1K9M2

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k9m200
3G71Z 3CME1 1VQLZ 1KD12 1YIT1 1VQ4Z 3CCJ1 1VQKZ 1N8R1 1M1K2 1VQ71 3I56Z 1Q811 3I55Z 1QVFY 1KC82 3CCQ1 3CCUZ 1KD11 1Q812 3CC4Z 1NJI2 1YI21 3CMAZ 1K8A2 1VQ6Z 3CCL1 1KC81 1N8R2 1M1K1 3CC21 1KQSY 1VQ7Z 2QA4Z 1NJI1 3CCV1 3CCJZ 1Q822 1YITZ 3OW2Y 3CCU1 1Q821 3CCQZ 3CCR1 3CMA1 3CC41 1K8A1 1YI2Z 3CCM1 1VQOZ 3CCEZ 2OTJ1 3OW2Z 1VQM1 3CCS1 1YHQ1 2OTLZ 3CXCY 1YJ9Z 1VQ91 1QVGZ 3CCVZ 1VQPZ 1KQSZ 3CPWZ 1M901 1VQ51 3CCLZ 3CCRZ 2QEX1 1VQNZ 3CC2Z 1W2BZ 1VQ41 1VQP1 1VQ5Z 3CCSZ 1QVFZ 3CD6Z 3CCE1 2OTJZ 3CC71 1VQ9Z 1JJ2Z 3G4SZ 1YJW1 1VQ61 1M902 1VQO1 1K731 2QEXZ 1VQN1 1JJ2Y 1S72Z 1K9M2 1VQ81 1YJNZ 1VQK1 1K732 1Q861 3I561 1VQL1 2QA41 1W2BY 3CMEZ 1VQ8Z 1S721 1YIJZ 1Q862 1YJN1 3CPWY 3G6EZ 3G4S1 1YJWZ 1YHQZ 1Q7Y1 1VQMZ 1QVGY 2OTL1 1K9M1 3G711 1YIJ1 3CD61 1YJ91 3CXCZ 3I551 3G6E1 3CC7Z 3CCMZ 1Q7Y2
chains in the Genus database with same CATH superfamily
5AN9F 1KD12 1YIT1 4MONA 3CCJ1 4BBRI 2VPXA 2OOYB 5C4XI 4AYBA 2JNYA 5A2Qf 4TNUA 2RIQA 2QLVB 5IP7I 3GTOI 4Y7NI 1QVFY 2VPYA 1KC82 4HGZA 1WZNA 3CCUZ 3HKZA 1Q812 3NDIA 3CCL1 2JIOA 4A3FI 1N8R2 4RVHA 3EERA 1ZB9A 2AKLA 4NBHA 1RO0A 1Q822 5D1OA 2KPIA 3PO2I 4E32A 1NUIA 3F3FC 1FDOA 3IR7A 3GTGI 3CCQZ 3CCR1 1SFOI 3IF8A 4DGLA 2E2JI 2V45A 1VQOZ 3NH8A 1AA6A 2OZKA 1YHQ1 3I4MI 2NVTI 2JIPA 3VB9A 3S14I 5C3EI 4A3JI 2EGTA 1QVGZ 4RVFA 2V8KA 2W04A 3CCRZ 2QREB 2QR1B 5D1OB 3CC2Z 3FQMA 3RZOI 3GTPI 1TWCI 4A3II 1VQP1 3U50C 4MH4A 1VQ5Z 2G2KA 3NH4A 4HGYA 4A3CI 3VTNA 3CC71 1VQ9Z 1JJ2Z 4NBBA 1QYPA 1FDIA 1M902 5D1PA 5C4JI 1K731 1VQN1 3JAMb 1JJ2Y 1S72Z 1ZH1A 1DL6A 3IFUA 2QA41 1W2BY 4E30A 1Q862 2LEXA 4E33A 2Q4ZA 1Q7Y1 3VMGA 1QVGY 4MXUA 1K9M1 1YIJ1 2K3RA 2NAPA 4A3MI 1KD11 1TWAI 4RVGA 2M48A 2QRCB 1VQ4Z 1VLAA 2VUMI 4RVDA 1M1K2 1YUAA 4EWCA 4E2ZA 1TFIA 1Q811 3HOXI 2JA5I 2VPZA 3FKII 4A3DI 5IT9f 3CCQ1 3M4OI 1YI21 3S17I 1X3WA 5IT9b 2QRDB 3P5JB 4MD8A 3CC21 3S1QI 1VQ7Z 1N2FA 2QA4Z 1NJI1 3CCV1 2JIQA 1L1OC 2JUBA 1I3QI 2W03A 3GKQA 4X6AI 3CCU1 1KRLA 5FLMI 3CMA1 2JR6A 1K8A1 1RQFA 2E9HA 3OW2Z 3CCS1 3GTLI 3CXCY 1VQ91 3CCVZ 2VPWA 4NBGA 1KQSZ 3CPWZ 2B63I 1VQ51 2JS4A 3H3VJ 3HOZI 2QEX1 2GU2A 1RO4A 3TDHB 3GTMI 3D6WA 3GTMS 4BBSI 3CCSZ 2YU9I 2WAQA 1VQ61 2VUGA 3GTJI 1VQO1 4QTTA 2NVQI 1Z03A 1VQ81 3K7AI 1Q861 2RHBA 3IX0A 3J7A4 4RS4A 2Y0SA 1YIJZ 3G6EZ 3G4S1 1YJWZ 3F3PC 3VMHA 1VQMZ 1RLYA 4A93I 3CD61 3HOVI 2RT9A 3J81b 1SIWA 1P9NA 1USPA 3NFZA 1RO2A 5T64A 3G71Z 3CME1 1QXFA 1VQLZ 2DE5A 2O4HA 3S1NI 3HOYI 3GTKI 3M3YI 4A3BI 1LQLA 4A3EI 1VQKZ 1N8R1 4CL1A 1VQ71 4DQYB 1JWHC 2JIMA 3ESWA 3I56Z 1I50I 2LFUA 2PM9A 1YUKA 1USPB 5CM2M 3CC4Z 1NJI2 3FQQA 3J80f 4HH4A 2F4OA 1KQSY 2PK7A 2QKDA 4MRIA 3GCFA 2H85A 3PO3I 3OW2Y 3CC41 2R6MA 2IZ3A 3HOWI 2R93I 3S2HI 3LUSA 1VQM1 2P3YA 3MONA 1Z02A 5FLXb 2DE6A 3GTQI 3S2DI 1YJ9Z 3I4NI 1VQPZ 2V8JA 2E2II 1M901 3CCLZ 2F4MA 1I6HI 1S7MA 2GTIA 2LIYA 4E2WA 3HOUI 2V3VA 1VQ41 3NH5A 4BY7I 4NBEA 2JA6I 4S1TA 1X0TA 4NOZA 5A2Qb 4E2YA 2JIRA 3J81f 5T67A 2V8IA 3NDJA 2HF1A 2QEXZ 3CQZI 3KIFA 2NVYI 1K9M2 2VF1A 1VQK1 3H0GI 1ZB8A 3I561 2PMZA 3EEDA 2M6NA 1VQ8Z 2ZAEB 1WIIA 4NH1C 2JA8I 2Q51A 1YJN1 3CPWY 4NB8A 1Y1VS 3RZDI 2JMOA 3S15I 3TE5B 3G711 4NBAA 4NB9A 3D9XA 2IZ4A 1YJNZ 2GTHA 3PO3S 2YADA 4RV9A 2I3CA 1RNIA 3KIHA 1TWFI 3D2LA 2JA7I 5C44I 1WJ2A 2K5RA 1X3ZA 2BJOA 4BY1I 3I55Z 1Y8CA 1Y1VI 2KI7B 2DE7A 3MZKB 2E7ZA 1TWHI 3CMAZ 1WCMI 1K8A2 1VQ6Z 1KC81 1M1K1 4DK1A 2HU9A 2NVXI 1PFTA 3QWUA 1Z01A 2AYDA 3CCJZ 2WB1A 3BG1B 4MD7A 1Q16A 5T6BA 3S1MI 1YITZ 3VMIA 1Q821 4NBCA 1YI2Z 3T4NB 3S1RI 3CCM1 3CCEZ 2OTJ1 4Y52I 4MD9A 2OTLZ 3JAMf 2RPRA 4QTUA 1VQNZ 1QF8A 1W2BZ 1WW9A 5LL6f 2R92I 2RBLA 4NBFA 1QVFZ 3CD6Z 1TWGI 3CCE1 3S16I 2OTJZ 3I07A 1K83I 1ML8A 4E31A 3G4SZ 1YJW1 4E2XA 1Y1WI 2J6AA 3BG0B 3MZLB 4A3LI 3Q87A 2OOXB 4A3GI 2E2HI 4BXXI 4NBDA 4A3KI 1K732 2R7ZI 4NFRA 2IV2X 1NP6A 1VQL1 1R9TI 4XX2A 3CMEZ 1S721 2P28A 2O53A 1YHQZ 5IP9I 2OTL1 5FLXf 1YJ91 3CXCZ 3I551 3J80b 3G6E1 3CC7Z 3CCMZ 1Q7Y2
chains in the Genus database with same CATH topology
5AN9F 1KD12 1YIT1 4MONA 3CCJ1 4BBRI 2OOYB 5C4XI 4AYBA 2JNYA 5A2Qf 4TNUA 2RIQA 2QLVB 5IP7I 3GTOI 4Y7NI 1QVFY 1KC82 4HGZA 3CCUZ 3HKZA 1Q812 3NDIA 3CCL1 4A3FI 1N8R2 4RVHA 3EERA 1ZB9A 2AKLA 4NBHA 1RO0A 1Q822 5D1OA 2KPIA 3PO2I 4E32A 1NUIA 3F3FC 3GTGI 3CCQZ 3CCR1 1SFOI 3IF8A 4DGLA 2E2JI 1VQOZ 3NH8A 2OZKA 1YHQ1 3I4MI 2NVTI 3VB9A 3S14I 5C3EI 4A3JI 2EGTA 1QVGZ 4RVFA 2V8KA 2W04A 3CCRZ 2QREB 2QR1B 5D1OB 3CC2Z 3FQMA 3RZOI 3GTPI 1TWCI 4A3II 1VQP1 3U50C 4MH4A 1VQ5Z 2G2KA 3NH4A 4HGYA 4A3CI 3VTNA 3CC71 1VQ9Z 1JJ2Z 4NBBA 1QYPA 1M902 5D1PA 5C4JI 1K731 1VQN1 3JAMb 1JJ2Y 1S72Z 1ZH1A 1DL6A 3IFUA 2QA41 1W2BY 4E30A 1Q862 4E33A 2Q4ZA 1Q7Y1 3VMGA 1QVGY 4MXUA 1K9M1 1YIJ1 2K3RA 4A3MI 1KD11 1TWAI 4RVGA 2M48A 2QRCB 1VQ4Z 1VLAA 2VUMI 4RVDA 1M1K2 1YUAA 4EWCA 4E2ZA 1TFIA 1Q811 3HOXI 2JA5I 3FKII 4A3DI 5IT9f 3CCQ1 3M4OI 1YI21 3S17I 1X3WA 5IT9b 2QRDB 3P5JB 4MD8A 3CC21 3S1QI 1VQ7Z 1N2FA 2QA4Z 1NJI1 3CCV1 1L1OC 2JUBA 1I3QI 2W03A 3GKQA 4X6AI 3CCU1 1KRLA 5FLMI 3CMA1 2JR6A 1K8A1 1RQFA 2E9HA 3OW2Z 3CCS1 3GTLI 3CXCY 1VQ91 3CCVZ 4NBGA 1KQSZ 3CPWZ 2B63I 1VQ51 2JS4A 3H3VJ 3HOZI 2QEX1 2GU2A 1RO4A 3TDHB 3GTMI 3D6WA 3GTMS 4BBSI 3CCSZ 2YU9I 2WAQA 1VQ61 2VUGA 3GTJI 1VQO1 4QTTA 2NVQI 1Z03A 1VQ81 3K7AI 1Q861 2RHBA 3IX0A 3J7A4 4RS4A 2Y0SA 1YIJZ 3G6EZ 3G4S1 1YJWZ 3F3PC 3VMHA 1VQMZ 1RLYA 4A93I 3CD61 3HOVI 2RT9A 3J81b 1P9NA 1USPA 3NFZA 1RO2A 5T64A 3G71Z 3CME1 1VQLZ 2DE5A 2O4HA 3S1NI 3HOYI 3GTKI 3M3YI 4A3BI 1LQLA 4A3EI 1VQKZ 1N8R1 4CL1A 1VQ71 4DQYB 1JWHC 3ESWA 3I56Z 1I50I 2LFUA 2PM9A 1YUKA 1USPB 5CM2M 3CC4Z 1NJI2 3FQQA 3J80f 4HH4A 2F4OA 1KQSY 2PK7A 2QKDA 4MRIA 3GCFA 2H85A 3PO3I 3OW2Y 3CC41 2R6MA 2IZ3A 3HOWI 2R93I 3S2HI 3LUSA 1VQM1 2P3YA 3MONA 1Z02A 5FLXb 2DE6A 3GTQI 3S2DI 1YJ9Z 3I4NI 1VQPZ 2V8JA 2E2II 1M901 3CCLZ 2F4MA 1I6HI 1S7MA 2GTIA 2LIYA 4E2WA 3HOUI 1VQ41 3NH5A 4BY7I 4NBEA 2JA6I 4S1TA 1X0TA 4NOZA 5A2Qb 4E2YA 3J81f 5T67A 2V8IA 3NDJA 2HF1A 2QEXZ 3CQZI 3KIFA 2NVYI 1K9M2 2VF1A 1VQK1 3H0GI 1ZB8A 3I561 2PMZA 3EEDA 2M6NA 1VQ8Z 2ZAEB 1WIIA 4NH1C 2JA8I 2Q51A 1YJN1 3CPWY 4NB8A 1Y1VS 3RZDI 2JMOA 3S15I 3TE5B 3G711 4NBAA 4NB9A 3D9XA 2IZ4A 1YJNZ 2GTHA 3PO3S 2YADA 4RV9A 2I3CA 1RNIA 3KIHA 1TWFI 2JA7I 5C44I 2K5RA 1X3ZA 2BJOA 4BY1I 3I55Z 2KI7B 1Y1VI 2DE7A 3MZKB 1TWHI 3CMAZ 1WCMI 1K8A2 1VQ6Z 1KC81 1M1K1 4DK1A 2HU9A 2NVXI 1PFTA 3QWUA 1Z01A 3CCJZ 2WB1A 3BG1B 4MD7A 5T6BA 3S1MI 1YITZ 3VMIA 1Q821 4NBCA 1YI2Z 3T4NB 3S1RI 3CCM1 3CCEZ 2OTJ1 4Y52I 4MD9A 2OTLZ 3JAMf 2RPRA 4QTUA 1VQNZ 1QF8A 1W2BZ 1WW9A 5LL6f 2R92I 2RBLA 4NBFA 1QVFZ 3CD6Z 1TWGI 3CCE1 3S16I 2OTJZ 3I07A 1K83I 1ML8A 4E31A 3G4SZ 1YJW1 4E2XA 1Y1WI 2J6AA 3BG0B 3MZLB 4A3LI 3Q87A 2OOXB 4A3GI 2E2HI 4BXXI 4NBDA 4A3KI 1K732 2R7ZI 4NFRA 1NP6A 1VQL1 1R9TI 4XX2A 3CMEZ 1S721 2P28A 2O53A 1YHQZ 5IP9I 2OTL1 5FLXf 1YJ91 3CXCZ 3I551 3J80b 3G6E1 3CC7Z 3CCMZ 1Q7Y2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Z;  3CME 1;  1VQL Z;  1KD1 2;  1YIT 1;  1VQ4 Z;  3CCJ 1;  1VQK Z;  1N8R 1;  1M1K 2;  1VQ7 1;  3I56 Z;  1Q81 1;  3I55 Z;  1QVF Y;  1KC8 2;  3CCQ 1;  3CCU Z;  1KD1 1;  1Q81 2;  3CC4 Z;  1NJI 2;  1YI2 1;  3CMA Z;  1K8A 2;  1VQ6 Z;  3CCL 1;  1KC8 1;  1N8R 2;  1M1K 1;  3CC2 1;  1KQS Y;  1VQ7 Z;  2QA4 Z;  1NJI 1;  3CCV 1;  3CCJ Z;  1Q82 2;  1YIT Z;  3OW2 Y;  3CCU 1;  1Q82 1;  3CCQ Z;  3CCR 1;  3CMA 1;  3CC4 1;  1K8A 1;  1YI2 Z;  3CCM 1;  1VQO Z;  3CCE Z;  2OTJ 1;  3OW2 Z;  1VQM 1;  3CCS 1;  1YHQ 1;  2OTL Z;  3CXC Y;  1YJ9 Z;  1VQ9 1;  1QVG Z;  3CCV Z;  1VQP Z;  1KQS Z;  3CPW Z;  1M90 1;  1VQ5 1;  3CCL Z;  3CCR Z;  2QEX 1;  1VQN Z;  3CC2 Z;  1W2B Z;  1VQ4 1;  1VQP 1;  1VQ5 Z;  3CCS Z;  1QVF Z;  3CD6 Z;  3CCE 1;  2OTJ Z;  3CC7 1;  1VQ9 Z;  1JJ2 Z;  3G4S Z;  1YJW 1;  1VQ6 1;  1M90 2;  1VQO 1;  1K73 1;  2QEX Z;  1VQN 1;  1JJ2 Y;  1S72 Z;  1K9M 2;  1VQ8 1;  1YJN Z;  1VQK 1;  1K73 2;  1Q86 1;  3I56 1;  1VQL 1;  2QA4 1;  1W2B Y;  3CME Z;  1VQ8 Z;  1S72 1;  1YIJ Z;  1Q86 2;  1YJN 1;  3CPW Y;  3G6E Z;  3G4S 1;  1YJW Z;  1YHQ Z;  1Q7Y 1;  1VQM Z;  1QVG Y;  2OTL 1;  1K9M 1;  3G71 1;  1YIJ 1;  3CD6 1;  1YJ9 1;  3CXC Z;  3I55 1;  3G6E 1;  3CC7 Z;  3CCM Z;  1Q7Y 2; 
#chains in the Genus database with same CATH topology
 5AN9 F;  1KD1 2;  1YIT 1;  4MON A;  3CCJ 1;  4BBR I;  2VPX A;  2OOY B;  5C4X I;  4AYB A;  2JNY A;  5A2Q f;  4TNU A;  2RIQ A;  2QLV B;  5IP7 I;  3GTO I;  4Y7N I;  1QVF Y;  2VPY A;  1KC8 2;  4HGZ A;  1WZN A;  3CCU Z;  3HKZ A;  1Q81 2;  3NDI A;  3CCL 1;  2JIO A;  4A3F I;  1N8R 2;  4RVH A;  3EER A;  1ZB9 A;  2AKL A;  4NBH A;  1RO0 A;  1Q82 2;  5D1O A;  2KPI A;  3PO2 I;  4E32 A;  1NUI A;  3F3F C;  1FDO A;  3IR7 A;  3GTG I;  3CCQ Z;  3CCR 1;  1SFO I;  3IF8 A;  4DGL A;  2E2J I;  2V45 A;  1VQO Z;  3NH8 A;  1AA6 A;  2OZK A;  1YHQ 1;  3I4M I;  2NVT I;  2JIP A;  3VB9 A;  3S14 I;  5C3E I;  4A3J I;  2EGT A;  1QVG Z;  4RVF A;  2V8K A;  2W04 A;  3CCR Z;  2QRE B;  2QR1 B;  5D1O B;  3CC2 Z;  3FQM A;  3RZO I;  3GTP I;  1TWC I;  4A3I I;  1VQP 1;  3U50 C;  4MH4 A;  1VQ5 Z;  2G2K A;  3NH4 A;  4HGY A;  4A3C I;  3VTN A;  3CC7 1;  1VQ9 Z;  1JJ2 Z;  4NBB A;  1QYP A;  1FDI A;  1M90 2;  5D1P A;  5C4J I;  1K73 1;  1VQN 1;  3JAM b;  1JJ2 Y;  1S72 Z;  1ZH1 A;  1DL6 A;  3IFU A;  2QA4 1;  1W2B Y;  4E30 A;  1Q86 2;  2LEX A;  4E33 A;  2Q4Z A;  1Q7Y 1;  3VMG A;  1QVG Y;  4MXU A;  1K9M 1;  1YIJ 1;  2K3R A;  2NAP A;  4A3M I;  1KD1 1;  1TWA I;  4RVG A;  2M48 A;  2QRC B;  1VQ4 Z;  1VLA A;  2VUM I;  4RVD A;  1M1K 2;  1YUA A;  4EWC A;  4E2Z A;  1TFI A;  1Q81 1;  3HOX I;  2JA5 I;  2VPZ A;  3FKI I;  4A3D I;  5IT9 f;  3CCQ 1;  3M4O I;  1YI2 1;  3S17 I;  1X3W A;  5IT9 b;  2QRD B;  3P5J B;  4MD8 A;  3CC2 1;  3S1Q I;  1VQ7 Z;  1N2F A;  2QA4 Z;  1NJI 1;  3CCV 1;  2JIQ A;  1L1O C;  2JUB A;  1I3Q I;  2W03 A;  3GKQ A;  4X6A I;  3CCU 1;  1KRL A;  5FLM I;  3CMA 1;  2JR6 A;  1K8A 1;  1RQF A;  2E9H A;  3OW2 Z;  3CCS 1;  3GTL I;  3CXC Y;  1VQ9 1;  3CCV Z;  2VPW A;  4NBG A;  1KQS Z;  3CPW Z;  2B63 I;  1VQ5 1;  2JS4 A;  3H3V J;  3HOZ I;  2QEX 1;  2GU2 A;  1RO4 A;  3TDH B;  3GTM I;  3D6W A;  3GTM S;  4BBS I;  3CCS Z;  2YU9 I;  2WAQ A;  1VQ6 1;  2VUG A;  3GTJ I;  1VQO 1;  4QTT A;  2NVQ I;  1Z03 A;  1VQ8 1;  3K7A I;  1Q86 1;  2RHB A;  3IX0 A;  3J7A 4;  4RS4 A;  2Y0S A;  1YIJ Z;  3G6E Z;  3G4S 1;  1YJW Z;  3F3P C;  3VMH A;  1VQM Z;  1RLY A;  4A93 I;  3CD6 1;  3HOV I;  2RT9 A;  3J81 b;  1SIW A;  1P9N A;  1USP A;  3NFZ A;  1RO2 A;  5T64 A;  3G71 Z;  3CME 1;  1QXF A;  1VQL Z;  2DE5 A;  2O4H A;  3S1N I;  3HOY I;  3GTK I;  3M3Y I;  4A3B I;  1LQL A;  4A3E I;  1VQK Z;  1N8R 1;  4CL1 A;  1VQ7 1;  4DQY B;  1JWH C;  2JIM A;  3ESW A;  3I56 Z;  1I50 I;  2LFU A;  2PM9 A;  1YUK A;  1USP B;  5CM2 M;  3CC4 Z;  1NJI 2;  3FQQ A;  3J80 f;  4HH4 A;  2F4O A;  1KQS Y;  2PK7 A;  2QKD A;  4MRI A;  3GCF A;  2H85 A;  3PO3 I;  3OW2 Y;  3CC4 1;  2R6M A;  2IZ3 A;  3HOW I;  2R93 I;  3S2H I;  3LUS A;  1VQM 1;  2P3Y A;  3MON A;  1Z02 A;  5FLX b;  2DE6 A;  3GTQ I;  3S2D I;  1YJ9 Z;  3I4N I;  1VQP Z;  2V8J A;  2E2I I;  1M90 1;  3CCL Z;  2F4M A;  1I6H I;  1S7M A;  2GTI A;  2LIY A;  4E2W A;  3HOU I;  2V3V A;  1VQ4 1;  3NH5 A;  4BY7 I;  4NBE A;  2JA6 I;  4S1T A;  1X0T A;  4NOZ A;  5A2Q b;  4E2Y A;  2JIR A;  3J81 f;  5T67 A;  2V8I A;  3NDJ A;  2HF1 A;  2QEX Z;  3CQZ I;  3KIF A;  2NVY I;  1K9M 2;  2VF1 A;  1VQK 1;  3H0G I;  1ZB8 A;  3I56 1;  2PMZ A;  3EED A;  2M6N A;  1VQ8 Z;  2ZAE B;  1WII A;  4NH1 C;  2JA8 I;  2Q51 A;  1YJN 1;  3CPW Y;  4NB8 A;  1Y1V S;  3RZD I;  2JMO A;  3S15 I;  3TE5 B;  3G71 1;  4NBA A;  4NB9 A;  3D9X A;  2IZ4 A;  1YJN Z;  2GTH A;  3PO3 S;  2YAD A;  4RV9 A;  2I3C A;  1RNI A;  3KIH A;  1TWF I;  3D2L A;  2JA7 I;  5C44 I;  1WJ2 A;  2K5R A;  1X3Z A;  2BJO A;  4BY1 I;  3I55 Z;  1Y8C A;  1Y1V I;  2KI7 B;  2DE7 A;  3MZK B;  2E7Z A;  1TWH I;  3CMA Z;  1WCM I;  1K8A 2;  1VQ6 Z;  1KC8 1;  1M1K 1;  4DK1 A;  2HU9 A;  2NVX I;  1PFT A;  3QWU A;  1Z01 A;  2AYD A;  3CCJ Z;  2WB1 A;  3BG1 B;  4MD7 A;  1Q16 A;  5T6B A;  3S1M I;  1YIT Z;  3VMI A;  1Q82 1;  4NBC A;  1YI2 Z;  3T4N B;  3S1R I;  3CCM 1;  3CCE Z;  2OTJ 1;  4Y52 I;  4MD9 A;  2OTL Z;  3JAM f;  2RPR A;  4QTU A;  1VQN Z;  1QF8 A;  1W2B Z;  1WW9 A;  5LL6 f;  2R92 I;  2RBL A;  4NBF A;  1QVF Z;  3CD6 Z;  1TWG I;  3CCE 1;  3S16 I;  2OTJ Z;  3I07 A;  1K83 I;  1ML8 A;  4E31 A;  3G4S Z;  1YJW 1;  4E2X A;  1Y1W I;  2J6A A;  3BG0 B;  3MZL B;  4A3L I;  3Q87 A;  2OOX B;  4A3G I;  2E2H I;  4BXX I;  4NBD A;  4A3K I;  1K73 2;  2R7Z I;  4NFR A;  2IV2 X;  1NP6 A;  1VQL 1;  1R9T I;  4XX2 A;  3CME Z;  1S72 1;  2P28 A;  2O53 A;  1YHQ Z;  5IP9 I;  2OTL 1;  5FLX f;  1YJ9 1;  3CXC Z;  3I55 1;  3J80 b;  3G6E 1;  3CC7 Z;  3CCM Z;  1Q7Y 2; 
#chains in the Genus database with same CATH homology
 5AN9 F;  1KD1 2;  1YIT 1;  4MON A;  3CCJ 1;  4BBR I;  2OOY B;  5C4X I;  4AYB A;  2JNY A;  5A2Q f;  4TNU A;  2RIQ A;  2QLV B;  5IP7 I;  3GTO I;  4Y7N I;  1QVF Y;  1KC8 2;  4HGZ A;  3CCU Z;  3HKZ A;  1Q81 2;  3NDI A;  3CCL 1;  4A3F I;  1N8R 2;  4RVH A;  3EER A;  1ZB9 A;  2AKL A;  4NBH A;  1RO0 A;  1Q82 2;  5D1O A;  2KPI A;  3PO2 I;  4E32 A;  1NUI A;  3F3F C;  3GTG I;  3CCQ Z;  3CCR 1;  1SFO I;  3IF8 A;  4DGL A;  2E2J I;  1VQO Z;  3NH8 A;  2OZK A;  1YHQ 1;  3I4M I;  2NVT I;  3VB9 A;  3S14 I;  5C3E I;  4A3J I;  2EGT A;  1QVG Z;  4RVF A;  2V8K A;  2W04 A;  3CCR Z;  2QRE B;  2QR1 B;  5D1O B;  3CC2 Z;  3FQM A;  3RZO I;  3GTP I;  1TWC I;  4A3I I;  1VQP 1;  3U50 C;  4MH4 A;  1VQ5 Z;  2G2K A;  3NH4 A;  4HGY A;  4A3C I;  3VTN A;  3CC7 1;  1VQ9 Z;  1JJ2 Z;  4NBB A;  1QYP A;  1M90 2;  5D1P A;  5C4J I;  1K73 1;  1VQN 1;  3JAM b;  1JJ2 Y;  1S72 Z;  1ZH1 A;  1DL6 A;  3IFU A;  2QA4 1;  1W2B Y;  4E30 A;  1Q86 2;  4E33 A;  2Q4Z A;  1Q7Y 1;  3VMG A;  1QVG Y;  4MXU A;  1K9M 1;  1YIJ 1;  2K3R A;  4A3M I;  1KD1 1;  1TWA I;  4RVG A;  2M48 A;  2QRC B;  1VQ4 Z;  1VLA A;  2VUM I;  4RVD A;  1M1K 2;  1YUA A;  4EWC A;  4E2Z A;  1TFI A;  1Q81 1;  3HOX I;  2JA5 I;  3FKI I;  4A3D I;  5IT9 f;  3CCQ 1;  3M4O I;  1YI2 1;  3S17 I;  1X3W A;  5IT9 b;  2QRD B;  3P5J B;  4MD8 A;  3CC2 1;  3S1Q I;  1VQ7 Z;  1N2F A;  2QA4 Z;  1NJI 1;  3CCV 1;  1L1O C;  2JUB A;  1I3Q I;  2W03 A;  3GKQ A;  4X6A I;  3CCU 1;  1KRL A;  5FLM I;  3CMA 1;  2JR6 A;  1K8A 1;  1RQF A;  2E9H A;  3OW2 Z;  3CCS 1;  3GTL I;  3CXC Y;  1VQ9 1;  3CCV Z;  4NBG A;  1KQS Z;  3CPW Z;  2B63 I;  1VQ5 1;  2JS4 A;  3H3V J;  3HOZ I;  2QEX 1;  2GU2 A;  1RO4 A;  3TDH B;  3GTM I;  3D6W A;  3GTM S;  4BBS I;  3CCS Z;  2YU9 I;  2WAQ A;  1VQ6 1;  2VUG A;  3GTJ I;  1VQO 1;  4QTT A;  2NVQ I;  1Z03 A;  1VQ8 1;  3K7A I;  1Q86 1;  2RHB A;  3IX0 A;  3J7A 4;  4RS4 A;  2Y0S A;  1YIJ Z;  3G6E Z;  3G4S 1;  1YJW Z;  3F3P C;  3VMH A;  1VQM Z;  1RLY A;  4A93 I;  3CD6 1;  3HOV I;  2RT9 A;  3J81 b;  1P9N A;  1USP A;  3NFZ A;  1RO2 A;  5T64 A;  3G71 Z;  3CME 1;  1VQL Z;  2DE5 A;  2O4H A;  3S1N I;  3HOY I;  3GTK I;  3M3Y I;  4A3B I;  1LQL A;  4A3E I;  1VQK Z;  1N8R 1;  4CL1 A;  1VQ7 1;  4DQY B;  1JWH C;  3ESW A;  3I56 Z;  1I50 I;  2LFU A;  2PM9 A;  1YUK A;  1USP B;  5CM2 M;  3CC4 Z;  1NJI 2;  3FQQ A;  3J80 f;  4HH4 A;  2F4O A;  1KQS Y;  2PK7 A;  2QKD A;  4MRI A;  3GCF A;  2H85 A;  3PO3 I;  3OW2 Y;  3CC4 1;  2R6M A;  2IZ3 A;  3HOW I;  2R93 I;  3S2H I;  3LUS A;  1VQM 1;  2P3Y A;  3MON A;  1Z02 A;  5FLX b;  2DE6 A;  3GTQ I;  3S2D I;  1YJ9 Z;  3I4N I;  1VQP Z;  2V8J A;  2E2I I;  1M90 1;  3CCL Z;  2F4M A;  1I6H I;  1S7M A;  2GTI A;  2LIY A;  4E2W A;  3HOU I;  1VQ4 1;  3NH5 A;  4BY7 I;  4NBE A;  2JA6 I;  4S1T A;  1X0T A;  4NOZ A;  5A2Q b;  4E2Y A;  3J81 f;  5T67 A;  2V8I A;  3NDJ A;  2HF1 A;  2QEX Z;  3CQZ I;  3KIF A;  2NVY I;  1K9M 2;  2VF1 A;  1VQK 1;  3H0G I;  1ZB8 A;  3I56 1;  2PMZ A;  3EED A;  2M6N A;  1VQ8 Z;  2ZAE B;  1WII A;  4NH1 C;  2JA8 I;  2Q51 A;  1YJN 1;  3CPW Y;  4NB8 A;  1Y1V S;  3RZD I;  2JMO A;  3S15 I;  3TE5 B;  3G71 1;  4NBA A;  4NB9 A;  3D9X A;  2IZ4 A;  1YJN Z;  2GTH A;  3PO3 S;  2YAD A;  4RV9 A;  2I3C A;  1RNI A;  3KIH A;  1TWF I;  2JA7 I;  5C44 I;  2K5R A;  1X3Z A;  2BJO A;  4BY1 I;  3I55 Z;  2KI7 B;  1Y1V I;  2DE7 A;  3MZK B;  1TWH I;  3CMA Z;  1WCM I;  1K8A 2;  1VQ6 Z;  1KC8 1;  1M1K 1;  4DK1 A;  2HU9 A;  2NVX I;  1PFT A;  3QWU A;  1Z01 A;  3CCJ Z;  2WB1 A;  3BG1 B;  4MD7 A;  5T6B A;  3S1M I;  1YIT Z;  3VMI A;  1Q82 1;  4NBC A;  1YI2 Z;  3T4N B;  3S1R I;  3CCM 1;  3CCE Z;  2OTJ 1;  4Y52 I;  4MD9 A;  2OTL Z;  3JAM f;  2RPR A;  4QTU A;  1VQN Z;  1QF8 A;  1W2B Z;  1WW9 A;  5LL6 f;  2R92 I;  2RBL A;  4NBF A;  1QVF Z;  3CD6 Z;  1TWG I;  3CCE 1;  3S16 I;  2OTJ Z;  3I07 A;  1K83 I;  1ML8 A;  4E31 A;  3G4S Z;  1YJW 1;  4E2X A;  1Y1W I;  2J6A A;  3BG0 B;  3MZL B;  4A3L I;  3Q87 A;  2OOX B;  4A3G I;  2E2H I;  4BXX I;  4NBD A;  4A3K I;  1K73 2;  2R7Z I;  4NFR A;  1NP6 A;  1VQL 1;  1R9T I;  4XX2 A;  3CME Z;  1S72 1;  2P28 A;  2O53 A;  1YHQ Z;  5IP9 I;  2OTL 1;  5FLX f;  1YJ9 1;  3CXC Z;  3I55 1;  3J80 b;  3G6E 1;  3CC7 Z;  3CCM Z;  1Q7Y 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...