ6Z 1K9M1 1VQOZ 3CCMZ 3GTKI 5FLXb 1ZH1A 2RHBA 4NBDA 1DL6A 2RBLA 2AKLA 2GU2A 3CQZI 2QRCB 3S2DI 3TE5B 1QXFA 4NBAA 1I6HI 2E2II 3D9XA 2VUGA 1Q811 5IP7I 3CCSZ 1M902 5T6BA 4TNUA 4DK1A 1M1K2 3GCFA 4S1TA 4NB8A 3D2LA 1QVGZ 2O53A 1QYPA 3MZLB 2V45A 3CCL1 1VQMZ 3CC21 2RIQA 3VTNA 1KQSY 2M6NA 3CCLZ 2HU9A 1YJW1 2NVQI 3ESWA 3CPWY 2R93I 2JA6I 1KRLA 4CL1A 1Y1VI 3KIFA 1YJWZ 2LIYA 3MONA 2VF1A 2WB1A 1LQLA 3T4NB 3G6EZ 2VPYA 4E2WA 2OZKA 2Q4ZA 4BBSI 1SIWA 3CMAZ 5AN9F 2JIRA 1KD12 2BJOA 4DQYB 1YJNZ 3CXCZ 2E2JI 2QRDB 5T64A 1QF8A 2LEXA 3F3PC 4A3LI 3IX0A 1S7MA 2LFUA 1K8A2 3CCU1 2JMOA 2V3VA 3VMHA 1RQFA 4Y7NI 3CC71 2IZ4A 1W2BZ 3CC7Z 3CC41 3K7AI 3S16I 4BBRI 2NVTI 1FDOA 2VPWA 3EEDA 1VQK1 1K732 1WZNA 2NAPA 3CC4Z 3I561 4HH4A 3VB9A 2PMZA 2JIOA 1VQKZ 3FKII 1PFTA 2V8JA 2QA41 2M48A 1QVFY 1L1OC 4MXUA 3OW2Z 1TWAI 3I55Z 4A3JI 2JNYA 1JJ2Y 2QA4Z 4RVDA 1I50I 4MD8A 4A3II 1WW9A 2V8KA 1P9NA 2OOYB 5T67A 5A2Qf 1NUIA 2GTIA 1VQL1 3NH5A 5C3EI 2DE6A 3FQQA 2QKDA 2OOXB 4E30A 1K731 2YADA 4NBEA 1VQLZ 3FQMA 3BG1B 3HOVI 1USPB 1N8R1 1RNIA 1Q7Y2 5LL6f 1USPA 2J6AA 3S1QI 4MONA 3KIHA 3J81f 2PM9A 2VUMI 1S721 2JA7I 3J7A4 1TFIA 3IR7A 4BXXI 4DGLA 2P28A 1VQP1 2DE5A 2QEX1 1S72Z 3I4NI 1VQN1 3P5JB 3VMGA 2I3CA 3BG0B 3HOZI 1Z02A 4HGZA 2JIPA 2YU9I 3NDJA 5C4JI 2JS4A 2OTL1 2QLVB 4A93I 1AA6A 4AYBA 3CC2Z 1R9TI 2OTLZ 1Q822 1Y1WI 2DE7A 1NJI2 4X6AI 2IV2X 4HGYA 1YUKA 1TWHI 3GKQA 1M901 1VQ81 2PK7A 1VQ51 3U50C 1YIJ1 4A3CI 4A3KI 2JA5I 1M1K1 2JIQA 4A3GI 3PO3I 3VMIA 2VPXA 2RT9A 3JAMf 2K3RA 4QTUA 2F4OA 1YUAA 3HKZA 3QWUA 3GTLI 2QREB 1I3QI 3PO2I 2RPRA 3M3YI 3NFZA 3CCUZ 1VQ41 2Y0SA 3CCQ1 1TWFI 1WCMI 4EWCA 3CXCY 3H0GI 4RS4A 1JJ2Z 4Y52I 1KD11 3I56Z 1VLAA 1SFOI 3G4S1 4A3DI 5FLMI 1K9M2 3I4MI 2H85A 1K8A1 3CD61 1YI21 4NBHA 1WJ2A 1TWCI 5A2Qb 3MZKB 4A3FI 1YJ91 3S1NI 3NH8A 1TWGI 4QTTA 3CME1 2JR6A 3J80f 3HOXI 2R92I 3S14I 1VQ91 4MD9A 1Q862 5D1OA 3NH4A 3CMEZ 4E2YA 4BY7I 1ZB9A 1Z03A 3CCJ1 3OW2Y 3CCR1 1VQ9Z 2OTJ1 3GTMI 1ZB8A 1VQ61 2WAQA 1VQO1 3S15I 4NB9A 5IP9I 1RO4A 2E2HI 3J81b 2R7ZI 4A3BI 2KPIA 2VPZA 4RVGA 1N2FA 4MD7A 5IT9f 4A3MI 4E2ZA 1X3WA 1Z01A 3TDHB 3S1MI 5FLXf 2Q51A 1Y1VS 3HOWI 1X3ZA 3CCS1 1NP6A 1KQSZ 1X0TA 3D6WA 4NFRA 2P3YA 1VQPZ 2QEXZ 3CPWZ 3Q87A 1Q861 2G2KA 4E2XA 3PO3S 1WIIA 1VQNZ 3M4OI 2EGTA 3GTQI 1Q7Y1 3CCE1 4XX2A 1VQM1 4RVFA 3HOUI 4RVHA 3HOYI 5CM2M 1YHQ1 2V8IA 3CCEZ 2F4MA 2IZ3A 1FDIA 1QVGY 2JA8I 3GTPI 1YHQZ 1VQ8Z 4MH4A 2GTHA 1VQ5Z 3JAMb 1YIJZ 2ZAEB 3I07A 4E32A 1JWHC 3F3FC 3G6E1 3IF8A 3GTJI 4BY1I 1RO0A 3CMA1 1YJN1 3CCV1 3LUSA 2JUBA 4E33A 2W04A 1Q821 1KC82 2NVYI 1NJI1 3CCVZ 3H3VJ 1Q16A 2K5RA 2JIMA 3IFUA
chains in the Genus database with same CATH topology
1VQ4Z 5C44I 1QVFZ 4NBCA 3CCQZ 2QR1B 2NVXI 3NDIA 1VQ71 4NBBA 3GTOI 1YIT1 1RO2A 4NBFA 3RZOI 1RLYA 1VQ7Z 1W2BY 2R6MA 3G4SZ 3GTMS 1YITZ 4NOZA 4MRIA 5C4XI 3CD6Z 2W03A 3G711 3I551 3RZDI 1YI2Z 1N8R2 3S2HI 3J80b 2O4HA 1KC81 1Q812 3S17I 5D1OB 2E9HA 3G71Z 3S1RI 4NH1C 2HF1A 1YJ9Z 2B63I 4RV9A 4E31A 1K83I 5D1PA 1ML8A 3CCM1 2KI7B 3CCJZ 2OTJZ 3CCRZ 5IT9b 4NBGA 3GTGI 4A3EI 3EERA 1VQ6Z 1K9M1 1VQOZ 3CCMZ 3GTKI 5FLXb 1ZH1A 2RHBA 4NBDA 1DL6A 2RBLA 2AKLA 2GU2A 3CQZI 2QRCB 3S2DI 3TE5B 4NBAA 1I6HI 2E2II 3D9XA 2VUGA 1Q811 5IP7I 3CCSZ 1M902 5T6BA 4TNUA 4DK1A 1M1K2 3GCFA 4S1TA 4NB8A 1QVGZ 2O53A 1QYPA 3MZLB 3CCL1 1VQMZ 3CC21 2RIQA 3VTNA 1KQSY 2M6NA 3CCLZ 2HU9A 1YJW1 2NVQI 3ESWA 3CPWY 2R93I 2JA6I 1KRLA 4CL1A 1Y1VI 3KIFA 1YJWZ 2LIYA 3MONA 2VF1A 2WB1A 1LQLA 3T4NB 3G6EZ 4E2WA 2OZKA 2Q4ZA 4BBSI 3CMAZ 5AN9F 1KD12 2BJOA 4DQYB 1YJNZ 3CXCZ 2E2JI 2QRDB 5T64A 1QF8A 3F3PC 4A3LI 3IX0A 1S7MA 2LFUA 1K8A2 3CCU1 2JMOA 3VMHA 1RQFA 4Y7NI 3CC71 2IZ4A 1W2BZ 3CC7Z 3CC41 3K7AI 3S16I 4BBRI 2NVTI 1VQK1 3EEDA 1K732 3CC4Z 3I561 4HH4A 3VB9A 2PMZA 1VQKZ 3FKII 1PFTA 2V8JA 2QA41 2M48A 1QVFY 1L1OC 4MXUA 3OW2Z 1TWAI 3I55Z 4A3JI 2JNYA 1JJ2Y 2QA4Z 4RVDA 1I50I 4MD8A 4A3II 1WW9A 2V8KA 1P9NA 2OOYB 5T67A 5A2Qf 1NUIA 2GTIA 1VQL1 3NH5A 5C3EI 2DE6A 3FQQA 2QKDA 2OOXB 4E30A 1K731 2YADA 4NBEA 1VQLZ 3FQMA 3BG1B 3HOVI 1USPB 1N8R1 1RNIA 1Q7Y2 5LL6f 1USPA 2J6AA 3S1QI 4MONA 3KIHA 3J81f 2PM9A 2VUMI 1S721 2JA7I 3J7A4 1TFIA 4BXXI 4DGLA 2P28A 1VQP1 2DE5A 2QEX1 1S72Z 3I4NI 1VQN1 3P5JB 3VMGA 2I3CA 3BG0B 3HOZI 1Z02A 4HGZA 2YU9I 3NDJA 5C4JI 2JS4A 2OTL1 2QLVB 4A93I 4AYBA 3CC2Z 1R9TI 2OTLZ 1Q822 1Y1WI 2DE7A 1NJI2 4X6AI 4HGYA 1YUKA 1TWHI 3GKQA 1M901 1VQ81 2PK7A 1VQ51 3U50C 1YIJ1 4A3CI 4A3KI 2JA5I 1M1K1 4A3GI 3PO3I 3VMIA 2RT9A 3JAMf 2K3RA 4QTUA 2F4OA 1YUAA 3HKZA 3QWUA 3GTLI 2QREB 1I3QI 3PO2I 2RPRA 3M3YI 3NFZA 3CCUZ 1VQ41 2Y0SA 3CCQ1 1TWFI 1WCMI 4EWCA 3CXCY 3H0GI 4RS4A 1JJ2Z 4Y52I 1KD11 3I56Z 1VLAA 1SFOI 3G4S1 4A3DI 5FLMI 1K9M2 3I4MI 2H85A 1K8A1 3CD61 1YI21 4NBHA 1TWCI 5A2Qb 3MZKB 4A3FI 1YJ91 3S1NI 3NH8A 1TWGI 4QTTA 3CME1 2JR6A 3J80f 3HOXI 2R92I 3S14I 1VQ91 4MD9A 1Q862 5D1OA 3NH4A 3CMEZ 4E2YA 4BY7I 1ZB9A 1Z03A 3CCJ1 3OW2Y 3CCR1 1VQ9Z 2OTJ1 3GTMI 1ZB8A 1VQ61 2WAQA 1VQO1 3S15I 4NB9A 5IP9I 1RO4A 2E2HI 3J81b 2R7ZI 4A3BI 2KPIA 4RVGA 1N2FA 4MD7A 5IT9f 4A3MI 4E2ZA 1X3WA 1Z01A 3TDHB 3S1MI 5FLXf 2Q51A 1Y1VS 3HOWI 1X3ZA 3CCS1 1NP6A 1KQSZ 1X0TA 3D6WA 4NFRA 2P3YA 1VQPZ 2QEXZ 3CPWZ 3Q87A 1Q861 2G2KA 4E2XA 3PO3S 1WIIA 1VQNZ 3M4OI 2EGTA 3GTQI 1Q7Y1 3CCE1 4XX2A 1VQM1 4RVFA 3HOUI 4RVHA 3HOYI 5CM2M 1YHQ1 2V8IA 3CCEZ 2F4MA 2IZ3A 1QVGY 2JA8I 3GTPI 1YHQZ 1VQ8Z 4MH4A 2GTHA 1VQ5Z 3JAMb 1YIJZ 2ZAEB 3I07A 4E32A 1JWHC 3F3FC 3G6E1 3IF8A 3GTJI 4BY1I 1RO0A 3CMA1 1YJN1 3CCV1 3LUSA 2JUBA 4E33A 2W04A 1Q821 1KC82 2NVYI 1NJI1 3CCVZ 3H3VJ 2K5RA 3IFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRE B;  2OOY B;  2QR1 B;  3TDH B;  3TE5 B;  2QRD B;  2QLV B;  3T4N B;  2OOX B;  2QRC B; 
#chains in the Genus database with same CATH topology
 1VQ4 Z;  2AYD A;  5C44 I;  1QVF Z;  4NBC A;  3CCQ Z;  2QR1 B;  2NVX I;  3NDI A;  1VQ7 1;  4NBB A;  3GTO I;  1YIT 1;  1RO2 A;  4NBF A;  3RZO I;  1RLY A;  1VQ7 Z;  1W2B Y;  2R6M A;  3G4S Z;  3GTM S;  1YIT Z;  4NOZ A;  4MRI A;  5C4X I;  3CD6 Z;  2W03 A;  3G71 1;  3I55 1;  3RZD I;  1YI2 Z;  1N8R 2;  1Y8C A;  3S2H I;  3J80 b;  2O4H A;  1KC8 1;  1Q81 2;  3S17 I;  5D1O B;  2E9H A;  3G71 Z;  3S1R I;  4NH1 C;  2HF1 A;  1YJ9 Z;  2B63 I;  4RV9 A;  4E31 A;  1K83 I;  5D1P A;  1ML8 A;  3CCM 1;  2E7Z A;  2KI7 B;  3CCJ Z;  2OTJ Z;  3CCR Z;  5IT9 b;  4NBG A;  3GTG I;  4A3E I;  3EER A;  1VQ6 Z;  1K9M 1;  1VQO Z;  3CCM Z;  3GTK I;  5FLX b;  1ZH1 A;  2RHB A;  4NBD A;  1DL6 A;  2RBL A;  2AKL A;  2GU2 A;  3CQZ I;  2QRC B;  3S2D I;  3TE5 B;  1QXF A;  4NBA A;  1I6H I;  2E2I I;  3D9X A;  2VUG A;  1Q81 1;  5IP7 I;  3CCS Z;  1M90 2;  5T6B A;  4TNU A;  4DK1 A;  1M1K 2;  3GCF A;  4S1T A;  4NB8 A;  3D2L A;  1QVG Z;  2O53 A;  1QYP A;  3MZL B;  2V45 A;  3CCL 1;  1VQM Z;  3CC2 1;  2RIQ A;  3VTN A;  1KQS Y;  2M6N A;  3CCL Z;  2HU9 A;  1YJW 1;  2NVQ I;  3ESW A;  3CPW Y;  2R93 I;  2JA6 I;  1KRL A;  4CL1 A;  1Y1V I;  3KIF A;  1YJW Z;  2LIY A;  3MON A;  2VF1 A;  2WB1 A;  1LQL A;  3T4N B;  3G6E Z;  2VPY A;  4E2W A;  2OZK A;  2Q4Z A;  4BBS I;  1SIW A;  3CMA Z;  5AN9 F;  2JIR A;  1KD1 2;  2BJO A;  4DQY B;  1YJN Z;  3CXC Z;  2E2J I;  2QRD B;  5T64 A;  1QF8 A;  2LEX A;  3F3P C;  4A3L I;  3IX0 A;  1S7M A;  2LFU A;  1K8A 2;  3CCU 1;  2JMO A;  2V3V A;  3VMH A;  1RQF A;  4Y7N I;  3CC7 1;  2IZ4 A;  1W2B Z;  3CC7 Z;  3CC4 1;  3K7A I;  3S16 I;  4BBR I;  2NVT I;  1FDO A;  2VPW A;  3EED A;  1VQK 1;  1K73 2;  1WZN A;  2NAP A;  3CC4 Z;  3I56 1;  4HH4 A;  3VB9 A;  2PMZ A;  2JIO A;  1VQK Z;  3FKI I;  1PFT A;  2V8J A;  2QA4 1;  2M48 A;  1QVF Y;  1L1O C;  4MXU A;  3OW2 Z;  1TWA I;  3I55 Z;  4A3J I;  2JNY A;  1JJ2 Y;  2QA4 Z;  4RVD A;  1I50 I;  4MD8 A;  4A3I I;  1WW9 A;  2V8K A;  1P9N A;  2OOY B;  5T67 A;  5A2Q f;  1NUI A;  2GTI A;  1VQL 1;  3NH5 A;  5C3E I;  2DE6 A;  3FQQ A;  2QKD A;  2OOX B;  4E30 A;  1K73 1;  2YAD A;  4NBE A;  1VQL Z;  3FQM A;  3BG1 B;  3HOV I;  1USP B;  1N8R 1;  1RNI A;  1Q7Y 2;  5LL6 f;  1USP A;  2J6A A;  3S1Q I;  4MON A;  3KIH A;  3J81 f;  2PM9 A;  2VUM I;  1S72 1;  2JA7 I;  3J7A 4;  1TFI A;  3IR7 A;  4BXX I;  4DGL A;  2P28 A;  1VQP 1;  2DE5 A;  2QEX 1;  1S72 Z;  3I4N I;  1VQN 1;  3P5J B;  3VMG A;  2I3C A;  3BG0 B;  3HOZ I;  1Z02 A;  4HGZ A;  2JIP A;  2YU9 I;  3NDJ A;  5C4J I;  2JS4 A;  2OTL 1;  2QLV B;  4A93 I;  1AA6 A;  4AYB A;  3CC2 Z;  1R9T I;  2OTL Z;  1Q82 2;  1Y1W I;  2DE7 A;  1NJI 2;  4X6A I;  2IV2 X;  4HGY A;  1YUK A;  1TWH I;  3GKQ A;  1M90 1;  1VQ8 1;  2PK7 A;  1VQ5 1;  3U50 C;  1YIJ 1;  4A3C I;  4A3K I;  2JA5 I;  1M1K 1;  2JIQ A;  4A3G I;  3PO3 I;  3VMI A;  2VPX A;  2RT9 A;  3JAM f;  2K3R A;  4QTU A;  2F4O A;  1YUA A;  3HKZ A;  3QWU A;  3GTL I;  2QRE B;  1I3Q I;  3PO2 I;  2RPR A;  3M3Y I;  3NFZ A;  3CCU Z;  1VQ4 1;  2Y0S A;  3CCQ 1;  1TWF I;  1WCM I;  4EWC A;  3CXC Y;  3H0G I;  4RS4 A;  1JJ2 Z;  4Y52 I;  1KD1 1;  3I56 Z;  1VLA A;  1SFO I;  3G4S 1;  4A3D I;  5FLM I;  1K9M 2;  3I4M I;  2H85 A;  1K8A 1;  3CD6 1;  1YI2 1;  4NBH A;  1WJ2 A;  1TWC I;  5A2Q b;  3MZK B;  4A3F I;  1YJ9 1;  3S1N I;  3NH8 A;  1TWG I;  4QTT A;  3CME 1;  2JR6 A;  3J80 f;  3HOX I;  2R92 I;  3S14 I;  1VQ9 1;  4MD9 A;  1Q86 2;  5D1O A;  3NH4 A;  3CME Z;  4E2Y A;  4BY7 I;  1ZB9 A;  1Z03 A;  3CCJ 1;  3OW2 Y;  3CCR 1;  1VQ9 Z;  2OTJ 1;  3GTM I;  1ZB8 A;  1VQ6 1;  2WAQ A;  1VQO 1;  3S15 I;  4NB9 A;  5IP9 I;  1RO4 A;  2E2H I;  3J81 b;  2R7Z I;  4A3B I;  2KPI A;  2VPZ A;  4RVG A;  1N2F A;  4MD7 A;  5IT9 f;  4A3M I;  4E2Z A;  1X3W A;  1Z01 A;  3TDH B;  3S1M I;  5FLX f;  2Q51 A;  1Y1V S;  3HOW I;  1X3Z A;  3CCS 1;  1NP6 A;  1KQS Z;  1X0T A;  3D6W A;  4NFR A;  2P3Y A;  1VQP Z;  2QEX Z;  3CPW Z;  3Q87 A;  1Q86 1;  2G2K A;  4E2X A;  3PO3 S;  1WII A;  1VQN Z;  3M4O I;  2EGT A;  3GTQ I;  1Q7Y 1;  3CCE 1;  4XX2 A;  1VQM 1;  4RVF A;  3HOU I;  4RVH A;  3HOY I;  5CM2 M;  1YHQ 1;  2V8I A;  3CCE Z;  2F4M A;  2IZ3 A;  1FDI A;  1QVG Y;  2JA8 I;  3GTP I;  1YHQ Z;  1VQ8 Z;  4MH4 A;  2GTH A;  1VQ5 Z;  3JAM b;  1YIJ Z;  2ZAE B;  3I07 A;  4E32 A;  1JWH C;  3F3F C;  3G6E 1;  3IF8 A;  3GTJ I;  4BY1 I;  1RO0 A;  3CMA 1;  1YJN 1;  3CCV 1;  3LUS A;  2JUB A;  4E33 A;  2W04 A;  1Q82 1;  1KC8 2;  2NVY I;  1NJI 1;  3CCV Z;  3H3V J;  1Q16 A;  2K5R A;  2JIM A;  3IFU A; 
#chains in the Genus database with same CATH homology
 1VQ4 Z;  5C44 I;  1QVF Z;  4NBC A;  3CCQ Z;  2QR1 B;  2NVX I;  3NDI A;  1VQ7 1;  4NBB A;  3GTO I;  1YIT 1;  1RO2 A;  4NBF A;  3RZO I;  1RLY A;  1VQ7 Z;  1W2B Y;  2R6M A;  3G4S Z;  3GTM S;  1YIT Z;  4NOZ A;  4MRI A;  5C4X I;  3CD6 Z;  2W03 A;  3G71 1;  3I55 1;  3RZD I;  1YI2 Z;  1N8R 2;  3S2H I;  3J80 b;  2O4H A;  1KC8 1;  1Q81 2;  3S17 I;  5D1O B;  2E9H A;  3G71 Z;  3S1R I;  4NH1 C;  2HF1 A;  1YJ9 Z;  2B63 I;  4RV9 A;  4E31 A;  1K83 I;  5D1P A;  1ML8 A;  3CCM 1;  2KI7 B;  3CCJ Z;  2OTJ Z;  3CCR Z;  5IT9 b;  4NBG A;  3GTG I;  4A3E I;  3EER A;  1VQ6 Z;  1K9M 1;  1VQO Z;  3CCM Z;  3GTK I;  5FLX b;  1ZH1 A;  2RHB A;  4NBD A;  1DL6 A;  2RBL A;  2AKL A;  2GU2 A;  3CQZ I;  2QRC B;  3S2D I;  3TE5 B;  4NBA A;  1I6H I;  2E2I I;  3D9X A;  2VUG A;  1Q81 1;  5IP7 I;  3CCS Z;  1M90 2;  5T6B A;  4TNU A;  4DK1 A;  1M1K 2;  3GCF A;  4S1T A;  4NB8 A;  1QVG Z;  2O53 A;  1QYP A;  3MZL B;  3CCL 1;  1VQM Z;  3CC2 1;  2RIQ A;  3VTN A;  1KQS Y;  2M6N A;  3CCL Z;  2HU9 A;  1YJW 1;  2NVQ I;  3ESW A;  3CPW Y;  2R93 I;  2JA6 I;  1KRL A;  4CL1 A;  1Y1V I;  3KIF A;  1YJW Z;  2LIY A;  3MON A;  2VF1 A;  2WB1 A;  1LQL A;  3T4N B;  3G6E Z;  4E2W A;  2OZK A;  2Q4Z A;  4BBS I;  3CMA Z;  5AN9 F;  1KD1 2;  2BJO A;  4DQY B;  1YJN Z;  3CXC Z;  2E2J I;  2QRD B;  5T64 A;  1QF8 A;  3F3P C;  4A3L I;  3IX0 A;  1S7M A;  2LFU A;  1K8A 2;  3CCU 1;  2JMO A;  3VMH A;  1RQF A;  4Y7N I;  3CC7 1;  2IZ4 A;  1W2B Z;  3CC7 Z;  3CC4 1;  3K7A I;  3S16 I;  4BBR I;  2NVT I;  1VQK 1;  3EED A;  1K73 2;  3CC4 Z;  3I56 1;  4HH4 A;  3VB9 A;  2PMZ A;  1VQK Z;  3FKI I;  1PFT A;  2V8J A;  2QA4 1;  2M48 A;  1QVF Y;  1L1O C;  4MXU A;  3OW2 Z;  1TWA I;  3I55 Z;  4A3J I;  2JNY A;  1JJ2 Y;  2QA4 Z;  4RVD A;  1I50 I;  4MD8 A;  4A3I I;  1WW9 A;  2V8K A;  1P9N A;  2OOY B;  5T67 A;  5A2Q f;  1NUI A;  2GTI A;  1VQL 1;  3NH5 A;  5C3E I;  2DE6 A;  3FQQ A;  2QKD A;  2OOX B;  4E30 A;  1K73 1;  2YAD A;  4NBE A;  1VQL Z;  3FQM A;  3BG1 B;  3HOV I;  1USP B;  1N8R 1;  1RNI A;  1Q7Y 2;  5LL6 f;  1USP A;  2J6A A;  3S1Q I;  4MON A;  3KIH A;  3J81 f;  2PM9 A;  2VUM I;  1S72 1;  2JA7 I;  3J7A 4;  1TFI A;  4BXX I;  4DGL A;  2P28 A;  1VQP 1;  2DE5 A;  2QEX 1;  1S72 Z;  3I4N I;  1VQN 1;  3P5J B;  3VMG A;  2I3C A;  3BG0 B;  3HOZ I;  1Z02 A;  4HGZ A;  2YU9 I;  3NDJ A;  5C4J I;  2JS4 A;  2OTL 1;  2QLV B;  4A93 I;  4AYB A;  3CC2 Z;  1R9T I;  2OTL Z;  1Q82 2;  1Y1W I;  2DE7 A;  1NJI 2;  4X6A I;  4HGY A;  1YUK A;  1TWH I;  3GKQ A;  1M90 1;  1VQ8 1;  2PK7 A;  1VQ5 1;  3U50 C;  1YIJ 1;  4A3C I;  4A3K I;  2JA5 I;  1M1K 1;  4A3G I;  3PO3 I;  3VMI A;  2RT9 A;  3JAM f;  2K3R A;  4QTU A;  2F4O A;  1YUA A;  3HKZ A;  3QWU A;  3GTL I;  2QRE B;  1I3Q I;  3PO2 I;  2RPR A;  3M3Y I;  3NFZ A;  3CCU Z;  1VQ4 1;  2Y0S A;  3CCQ 1;  1TWF I;  1WCM I;  4EWC A;  3CXC Y;  3H0G I;  4RS4 A;  1JJ2 Z;  4Y52 I;  1KD1 1;  3I56 Z;  1VLA A;  1SFO I;  3G4S 1;  4A3D I;  5FLM I;  1K9M 2;  3I4M I;  2H85 A;  1K8A 1;  3CD6 1;  1YI2 1;  4NBH A;  1TWC I;  5A2Q b;  3MZK B;  4A3F I;  1YJ9 1;  3S1N I;  3NH8 A;  1TWG I;  4QTT A;  3CME 1;  2JR6 A;  3J80 f;  3HOX I;  2R92 I;  3S14 I;  1VQ9 1;  4MD9 A;  1Q86 2;  5D1O A;  3NH4 A;  3CME Z;  4E2Y A;  4BY7 I;  1ZB9 A;  1Z03 A;  3CCJ 1;  3OW2 Y;  3CCR 1;  1VQ9 Z;  2OTJ 1;  3GTM I;  1ZB8 A;  1VQ6 1;  2WAQ A;  1VQO 1;  3S15 I;  4NB9 A;  5IP9 I;  1RO4 A;  2E2H I;  3J81 b;  2R7Z I;  4A3B I;  2KPI A;  4RVG A;  1N2F A;  4MD7 A;  5IT9 f;  4A3M I;  4E2Z A;  1X3W A;  1Z01 A;  3TDH B;  3S1M I;  5FLX f;  2Q51 A;  1Y1V S;  3HOW I;  1X3Z A;  3CCS 1;  1NP6 A;  1KQS Z;  1X0T A;  3D6W A;  4NFR A;  2P3Y A;  1VQP Z;  2QEX Z;  3CPW Z;  3Q87 A;  1Q86 1;  2G2K A;  4E2X A;  3PO3 S;  1WII A;  1VQN Z;  3M4O I;  2EGT A;  3GTQ I;  1Q7Y 1;  3CCE 1;  4XX2 A;  1VQM 1;  4RVF A;  3HOU I;  4RVH A;  3HOY I;  5CM2 M;  1YHQ 1;  2V8I A;  3CCE Z;  2F4M A;  2IZ3 A;  1QVG Y;  2JA8 I;  3GTP I;  1YHQ Z;  1VQ8 Z;  4MH4 A;  2GTH A;  1VQ5 Z;  3JAM b;  1YIJ Z;  2ZAE B;  3I07 A;  4E32 A;  1JWH C;  3F3F C;  3G6E 1;  3IF8 A;  3GTJ I;  4BY1 I;  1RO0 A;  3CMA 1;  1YJN 1;  3CCV 1;  3LUS A;  2JUB A;  4E33 A;  2W04 A;  1Q82 1;  1KC8 2;  2NVY I;  1NJI 1;  3CCV Z;  3H3V J;  2K5R A;  3IFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...