1VQ9Z

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
73
structure length
73
Chain Sequence
RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 12
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq9Z00
1S72Z 2QA4Z 3G6EZ 1YIT1 1VQO1 1YJW1 2QEX1 1VQ91 1Q7Y1 3CC21 3CCR1 3CCEZ 3G4SZ 1K732 1M901 3OW2Z 1VQ51 1K8A1 1YITZ 1VQOZ 1YJWZ 2QEXZ 1N8R2 1Q822 3CCRZ 1M1K2 1M1K1 1VQL1 1QVFY 1W2BZ 1VQ61 1YI2Z 1KQSZ 3CC7Z 1JJ2Y 1VQLZ 1Q7Y2 1QVGY 3CMAZ 1M902 1Q811 1YIJZ 1KC81 1VQ6Z 1K8A2 1VQ71 1VQPZ 1YI21 1Q861 3CC71 1VQM1 1K9M1 1VQ41 1VQ8Z 3CC4Z 1VQ7Z 3CXCZ 3OW2Y 3CMA1 1KD11 1YIJ1 3CCQ1 1VQP1 3CPWZ 1VQMZ 1VQ4Z 1NJI1 1Q812 1KC82 1VQKZ 3I56Z 3CC41 1VQ81 3CCQZ 3CCJ1 3CCUZ 1YJ91 1W2BY 3CD61 3CCS1 1QVGZ 1KQSY 1Q862 3CCV1 1K9M2 1YJNZ 3G711 3CCJZ 1YJ9Z 3I551 1KD12 3CD6Z 1VQK1 3CCSZ 3I561 3CME1 3CCLZ 3CCVZ 2OTL1 3CCU1 1QVFZ 1NJI2 1K731 3G71Z 1YHQ1 3CCM1 3I55Z 2OTJ1 1YJN1 1VQN1 3CMEZ 1VQ9Z 1S721 2QA41 3CXCY 1JJ2Z 2OTLZ 1N8R1 3CC2Z 3G6E1 1Q821 3CCL1 3CPWY 1VQ5Z 1YHQZ 3CCE1 3G4S1 3CCMZ 2OTJZ 1VQNZ
chains in the Genus database with same CATH superfamily
3GCFA 4E2YA 4A3BI 5T67A 1VQO1 1I50I 3IF8A 3I4NI 4MRIA 5IP9I 3S17I 3G4SZ 1ML8A 1TWCI 3GTJI 2WAQA 1M901 3BG1B 2RHBA 4MD7A 1KRLA 1RLYA 1TWHI 1YJWZ 3JAMf 1N8R2 4QTUA 3HKZA 2NVQI 2RBLA 4NBBA 2R92I 2LIYA 2ZAEB 1YI2Z 1KQSZ 4NB9A 2GTIA 3GTMI 1VQLZ 2YADA 3FKII 4Y7NI 3H0GI 3MZLB 2NVTI 2M6NA 3HOZI 1Q811 1KC81 1VQ6Z 3NFZA 5FLMI 2E2HI 4DK1A 1TWGI 2AYDA 2QR1B 1X3ZA 3F3FC 1Q861 2VF1A 1VQM1 3D2LA 1VQ41 1VQ8Z 3KIFA 3U50C 1Y1WI 1KD11 3NH8A 2I3CA 1YIJ1 3MZKB 1ZB9A 1I3QI 1WW9A 2VUGA 1NJI1 2JUBA 2Q4ZA 3GKQA 3NDJA 2QKDA 3CCQZ 2RPRA 1WCMI 2R7ZI 1KQSY 4HGYA 3S1MI 1K9M2 5IT9b 2O4HA 3Q87A 4A93I 4A3DI 2DE5A 3CD6Z 2VPXA 3I561 1QYPA 2E2JI 3GTOI 2KPIA 1Z02A 5FLXb 3CCU1 3S15I 1Y1VI 4E2WA 3EEDA 4MONA 3VMHA 3TDHB 1YJN1 3CMEZ 1S721 2O53A 1Q821 3IFUA 1PFTA 2RT9A 4A3KI 1USPB 3VMIA 2OTJZ 1VQNZ 3RZOI 2QA4Z 1K83I 1RQFA 3KIHA 2V3VA 3G6EZ 2V8KA 2QEX1 4MH4A 4NBFA 3CC21 3CCR1 3CCEZ 3MONA 4DQYB 3OW2Z 3NDIA 1VQ51 1Q16A 1K8A1 1YITZ 1VLAA 2M48A 2V45A 3S1RI 5IP7I 2B63I 5A2Qb 4E33A 3S14I 2GTHA 2V8IA 3HOUI 5C4XI 4MXUA 3FQQA 3S16I 3NH4A 1USPA 2IV2X 3BG0B 1QVGY 1M902 2NAPA 1YIJZ 2PM9A 1Z01A 1VQ71 3HOWI 1WIIA 1QF8A 2R93I 3J81f 3CC71 3VB9A 2QRCB 2E2II 4A3CI 1RNIA 3GTMS 3CXCZ 3OW2Y 1YUAA 3CMA1 3S1QI 2JR6A 1VQP1 2WB1A 3CPWZ 2LFUA 3HOXI 1QXFA 1TWFI 1Q812 1KC82 3I56Z 3CC41 4E31A 4MD9A 3CCUZ 4XX2A 1S7MA 3S2DI 4NBGA 1Q862 4NH1C 2EGTA 1YJNZ 2JA8I 4AYBA 3G711 3CCJZ 1YJ9Z 4E2XA 1KD12 4RVHA 3CCSZ 1X0TA 4HGZA 3CCVZ 2QRDB 4NOZA 4RVGA 4BBRI 1NJI2 1K731 1YHQ1 3CCM1 3I55Z 3GTKI 2DE7A 2K5RA 1JJ2Z 3CXCY 2OTLZ 3CC2Z 3HOYI 1SIWA 3P5JB 3RZDI 5C4JI 3CPWY 1VQ5Z 3PO3S 2GU2A 3G4S1 5C3EI 4A3FI 1YJW1 1VQ91 2JMOA 1Q7Y1 1VQOZ 1DL6A 3JAMb 1Q822 2IZ3A 3IR7A 5LL6f 4S1TA 3ESWA 3CQZI 4E30A 1VQL1 3M4OI 4BY1I 1VQ61 1N2FA 1FDOA 1NP6A 3CC7Z 5D1PA 4NBHA 1JJ2Y 2NVXI 3H3VJ 1JWHC 2H85A 1FDIA 2JIQA 3CMAZ 1I6HI 2W03A 1TFIA 1K8A2 1VQPZ 2JA5I 2VUMI 2VPZA 1P9NA 3FQMA 1TWAI 2JA6I 1LQLA 1YUKA 4TNUA 3CC4Z 2HU9A 4EWCA 3GTLI 3GTGI 2W04A 2QREB 2OZKA 3TE5B 3I4MI 3CCQ1 2LEXA 4QTTA 1VQMZ 2VPWA 5CM2M 1VQ4Z 4RS4A 4NB8A 4X6AI 1SFOI 3CD61 2F4MA 1Y8CA 3IX0A 4A3LI 4E32A 2KI7B 1L1OC 5IT9f 2JS4A 1VQK1 4E2ZA 3CME1 2BJOA 1NUIA 4BXXI 5FLXf 1QVFZ 3LUSA 4BY7I 2F4OA 2PMZA 2OTJ1 1VQN1 3GTQI 1VQ9Z 4BBSI 2QA41 1ZH1A 2DE6A 1N8R1 3G6E1 2AKLA 5D1OB 3CCL1 5T6BA 2JIRA 4A3II 2RIQA 3CCE1 4NBEA 1S72Z 2HF1A 2IZ4A 5C44I 3EERA 1RO4A 2OOXB 1YIT1 3VTNA 3I07A 4RV9A 4DGLA 4RVFA 3HOVI 2G2KA 4NBAA 1K732 1X3WA 2QLVB 1ZB8A 2QEXZ 3J80b 3CCRZ 1M1K2 4NBCA 5A2Qf 3QWUA 1M1K1 3F3PC 1QVFY 3NH5A 1W2BZ 1Y1VS 2JIPA 5D1OA 1Q7Y2 2P28A 3PO2I 4Y52I 1WJ2A 3J81b 4A3MI 1YI21 3J7A4 3D9XA 1K9M1 2V8JA 2JA7I 4A3EI 1RO0A 1VQ7Z 3M3YI 2JNYA 1AA6A 2R6MA 3PO3I 2JIMA 2JIOA 4RVDA 2P3YA 2Q51A 2VPYA 4NBDA 4NFRA 1VQKZ 2YU9I 4MD8A 3S1NI 1VQ81 4CL1A 3CCJ1 1YJ91 1W2BY 1R9TI 2PK7A 3CCS1 1QVGZ 4HH4A 3CCV1 1RO2A 5AN9F 3I551 2NVYI 3CCLZ 2J6AA 4A3JI 2OTL1 5T64A 3S2HI 3VMGA 2E9HA 1Z03A 4A3GI 3G71Z 1WZNA 3J80f 3D6WA 3GTPI 3K7AI 2K3RA 2Y0SA 2OOYB 1YHQZ 2E7ZA 3CCMZ 3T4NB
chains in the Genus database with same CATH topology
3GCFA 4E2YA 4A3BI 5T67A 1VQO1 1I50I 3IF8A 3I4NI 4MRIA 5IP9I 3S17I 3G4SZ 1ML8A 1TWCI 3GTJI 2WAQA 1M901 3BG1B 2RHBA 4MD7A 1KRLA 1RLYA 1TWHI 1YJWZ 3JAMf 1N8R2 4QTUA 3HKZA 2NVQI 2RBLA 4NBBA 2R92I 2LIYA 2ZAEB 1YI2Z 1KQSZ 4NB9A 2GTIA 3GTMI 1VQLZ 2YADA 3FKII 4Y7NI 3H0GI 3MZLB 2NVTI 2M6NA 3HOZI 1Q811 1KC81 1VQ6Z 3NFZA 5FLMI 2E2HI 4DK1A 1TWGI 2QR1B 3F3FC 1X3ZA 1Q861 2VF1A 1VQM1 1VQ41 1VQ8Z 3KIFA 3U50C 1Y1WI 1KD11 3NH8A 2I3CA 1YIJ1 3MZKB 1ZB9A 1I3QI 1WW9A 2VUGA 1NJI1 2JUBA 2Q4ZA 3GKQA 3NDJA 2QKDA 3CCQZ 2RPRA 1WCMI 2R7ZI 1KQSY 4HGYA 3S1MI 1K9M2 5IT9b 2O4HA 3Q87A 4A93I 4A3DI 2DE5A 3CD6Z 3I561 1QYPA 2E2JI 3GTOI 2KPIA 1Z02A 5FLXb 3CCU1 3S15I 1Y1VI 4E2WA 3EEDA 4MONA 3VMHA 3TDHB 1YJN1 3CMEZ 1S721 2O53A 1Q821 3IFUA 1PFTA 2RT9A 4A3KI 1USPB 3VMIA 2OTJZ 1VQNZ 3RZOI 2QA4Z 1K83I 1RQFA 3KIHA 3G6EZ 2V8KA 2QEX1 4MH4A 4NBFA 3CC21 3CCR1 3CCEZ 3MONA 4DQYB 3OW2Z 3NDIA 1VQ51 1K8A1 1YITZ 1VLAA 2M48A 3S1RI 5IP7I 2B63I 5A2Qb 4E33A 3S14I 2GTHA 2V8IA 3HOUI 5C4XI 4MXUA 3FQQA 3S16I 3NH4A 1USPA 3BG0B 1QVGY 1M902 1YIJZ 2PM9A 1Z01A 1VQ71 3HOWI 1WIIA 1QF8A 2R93I 3J81f 3CC71 3VB9A 2QRCB 2E2II 4A3CI 1RNIA 3GTMS 3CXCZ 3OW2Y 1YUAA 3CMA1 3S1QI 2JR6A 1VQP1 2WB1A 3CPWZ 2LFUA 3HOXI 1TWFI 1Q812 1KC82 3I56Z 3CC41 4E31A 4MD9A 3CCUZ 4XX2A 1S7MA 3S2DI 4NBGA 1Q862 4NH1C 2EGTA 1YJNZ 2JA8I 4AYBA 3G711 3CCJZ 1YJ9Z 4E2XA 1KD12 4RVHA 3CCSZ 1X0TA 4HGZA 3CCVZ 2QRDB 4NOZA 4RVGA 4BBRI 1NJI2 1K731 1YHQ1 3CCM1 3I55Z 3GTKI 2DE7A 2K5RA 1JJ2Z 3CXCY 2OTLZ 3CC2Z 3HOYI 3RZDI 3P5JB 5C4JI 3CPWY 1VQ5Z 3PO3S 2GU2A 3G4S1 5C3EI 4A3FI 1YJW1 1VQ91 2JMOA 1Q7Y1 1VQOZ 1DL6A 3JAMb 1Q822 2IZ3A 5LL6f 4S1TA 3ESWA 3CQZI 4E30A 1VQL1 3M4OI 4BY1I 1VQ61 1N2FA 1NP6A 3CC7Z 5D1PA 4NBHA 1JJ2Y 2NVXI 3H3VJ 1JWHC 2H85A 3CMAZ 1I6HI 2W03A 1TFIA 1K8A2 1VQPZ 2JA5I 2VUMI 1P9NA 3FQMA 1TWAI 2JA6I 1LQLA 1YUKA 4TNUA 3CC4Z 2HU9A 4EWCA 3GTLI 3GTGI 2W04A 2QREB 2OZKA 3TE5B 3I4MI 3CCQ1 4QTTA 1VQMZ 5CM2M 1VQ4Z 4RS4A 4NB8A 4X6AI 1SFOI 3CD61 2F4MA 3IX0A 4A3LI 4E32A 2KI7B 1L1OC 5IT9f 2JS4A 1VQK1 4E2ZA 3CME1 2BJOA 1NUIA 4BXXI 5FLXf 1QVFZ 3LUSA 4BY7I 2F4OA 2PMZA 2OTJ1 1VQN1 3GTQI 1VQ9Z 4BBSI 2QA41 1ZH1A 2DE6A 1N8R1 3G6E1 2AKLA 5D1OB 3CCL1 5T6BA 4A3II 2RIQA 3CCE1 4NBEA 1S72Z 2HF1A 2IZ4A 5C44I 3EERA 1RO4A 2OOXB 1YIT1 3VTNA 3I07A 4RV9A 4DGLA 4RVFA 3HOVI 2G2KA 4NBAA 1K732 1X3WA 2QLVB 1ZB8A 2QEXZ 3J80b 3CCRZ 1M1K2 4NBCA 5A2Qf 3QWUA 1M1K1 3F3PC 1QVFY 3NH5A 1W2BZ 1Y1VS 5D1OA 1Q7Y2 2P28A 3PO2I 4Y52I 3J81b 4A3MI 1YI21 3J7A4 3D9XA 1K9M1 2V8JA 2JA7I 4A3EI 1RO0A 1VQ7Z 3M3YI 2JNYA 2R6MA 3PO3I 4RVDA 2P3YA 2Q51A 4NBDA 4NFRA 1VQKZ 2YU9I 4MD8A 3S1NI 1VQ81 4CL1A 3CCJ1 1YJ91 1W2BY 1R9TI 2PK7A 3CCS1 1QVGZ 4HH4A 3CCV1 1RO2A 5AN9F 3I551 2NVYI 4A3JI 2J6AA 3CCLZ 2OTL1 5T64A 3S2HI 3VMGA 2E9HA 1Z03A 4A3GI 3G71Z 3J80f 3D6WA 3GTPI 3K7AI 2K3RA 2Y0SA 2OOYB 1YHQZ 3CCMZ 3T4NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 Z;  2QA4 Z;  3G6E Z;  1YIT 1;  1VQO 1;  1YJW 1;  2QEX 1;  1VQ9 1;  1Q7Y 1;  3CC2 1;  3CCR 1;  3CCE Z;  3G4S Z;  1K73 2;  1M90 1;  3OW2 Z;  1VQ5 1;  1K8A 1;  1YIT Z;  1VQO Z;  1YJW Z;  2QEX Z;  1N8R 2;  1Q82 2;  3CCR Z;  1M1K 2;  1M1K 1;  1VQL 1;  1QVF Y;  1W2B Z;  1VQ6 1;  1YI2 Z;  1KQS Z;  3CC7 Z;  1JJ2 Y;  1VQL Z;  1Q7Y 2;  1QVG Y;  3CMA Z;  1M90 2;  1Q81 1;  1YIJ Z;  1KC8 1;  1VQ6 Z;  1K8A 2;  1VQ7 1;  1VQP Z;  1YI2 1;  1Q86 1;  3CC7 1;  1VQM 1;  1K9M 1;  1VQ4 1;  1VQ8 Z;  3CC4 Z;  1VQ7 Z;  3CXC Z;  3OW2 Y;  3CMA 1;  1KD1 1;  1YIJ 1;  3CCQ 1;  1VQP 1;  3CPW Z;  1VQM Z;  1VQ4 Z;  1NJI 1;  1Q81 2;  1KC8 2;  1VQK Z;  3I56 Z;  3CC4 1;  1VQ8 1;  3CCQ Z;  3CCJ 1;  3CCU Z;  1YJ9 1;  1W2B Y;  3CD6 1;  3CCS 1;  1QVG Z;  1KQS Y;  1Q86 2;  3CCV 1;  1K9M 2;  1YJN Z;  3G71 1;  3CCJ Z;  1YJ9 Z;  3I55 1;  1KD1 2;  3CD6 Z;  1VQK 1;  3CCS Z;  3I56 1;  3CME 1;  3CCL Z;  3CCV Z;  2OTL 1;  3CCU 1;  1QVF Z;  1NJI 2;  1K73 1;  3G71 Z;  1YHQ 1;  3CCM 1;  3I55 Z;  2OTJ 1;  1YJN 1;  1VQN 1;  3CME Z;  1VQ9 Z;  1S72 1;  2QA4 1;  3CXC Y;  1JJ2 Z;  2OTL Z;  1N8R 1;  3CC2 Z;  3G6E 1;  1Q82 1;  3CCL 1;  3CPW Y;  1VQ5 Z;  1YHQ Z;  3CCE 1;  3G4S 1;  3CCM Z;  2OTJ Z;  1VQN Z; 
#chains in the Genus database with same CATH topology
 3GCF A;  4E2Y A;  4A3B I;  5T67 A;  1VQO 1;  1I50 I;  3IF8 A;  3I4N I;  4MRI A;  5IP9 I;  3S17 I;  3G4S Z;  1ML8 A;  1TWC I;  3GTJ I;  2WAQ A;  1M90 1;  3BG1 B;  2RHB A;  4MD7 A;  1KRL A;  1RLY A;  1TWH I;  1YJW Z;  3JAM f;  1N8R 2;  4QTU A;  3HKZ A;  2NVQ I;  2RBL A;  4NBB A;  2R92 I;  2LIY A;  2ZAE B;  1YI2 Z;  1KQS Z;  4NB9 A;  2GTI A;  3GTM I;  1VQL Z;  2YAD A;  3FKI I;  4Y7N I;  3H0G I;  3MZL B;  2NVT I;  2M6N A;  3HOZ I;  1Q81 1;  1KC8 1;  1VQ6 Z;  3NFZ A;  5FLM I;  2E2H I;  4DK1 A;  1TWG I;  2AYD A;  2QR1 B;  1X3Z A;  3F3F C;  1Q86 1;  2VF1 A;  1VQM 1;  3D2L A;  1VQ4 1;  1VQ8 Z;  3KIF A;  3U50 C;  1Y1W I;  1KD1 1;  3NH8 A;  2I3C A;  1YIJ 1;  3MZK B;  1ZB9 A;  1I3Q I;  1WW9 A;  2VUG A;  1NJI 1;  2JUB A;  2Q4Z A;  3GKQ A;  3NDJ A;  2QKD A;  3CCQ Z;  2RPR A;  1WCM I;  2R7Z I;  1KQS Y;  4HGY A;  3S1M I;  1K9M 2;  5IT9 b;  2O4H A;  3Q87 A;  4A93 I;  4A3D I;  2DE5 A;  3CD6 Z;  2VPX A;  3I56 1;  1QYP A;  2E2J I;  3GTO I;  2KPI A;  1Z02 A;  5FLX b;  3CCU 1;  3S15 I;  1Y1V I;  4E2W A;  3EED A;  4MON A;  3VMH A;  3TDH B;  1YJN 1;  3CME Z;  1S72 1;  2O53 A;  1Q82 1;  3IFU A;  1PFT A;  2RT9 A;  4A3K I;  1USP B;  3VMI A;  2OTJ Z;  1VQN Z;  3RZO I;  2QA4 Z;  1K83 I;  1RQF A;  3KIH A;  2V3V A;  3G6E Z;  2V8K A;  2QEX 1;  4MH4 A;  4NBF A;  3CC2 1;  3CCR 1;  3CCE Z;  3MON A;  4DQY B;  3OW2 Z;  3NDI A;  1VQ5 1;  1Q16 A;  1K8A 1;  1YIT Z;  1VLA A;  2M48 A;  2V45 A;  3S1R I;  5IP7 I;  2B63 I;  5A2Q b;  4E33 A;  3S14 I;  2GTH A;  2V8I A;  3HOU I;  5C4X I;  4MXU A;  3FQQ A;  3S16 I;  3NH4 A;  1USP A;  2IV2 X;  3BG0 B;  1QVG Y;  1M90 2;  2NAP A;  1YIJ Z;  2PM9 A;  1Z01 A;  1VQ7 1;  3HOW I;  1WII A;  1QF8 A;  2R93 I;  3J81 f;  3CC7 1;  3VB9 A;  2QRC B;  2E2I I;  4A3C I;  1RNI A;  3GTM S;  3CXC Z;  3OW2 Y;  1YUA A;  3CMA 1;  3S1Q I;  2JR6 A;  1VQP 1;  2WB1 A;  3CPW Z;  2LFU A;  3HOX I;  1QXF A;  1TWF I;  1Q81 2;  1KC8 2;  3I56 Z;  3CC4 1;  4E31 A;  4MD9 A;  3CCU Z;  4XX2 A;  1S7M A;  3S2D I;  4NBG A;  1Q86 2;  4NH1 C;  2EGT A;  1YJN Z;  2JA8 I;  4AYB A;  3G71 1;  3CCJ Z;  1YJ9 Z;  4E2X A;  1KD1 2;  4RVH A;  3CCS Z;  1X0T A;  4HGZ A;  3CCV Z;  2QRD B;  4NOZ A;  4RVG A;  4BBR I;  1NJI 2;  1K73 1;  1YHQ 1;  3CCM 1;  3I55 Z;  3GTK I;  2DE7 A;  2K5R A;  1JJ2 Z;  3CXC Y;  2OTL Z;  3CC2 Z;  3HOY I;  1SIW A;  3P5J B;  3RZD I;  5C4J I;  3CPW Y;  1VQ5 Z;  3PO3 S;  2GU2 A;  3G4S 1;  5C3E I;  4A3F I;  1YJW 1;  1VQ9 1;  2JMO A;  1Q7Y 1;  1VQO Z;  1DL6 A;  3JAM b;  1Q82 2;  2IZ3 A;  3IR7 A;  5LL6 f;  4S1T A;  3ESW A;  3CQZ I;  4E30 A;  1VQL 1;  3M4O I;  4BY1 I;  1VQ6 1;  1N2F A;  1FDO A;  1NP6 A;  3CC7 Z;  5D1P A;  4NBH A;  1JJ2 Y;  2NVX I;  3H3V J;  1JWH C;  2H85 A;  1FDI A;  2JIQ A;  3CMA Z;  1I6H I;  2W03 A;  1TFI A;  1K8A 2;  1VQP Z;  2JA5 I;  2VUM I;  2VPZ A;  1P9N A;  3FQM A;  1TWA I;  2JA6 I;  1LQL A;  1YUK A;  4TNU A;  3CC4 Z;  2HU9 A;  4EWC A;  3GTL I;  3GTG I;  2W04 A;  2QRE B;  2OZK A;  3TE5 B;  3I4M I;  3CCQ 1;  2LEX A;  4QTT A;  1VQM Z;  2VPW A;  5CM2 M;  1VQ4 Z;  4RS4 A;  4NB8 A;  4X6A I;  1SFO I;  3CD6 1;  2F4M A;  1Y8C A;  3IX0 A;  4A3L I;  4E32 A;  2KI7 B;  1L1O C;  5IT9 f;  2JS4 A;  1VQK 1;  4E2Z A;  3CME 1;  2BJO A;  1NUI A;  4BXX I;  5FLX f;  1QVF Z;  3LUS A;  4BY7 I;  2F4O A;  2PMZ A;  2OTJ 1;  1VQN 1;  3GTQ I;  1VQ9 Z;  4BBS I;  2QA4 1;  1ZH1 A;  2DE6 A;  1N8R 1;  3G6E 1;  2AKL A;  5D1O B;  3CCL 1;  5T6B A;  2JIR A;  4A3I I;  2RIQ A;  3CCE 1;  4NBE A;  1S72 Z;  2HF1 A;  2IZ4 A;  5C44 I;  3EER A;  1RO4 A;  2OOX B;  1YIT 1;  3VTN A;  3I07 A;  4RV9 A;  4DGL A;  4RVF A;  3HOV I;  2G2K A;  4NBA A;  1K73 2;  1X3W A;  2QLV B;  1ZB8 A;  2QEX Z;  3J80 b;  3CCR Z;  1M1K 2;  4NBC A;  5A2Q f;  3QWU A;  1M1K 1;  3F3P C;  1QVF Y;  3NH5 A;  1W2B Z;  1Y1V S;  2JIP A;  5D1O A;  1Q7Y 2;  2P28 A;  3PO2 I;  4Y52 I;  1WJ2 A;  3J81 b;  4A3M I;  1YI2 1;  3J7A 4;  3D9X A;  1K9M 1;  2V8J A;  2JA7 I;  4A3E I;  1RO0 A;  1VQ7 Z;  3M3Y I;  2JNY A;  1AA6 A;  2R6M A;  3PO3 I;  2JIM A;  2JIO A;  4RVD A;  2P3Y A;  2Q51 A;  2VPY A;  4NBD A;  4NFR A;  1VQK Z;  2YU9 I;  4MD8 A;  3S1N I;  1VQ8 1;  4CL1 A;  3CCJ 1;  1YJ9 1;  1W2B Y;  1R9T I;  2PK7 A;  3CCS 1;  1QVG Z;  4HH4 A;  3CCV 1;  1RO2 A;  5AN9 F;  3I55 1;  2NVY I;  3CCL Z;  2J6A A;  4A3J I;  2OTL 1;  5T64 A;  3S2H I;  3VMG A;  2E9H A;  1Z03 A;  4A3G I;  3G71 Z;  1WZN A;  3J80 f;  3D6W A;  3GTP I;  3K7A I;  2K3R A;  2Y0S A;  2OOY B;  1YHQ Z;  2E7Z A;  3CCM Z;  3T4N B; 
#chains in the Genus database with same CATH homology
 3GCF A;  4E2Y A;  4A3B I;  5T67 A;  1VQO 1;  1I50 I;  3IF8 A;  3I4N I;  4MRI A;  5IP9 I;  3S17 I;  3G4S Z;  1ML8 A;  1TWC I;  3GTJ I;  2WAQ A;  1M90 1;  3BG1 B;  2RHB A;  4MD7 A;  1KRL A;  1RLY A;  1TWH I;  1YJW Z;  3JAM f;  1N8R 2;  4QTU A;  3HKZ A;  2NVQ I;  2RBL A;  4NBB A;  2R92 I;  2LIY A;  2ZAE B;  1YI2 Z;  1KQS Z;  4NB9 A;  2GTI A;  3GTM I;  1VQL Z;  2YAD A;  3FKI I;  4Y7N I;  3H0G I;  3MZL B;  2NVT I;  2M6N A;  3HOZ I;  1Q81 1;  1KC8 1;  1VQ6 Z;  3NFZ A;  5FLM I;  2E2H I;  4DK1 A;  1TWG I;  2QR1 B;  3F3F C;  1X3Z A;  1Q86 1;  2VF1 A;  1VQM 1;  1VQ4 1;  1VQ8 Z;  3KIF A;  3U50 C;  1Y1W I;  1KD1 1;  3NH8 A;  2I3C A;  1YIJ 1;  3MZK B;  1ZB9 A;  1I3Q I;  1WW9 A;  2VUG A;  1NJI 1;  2JUB A;  2Q4Z A;  3GKQ A;  3NDJ A;  2QKD A;  3CCQ Z;  2RPR A;  1WCM I;  2R7Z I;  1KQS Y;  4HGY A;  3S1M I;  1K9M 2;  5IT9 b;  2O4H A;  3Q87 A;  4A93 I;  4A3D I;  2DE5 A;  3CD6 Z;  3I56 1;  1QYP A;  2E2J I;  3GTO I;  2KPI A;  1Z02 A;  5FLX b;  3CCU 1;  3S15 I;  1Y1V I;  4E2W A;  3EED A;  4MON A;  3VMH A;  3TDH B;  1YJN 1;  3CME Z;  1S72 1;  2O53 A;  1Q82 1;  3IFU A;  1PFT A;  2RT9 A;  4A3K I;  1USP B;  3VMI A;  2OTJ Z;  1VQN Z;  3RZO I;  2QA4 Z;  1K83 I;  1RQF A;  3KIH A;  3G6E Z;  2V8K A;  2QEX 1;  4MH4 A;  4NBF A;  3CC2 1;  3CCR 1;  3CCE Z;  3MON A;  4DQY B;  3OW2 Z;  3NDI A;  1VQ5 1;  1K8A 1;  1YIT Z;  1VLA A;  2M48 A;  3S1R I;  5IP7 I;  2B63 I;  5A2Q b;  4E33 A;  3S14 I;  2GTH A;  2V8I A;  3HOU I;  5C4X I;  4MXU A;  3FQQ A;  3S16 I;  3NH4 A;  1USP A;  3BG0 B;  1QVG Y;  1M90 2;  1YIJ Z;  2PM9 A;  1Z01 A;  1VQ7 1;  3HOW I;  1WII A;  1QF8 A;  2R93 I;  3J81 f;  3CC7 1;  3VB9 A;  2QRC B;  2E2I I;  4A3C I;  1RNI A;  3GTM S;  3CXC Z;  3OW2 Y;  1YUA A;  3CMA 1;  3S1Q I;  2JR6 A;  1VQP 1;  2WB1 A;  3CPW Z;  2LFU A;  3HOX I;  1TWF I;  1Q81 2;  1KC8 2;  3I56 Z;  3CC4 1;  4E31 A;  4MD9 A;  3CCU Z;  4XX2 A;  1S7M A;  3S2D I;  4NBG A;  1Q86 2;  4NH1 C;  2EGT A;  1YJN Z;  2JA8 I;  4AYB A;  3G71 1;  3CCJ Z;  1YJ9 Z;  4E2X A;  1KD1 2;  4RVH A;  3CCS Z;  1X0T A;  4HGZ A;  3CCV Z;  2QRD B;  4NOZ A;  4RVG A;  4BBR I;  1NJI 2;  1K73 1;  1YHQ 1;  3CCM 1;  3I55 Z;  3GTK I;  2DE7 A;  2K5R A;  1JJ2 Z;  3CXC Y;  2OTL Z;  3CC2 Z;  3HOY I;  3RZD I;  3P5J B;  5C4J I;  3CPW Y;  1VQ5 Z;  3PO3 S;  2GU2 A;  3G4S 1;  5C3E I;  4A3F I;  1YJW 1;  1VQ9 1;  2JMO A;  1Q7Y 1;  1VQO Z;  1DL6 A;  3JAM b;  1Q82 2;  2IZ3 A;  5LL6 f;  4S1T A;  3ESW A;  3CQZ I;  4E30 A;  1VQL 1;  3M4O I;  4BY1 I;  1VQ6 1;  1N2F A;  1NP6 A;  3CC7 Z;  5D1P A;  4NBH A;  1JJ2 Y;  2NVX I;  3H3V J;  1JWH C;  2H85 A;  3CMA Z;  1I6H I;  2W03 A;  1TFI A;  1K8A 2;  1VQP Z;  2JA5 I;  2VUM I;  1P9N A;  3FQM A;  1TWA I;  2JA6 I;  1LQL A;  1YUK A;  4TNU A;  3CC4 Z;  2HU9 A;  4EWC A;  3GTL I;  3GTG I;  2W04 A;  2QRE B;  2OZK A;  3TE5 B;  3I4M I;  3CCQ 1;  4QTT A;  1VQM Z;  5CM2 M;  1VQ4 Z;  4RS4 A;  4NB8 A;  4X6A I;  1SFO I;  3CD6 1;  2F4M A;  3IX0 A;  4A3L I;  4E32 A;  2KI7 B;  1L1O C;  5IT9 f;  2JS4 A;  1VQK 1;  4E2Z A;  3CME 1;  2BJO A;  1NUI A;  4BXX I;  5FLX f;  1QVF Z;  3LUS A;  4BY7 I;  2F4O A;  2PMZ A;  2OTJ 1;  1VQN 1;  3GTQ I;  1VQ9 Z;  4BBS I;  2QA4 1;  1ZH1 A;  2DE6 A;  1N8R 1;  3G6E 1;  2AKL A;  5D1O B;  3CCL 1;  5T6B A;  4A3I I;  2RIQ A;  3CCE 1;  4NBE A;  1S72 Z;  2HF1 A;  2IZ4 A;  5C44 I;  3EER A;  1RO4 A;  2OOX B;  1YIT 1;  3VTN A;  3I07 A;  4RV9 A;  4DGL A;  4RVF A;  3HOV I;  2G2K A;  4NBA A;  1K73 2;  1X3W A;  2QLV B;  1ZB8 A;  2QEX Z;  3J80 b;  3CCR Z;  1M1K 2;  4NBC A;  5A2Q f;  3QWU A;  1M1K 1;  3F3P C;  1QVF Y;  3NH5 A;  1W2B Z;  1Y1V S;  5D1O A;  1Q7Y 2;  2P28 A;  3PO2 I;  4Y52 I;  3J81 b;  4A3M I;  1YI2 1;  3J7A 4;  3D9X A;  1K9M 1;  2V8J A;  2JA7 I;  4A3E I;  1RO0 A;  1VQ7 Z;  3M3Y I;  2JNY A;  2R6M A;  3PO3 I;  4RVD A;  2P3Y A;  2Q51 A;  4NBD A;  4NFR A;  1VQK Z;  2YU9 I;  4MD8 A;  3S1N I;  1VQ8 1;  4CL1 A;  3CCJ 1;  1YJ9 1;  1W2B Y;  1R9T I;  2PK7 A;  3CCS 1;  1QVG Z;  4HH4 A;  3CCV 1;  1RO2 A;  5AN9 F;  3I55 1;  2NVY I;  4A3J I;  2J6A A;  3CCL Z;  2OTL 1;  5T64 A;  3S2H I;  3VMG A;  2E9H A;  1Z03 A;  4A3G I;  3G71 Z;  3J80 f;  3D6W A;  3GTP I;  3K7A I;  2K3R A;  2Y0S A;  2OOY B;  1YHQ Z;  3CCM Z;  3T4N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...