1K9M2

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1k9m200
3CCLZ 3CCR1 3OW2Z 1YITZ 1JJ2Z 1YHQ1 1VQ6Z 1K9M2 3G71Z 1KC81 3CD6Z 1Q7Y1 1YJ91 3G711 1VQ8Z 3G6EZ 3CCMZ 2QEX1 1YI21 1M902 2QA41 3G6E1 3CC71 1VQPZ 1K8A1 1VQMZ 1W2BZ 3CCU1 3CCJ1 1JJ2Y 2OTL1 1VQP1 1M1K2 1QVFZ 1VQNZ 1YJNZ 1VQO1 1NJI2 1VQ41 1VQN1 1VQLZ 3CCEZ 3CCL1 1K732 1YIJZ 1YIT1 3CMAZ 2OTJZ 1Q821 1VQ61 3CCE1 3CMEZ 3CD61 1QVGY 1QVFY 3CME1 1VQ81 3CCM1 3CCQZ 3OW2Y 3G4SZ 1Q862 1K9M1 1KQSZ 1N8R2 1VQM1 3CCVZ 1VQ7Z 1VQ9Z 3CC4Z 3G4S1 1YJWZ 3I55Z 3CXCZ 3CPWZ 1M901 1YJN1 3CCSZ 3I56Z 1VQKZ 3CCS1 1VQL1 1W2BY 1KC82 1M1K1 1YIJ1 3CMA1 2OTJ1 1KQSY 1VQ5Z 1Q7Y2 1NJI1 3CCRZ 1KD12 3CC2Z 1Q812 1YHQZ 1K8A2 3CCQ1 1K731 3CC21 1YJ9Z 3CCV1 1VQ71 3CC41 2QEXZ 1VQ91 1YI2Z 1YJW1 3I551 2QA4Z 1S72Z 3CC7Z 1KD11 1Q811 3CCUZ 3CCJZ 3I561 1S721 1Q861 2OTLZ 1VQK1 1N8R1 1Q822 1VQOZ 1QVGZ 1VQ51 1VQ4Z 3CXCY 3CPWY
chains in the Genus database with same CATH superfamily
3U50C 3OW2Z 1ZB9A 1USPA 2PM9A 1WJ2A 1KC81 2VPWA 3RZOI 3T4NB 1Q7Y1 4EWCA 2Q4ZA 3G711 2YADA 1VQ8Z 2IZ3A 4NBFA 3HOYI 3S1MI 4DGLA 1Y1WI 1AA6A 1TWAI 3ESWA 4NH1C 2QA41 1VQPZ 1K8A1 2PMZA 2NVQI 2GTIA 4DK1A 5C4JI 3HKZA 2KI7B 3S2DI 2QLVB 2P28A 1VQNZ 5IT9f 5IP9I 2F4OA 2NAPA 1VQ41 1RQFA 3CCEZ 3IR7A 1KRLA 1VQ61 3PO3I 2JA5I 4RS4A 4XX2A 1K9M1 2RIQA 2OOXB 3PO3S 3CC4Z 1Y1VI 4MH4A 1SFOI 5FLXb 2QKDA 1M901 3J80b 1VQKZ 3J81b 3CCS1 1VQL1 1W2BY 1Y1VS 1M1K1 1YIJ1 3IX0A 3CMA1 3GTKI 4HGZA 1YUKA 5AN9F 5FLXf 3CCRZ 4A3LI 1Q812 3F3PC 2JA6I 3J81f 3D2LA 1Z01A 2LEXA 4BBSI 3CCV1 1VQ91 1YI2Z 1QXFA 3KIHA 5C4XI 1YJW1 4A3MI 3CC7Z 1N2FA 4NBBA 1Q811 2JIQA 2J6AA 3VMGA 3I561 2VUMI 1S721 1Q861 2KPIA 5C44I 1Q822 3GTGI 4NBHA 1P9NA 4MD9A 2JIRA 2K5RA 4NBAA 5FLMI 3CXCY 1FDIA 1YITZ 1JJ2Z 4HH4A 3I07A 3NH5A 1YHQ1 4A3DI 1L1OC 3CD6Z 4NFRA 3GTJI 1YJ91 2VF1A 4Y52I 3G6EZ 3CCMZ 2QEX1 4A3FI 2R92I 1VQMZ 4E2YA 4E2WA 3CCJ1 1FDOA 1VQP1 3GTMS 3MZKB 3H0GI 1YJNZ 1K83I 1Z03A 2DE5A 2R6MA 5LL6f 2DE6A 1VQN1 2E9HA 3CQZI 3CCL1 3HOVI 4NOZA 2OTJZ 3CCE1 3CMEZ 1RNIA 5D1OB 5T67A 2I3CA 1I3QI 2LIYA 2V8IA 2VUGA 2V45A 2O53A 1VQ7Z 4QTTA 3I55Z 3CPWZ 3S1NI 4NBDA 2PK7A 3D9XA 1QYPA 1X3ZA 1TFIA 2G2KA 2RHBA 2NVTI 5A2Qb 4X6AI 4Y7NI 1WZNA 2HF1A 2V8JA 4NB9A 3CC2Z 5T64A 4E2ZA 2IZ4A 4MRIA 3CCQ1 2E2HI 4BY1I 2JA8I 2RT9A 4A3II 2QA4Z 3BG0B 4E32A 2JIMA 2BJOA 1RLYA 2P3YA 4A3KI 1VQ51 2ZAEB 2VPYA 1VQ4Z 3FQQA 4MD8A 2GTHA 3J80f 5CM2M 3BG1B 1VQ6Z 3IFUA 2YU9I 3F3FC 3S16I 1USPB 1TWCI 4E31A 3Q87A 1RO2A 3G6E1 1W2BZ 3S17I 3CCU1 3HOXI 1JJ2Y 2OTL1 2M6NA 1QVFZ 1ZH1A 2JS4A 3JAMb 4MXUA 1JWHC 1VQO1 1NJI2 3HOWI 2NVXI 4RV9A 2DE7A 3KIFA 3IF8A 1VQLZ 2V8KA 3S15I 3GTQI 1K732 1YIJZ 3CMAZ 2F4MA 1Q821 3S1RI 3I4MI 1RO4A 3NFZA 3NH8A 1QVGY 3CME1 4RVDA 1VQ81 3TE5B 3OW2Y 3FQMA 3G4SZ 1KQSZ 2NVYI 1N8R2 3P5JB 4BBRI 3CCVZ 1VQ9Z 2OZKA 1YJWZ 3CXCZ 2R93I 2Q51A 3QWUA 2AYDA 3I56Z 3LUSA 2AKLA 4HGYA 5T6BA 1S7MA 3S1QI 2QR1B 2JIOA 1KC82 4QTUA 3TDHB 3J7A4 1WCMI 1Q7Y2 3NDJA 1X0TA 1YHQZ 1K8A2 1NUIA 3CC21 2M48A 2W03A 1YJ9Z 3H3VJ 1RO0A 3VB9A 4E2XA 3CC41 2QEXZ 1PFTA 1R9TI 4BXXI 5IT9b 2H85A 3GTLI 3GKQA 2WAQA 4A3EI 2QRDB 3CCJZ 2E2II 2JMOA 1VQK1 2OOYB 2RBLA 1Q16A 1YUAA 1SIWA 2E2JI 4TNUA 3NH4A 3CCLZ 3CCR1 3GTOI 1WIIA 5C3EI 2HU9A 2JA7I 2O4HA 3D6WA 1K9M2 1I50I 3G71Z 5A2Qf 1Y8CA 1TWFI 1VLAA 3K7AI 4RVFA 3VMIA 1YI21 4NB8A 1M902 2Y0SA 3CC71 3MONA 3S14I 2VPZA 3HOZI 1I6HI 3FKII 4A93I 2RPRA 1M1K2 4CL1A 2WB1A 2QREB 4RVGA 3EERA 4MONA 4RVHA 1TWHI 1YIT1 1WW9A 3M3YI 4NBGA 3CD61 5D1OA 4NBEA 4E33A 4A3JI 1QVFY 3PO2I 3CCM1 3CCQZ 1TWGI 3S2HI 4A3CI 1Q862 2K3RA 2JIPA 1VQM1 2W04A 3G4S1 4MD7A 1Z02A 2GU2A 1YJN1 3CCSZ 1ZB8A 3GCFA 3NDIA 1LQLA 3GTPI 4A3BI 1NP6A 2LFUA 3HOUI 5D1PA 3JAMf 2OTJ1 1KQSY 1VQ5Z 3I4NI 1X3WA 4BY7I 1NJI1 2V3VA 1KD12 4A3GI 1ML8A 4AYBA 4DQYB 4S1TA 1K731 3M4OI 2QRCB 2EGTA 1QF8A 2JUBA 1VQ71 3GTMI 2JNYA 3I551 1DL6A 2B63I 1S72Z 2E7ZA 3MZLB 3VTNA 1KD11 3CCUZ 3RZDI 2IV2X 2OTLZ 4NBCA 3VMHA 2VPXA 1N8R1 4E30A 5IP7I 1VQOZ 1QVGZ 3EEDA 2JR6A 2R7ZI 3CPWY
chains in the Genus database with same CATH topology
3U50C 3OW2Z 1ZB9A 1USPA 2PM9A 1KC81 3RZOI 3T4NB 1Q7Y1 4EWCA 2Q4ZA 3G711 2YADA 1VQ8Z 2IZ3A 4NBFA 3HOYI 3S1MI 4DGLA 1Y1WI 1TWAI 3ESWA 4NH1C 2QA41 1VQPZ 1K8A1 2PMZA 2NVQI 2GTIA 4DK1A 5C4JI 3HKZA 2KI7B 3S2DI 2QLVB 2P28A 1VQNZ 5IT9f 5IP9I 2F4OA 1VQ41 1RQFA 3CCEZ 1KRLA 1VQ61 3PO3I 2JA5I 4RS4A 4XX2A 1K9M1 2RIQA 2OOXB 3PO3S 3CC4Z 1Y1VI 4MH4A 1SFOI 5FLXb 2QKDA 1M901 3J80b 1VQKZ 3J81b 3CCS1 1VQL1 1W2BY 1Y1VS 1M1K1 1YIJ1 3IX0A 3CMA1 3GTKI 4HGZA 1YUKA 5AN9F 5FLXf 3CCRZ 4A3LI 1Q812 3F3PC 2JA6I 3J81f 1Z01A 4BBSI 3CCV1 1VQ91 1YI2Z 3KIHA 5C4XI 1YJW1 4A3MI 3CC7Z 1N2FA 4NBBA 1Q811 3VMGA 2J6AA 3I561 2VUMI 1S721 1Q861 2KPIA 5C44I 1Q822 3GTGI 4NBHA 1P9NA 4MD9A 2K5RA 4NBAA 5FLMI 3CXCY 1YITZ 1JJ2Z 4HH4A 3I07A 3NH5A 1YHQ1 4A3DI 1L1OC 3CD6Z 4NFRA 3GTJI 1YJ91 2VF1A 4Y52I 3G6EZ 3CCMZ 2QEX1 4A3FI 2R92I 1VQMZ 4E2YA 4E2WA 3CCJ1 1VQP1 3GTMS 3MZKB 3H0GI 1YJNZ 1K83I 1Z03A 2DE5A 2R6MA 5LL6f 2DE6A 1VQN1 2E9HA 3CQZI 3CCL1 3HOVI 4NOZA 2OTJZ 3CCE1 3CMEZ 1RNIA 5D1OB 5T67A 2I3CA 1I3QI 2LIYA 2V8IA 2VUGA 2O53A 1VQ7Z 4QTTA 3I55Z 3CPWZ 3S1NI 4NBDA 2PK7A 3D9XA 1QYPA 1X3ZA 1TFIA 2G2KA 2RHBA 2NVTI 5A2Qb 4X6AI 4Y7NI 2HF1A 2V8JA 4NB9A 3CC2Z 5T64A 4E2ZA 2IZ4A 4MRIA 3CCQ1 2E2HI 4BY1I 2JA8I 2RT9A 4A3II 2QA4Z 3BG0B 4E32A 2BJOA 1RLYA 2P3YA 4A3KI 1VQ51 2ZAEB 1VQ4Z 3FQQA 4MD8A 2GTHA 3J80f 5CM2M 3BG1B 1VQ6Z 3IFUA 2YU9I 3F3FC 3S16I 1USPB 1TWCI 4E31A 3Q87A 1RO2A 3G6E1 1W2BZ 3S17I 3CCU1 3HOXI 1JJ2Y 2OTL1 2M6NA 1QVFZ 1ZH1A 2JS4A 3JAMb 4MXUA 1JWHC 1VQO1 1NJI2 3HOWI 2NVXI 4RV9A 2DE7A 3KIFA 3IF8A 1VQLZ 2V8KA 3S15I 3GTQI 1K732 1YIJZ 3CMAZ 2F4MA 1Q821 3S1RI 3I4MI 1RO4A 3NFZA 3NH8A 1QVGY 3CME1 4RVDA 1VQ81 3TE5B 3OW2Y 3FQMA 3G4SZ 1KQSZ 2NVYI 1N8R2 3P5JB 4BBRI 3CCVZ 1VQ9Z 2OZKA 1YJWZ 3CXCZ 2R93I 2Q51A 3QWUA 3I56Z 3LUSA 2AKLA 4HGYA 5T6BA 1S7MA 3S1QI 2QR1B 1KC82 4QTUA 3TDHB 3J7A4 1WCMI 1Q7Y2 3NDJA 1X0TA 1YHQZ 1K8A2 1NUIA 3CC21 2M48A 2W03A 1YJ9Z 3H3VJ 1RO0A 3VB9A 4E2XA 3CC41 2QEXZ 1PFTA 1R9TI 4BXXI 5IT9b 2H85A 3GTLI 3GKQA 2WAQA 4A3EI 2QRDB 3CCJZ 2E2II 2JMOA 1VQK1 2OOYB 2RBLA 1YUAA 2E2JI 4TNUA 3NH4A 3CCLZ 3CCR1 3GTOI 1WIIA 5C3EI 2HU9A 2JA7I 2O4HA 3D6WA 1K9M2 1I50I 3G71Z 5A2Qf 1TWFI 1VLAA 3K7AI 4RVFA 3VMIA 1YI21 4NB8A 1M902 2Y0SA 3CC71 3MONA 3S14I 3HOZI 1I6HI 3FKII 4A93I 2RPRA 1M1K2 4CL1A 2WB1A 2QREB 4RVGA 3EERA 4MONA 4RVHA 1TWHI 1YIT1 1WW9A 3M3YI 4NBGA 3CD61 5D1OA 4NBEA 4E33A 4A3JI 1QVFY 3PO2I 3CCM1 3CCQZ 1TWGI 3S2HI 4A3CI 1Q862 2K3RA 1VQM1 2W04A 3G4S1 4MD7A 1Z02A 2GU2A 1YJN1 3CCSZ 1ZB8A 3GCFA 3NDIA 1LQLA 3GTPI 4A3BI 1NP6A 2LFUA 3HOUI 5D1PA 3JAMf 2OTJ1 1KQSY 1VQ5Z 3I4NI 1X3WA 4BY7I 1NJI1 1KD12 4A3GI 1ML8A 4AYBA 4DQYB 4S1TA 1K731 3M4OI 2QRCB 2EGTA 1QF8A 2JUBA 1VQ71 3GTMI 2JNYA 3I551 1DL6A 2B63I 1S72Z 3MZLB 3VTNA 1KD11 3CCUZ 3RZDI 2OTLZ 4NBCA 3VMHA 1N8R1 4E30A 5IP7I 1VQOZ 1QVGZ 3EEDA 2JR6A 2R7ZI 3CPWY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL Z;  3CCR 1;  3OW2 Z;  1YIT Z;  1JJ2 Z;  1YHQ 1;  1VQ6 Z;  1K9M 2;  3G71 Z;  1KC8 1;  3CD6 Z;  1Q7Y 1;  1YJ9 1;  3G71 1;  1VQ8 Z;  3G6E Z;  3CCM Z;  2QEX 1;  1YI2 1;  1M90 2;  2QA4 1;  3G6E 1;  3CC7 1;  1VQP Z;  1K8A 1;  1VQM Z;  1W2B Z;  3CCU 1;  3CCJ 1;  1JJ2 Y;  2OTL 1;  1VQP 1;  1M1K 2;  1QVF Z;  1VQN Z;  1YJN Z;  1VQO 1;  1NJI 2;  1VQ4 1;  1VQN 1;  1VQL Z;  3CCE Z;  3CCL 1;  1K73 2;  1YIJ Z;  1YIT 1;  3CMA Z;  2OTJ Z;  1Q82 1;  1VQ6 1;  3CCE 1;  3CME Z;  3CD6 1;  1QVG Y;  1QVF Y;  3CME 1;  1VQ8 1;  3CCM 1;  3CCQ Z;  3OW2 Y;  3G4S Z;  1Q86 2;  1K9M 1;  1KQS Z;  1N8R 2;  1VQM 1;  3CCV Z;  1VQ7 Z;  1VQ9 Z;  3CC4 Z;  3G4S 1;  1YJW Z;  3I55 Z;  3CXC Z;  3CPW Z;  1M90 1;  1YJN 1;  3CCS Z;  3I56 Z;  1VQK Z;  3CCS 1;  1VQL 1;  1W2B Y;  1KC8 2;  1M1K 1;  1YIJ 1;  3CMA 1;  2OTJ 1;  1KQS Y;  1VQ5 Z;  1Q7Y 2;  1NJI 1;  3CCR Z;  1KD1 2;  3CC2 Z;  1Q81 2;  1YHQ Z;  1K8A 2;  3CCQ 1;  1K73 1;  3CC2 1;  1YJ9 Z;  3CCV 1;  1VQ7 1;  3CC4 1;  2QEX Z;  1VQ9 1;  1YI2 Z;  1YJW 1;  3I55 1;  2QA4 Z;  1S72 Z;  3CC7 Z;  1KD1 1;  1Q81 1;  3CCU Z;  3CCJ Z;  3I56 1;  1S72 1;  1Q86 1;  2OTL Z;  1VQK 1;  1N8R 1;  1Q82 2;  1VQO Z;  1QVG Z;  1VQ5 1;  1VQ4 Z;  3CXC Y;  3CPW Y; 
#chains in the Genus database with same CATH topology
 3U50 C;  3OW2 Z;  1ZB9 A;  1USP A;  2PM9 A;  1WJ2 A;  1KC8 1;  2VPW A;  3RZO I;  3T4N B;  1Q7Y 1;  4EWC A;  2Q4Z A;  3G71 1;  2YAD A;  1VQ8 Z;  2IZ3 A;  4NBF A;  3HOY I;  3S1M I;  4DGL A;  1Y1W I;  1AA6 A;  1TWA I;  3ESW A;  4NH1 C;  2QA4 1;  1VQP Z;  1K8A 1;  2PMZ A;  2NVQ I;  2GTI A;  4DK1 A;  5C4J I;  3HKZ A;  2KI7 B;  3S2D I;  2QLV B;  2P28 A;  1VQN Z;  5IT9 f;  5IP9 I;  2F4O A;  2NAP A;  1VQ4 1;  1RQF A;  3CCE Z;  3IR7 A;  1KRL A;  1VQ6 1;  3PO3 I;  2JA5 I;  4RS4 A;  4XX2 A;  1K9M 1;  2RIQ A;  2OOX B;  3PO3 S;  3CC4 Z;  1Y1V I;  4MH4 A;  1SFO I;  5FLX b;  2QKD A;  1M90 1;  3J80 b;  1VQK Z;  3J81 b;  3CCS 1;  1VQL 1;  1W2B Y;  1Y1V S;  1M1K 1;  1YIJ 1;  3IX0 A;  3CMA 1;  3GTK I;  4HGZ A;  1YUK A;  5AN9 F;  5FLX f;  3CCR Z;  4A3L I;  1Q81 2;  3F3P C;  2JA6 I;  3J81 f;  3D2L A;  1Z01 A;  2LEX A;  4BBS I;  3CCV 1;  1VQ9 1;  1YI2 Z;  1QXF A;  3KIH A;  5C4X I;  1YJW 1;  4A3M I;  3CC7 Z;  1N2F A;  4NBB A;  1Q81 1;  2JIQ A;  2J6A A;  3VMG A;  3I56 1;  2VUM I;  1S72 1;  1Q86 1;  2KPI A;  5C44 I;  1Q82 2;  3GTG I;  4NBH A;  1P9N A;  4MD9 A;  2JIR A;  2K5R A;  4NBA A;  5FLM I;  3CXC Y;  1FDI A;  1YIT Z;  1JJ2 Z;  4HH4 A;  3I07 A;  3NH5 A;  1YHQ 1;  4A3D I;  1L1O C;  3CD6 Z;  4NFR A;  3GTJ I;  1YJ9 1;  2VF1 A;  4Y52 I;  3G6E Z;  3CCM Z;  2QEX 1;  4A3F I;  2R92 I;  1VQM Z;  4E2Y A;  4E2W A;  3CCJ 1;  1FDO A;  1VQP 1;  3GTM S;  3MZK B;  3H0G I;  1YJN Z;  1K83 I;  1Z03 A;  2DE5 A;  2R6M A;  5LL6 f;  2DE6 A;  1VQN 1;  2E9H A;  3CQZ I;  3CCL 1;  3HOV I;  4NOZ A;  2OTJ Z;  3CCE 1;  3CME Z;  1RNI A;  5D1O B;  5T67 A;  2I3C A;  1I3Q I;  2LIY A;  2V8I A;  2VUG A;  2V45 A;  2O53 A;  1VQ7 Z;  4QTT A;  3I55 Z;  3CPW Z;  3S1N I;  4NBD A;  2PK7 A;  3D9X A;  1QYP A;  1X3Z A;  1TFI A;  2G2K A;  2RHB A;  2NVT I;  5A2Q b;  4X6A I;  4Y7N I;  1WZN A;  2HF1 A;  2V8J A;  4NB9 A;  3CC2 Z;  5T64 A;  4E2Z A;  2IZ4 A;  4MRI A;  3CCQ 1;  2E2H I;  4BY1 I;  2JA8 I;  2RT9 A;  4A3I I;  2QA4 Z;  3BG0 B;  4E32 A;  2JIM A;  2BJO A;  1RLY A;  2P3Y A;  4A3K I;  1VQ5 1;  2ZAE B;  2VPY A;  1VQ4 Z;  3FQQ A;  4MD8 A;  2GTH A;  3J80 f;  5CM2 M;  3BG1 B;  1VQ6 Z;  3IFU A;  2YU9 I;  3F3F C;  3S16 I;  1USP B;  1TWC I;  4E31 A;  3Q87 A;  1RO2 A;  3G6E 1;  1W2B Z;  3S17 I;  3CCU 1;  3HOX I;  1JJ2 Y;  2OTL 1;  2M6N A;  1QVF Z;  1ZH1 A;  2JS4 A;  3JAM b;  4MXU A;  1JWH C;  1VQO 1;  1NJI 2;  3HOW I;  2NVX I;  4RV9 A;  2DE7 A;  3KIF A;  3IF8 A;  1VQL Z;  2V8K A;  3S15 I;  3GTQ I;  1K73 2;  1YIJ Z;  3CMA Z;  2F4M A;  1Q82 1;  3S1R I;  3I4M I;  1RO4 A;  3NFZ A;  3NH8 A;  1QVG Y;  3CME 1;  4RVD A;  1VQ8 1;  3TE5 B;  3OW2 Y;  3FQM A;  3G4S Z;  1KQS Z;  2NVY I;  1N8R 2;  3P5J B;  4BBR I;  3CCV Z;  1VQ9 Z;  2OZK A;  1YJW Z;  3CXC Z;  2R93 I;  2Q51 A;  3QWU A;  2AYD A;  3I56 Z;  3LUS A;  2AKL A;  4HGY A;  5T6B A;  1S7M A;  3S1Q I;  2QR1 B;  2JIO A;  1KC8 2;  4QTU A;  3TDH B;  3J7A 4;  1WCM I;  1Q7Y 2;  3NDJ A;  1X0T A;  1YHQ Z;  1K8A 2;  1NUI A;  3CC2 1;  2M48 A;  2W03 A;  1YJ9 Z;  3H3V J;  1RO0 A;  3VB9 A;  4E2X A;  3CC4 1;  2QEX Z;  1PFT A;  1R9T I;  4BXX I;  5IT9 b;  2H85 A;  3GTL I;  3GKQ A;  2WAQ A;  4A3E I;  2QRD B;  3CCJ Z;  2E2I I;  2JMO A;  1VQK 1;  2OOY B;  2RBL A;  1Q16 A;  1YUA A;  1SIW A;  2E2J I;  4TNU A;  3NH4 A;  3CCL Z;  3CCR 1;  3GTO I;  1WII A;  5C3E I;  2HU9 A;  2JA7 I;  2O4H A;  3D6W A;  1K9M 2;  1I50 I;  3G71 Z;  5A2Q f;  1Y8C A;  1TWF I;  1VLA A;  3K7A I;  4RVF A;  3VMI A;  1YI2 1;  4NB8 A;  1M90 2;  2Y0S A;  3CC7 1;  3MON A;  3S14 I;  2VPZ A;  3HOZ I;  1I6H I;  3FKI I;  4A93 I;  2RPR A;  1M1K 2;  4CL1 A;  2WB1 A;  2QRE B;  4RVG A;  3EER A;  4MON A;  4RVH A;  1TWH I;  1YIT 1;  1WW9 A;  3M3Y I;  4NBG A;  3CD6 1;  5D1O A;  4NBE A;  4E33 A;  4A3J I;  1QVF Y;  3PO2 I;  3CCM 1;  3CCQ Z;  1TWG I;  3S2H I;  4A3C I;  1Q86 2;  2K3R A;  2JIP A;  1VQM 1;  2W04 A;  3G4S 1;  4MD7 A;  1Z02 A;  2GU2 A;  1YJN 1;  3CCS Z;  1ZB8 A;  3GCF A;  3NDI A;  1LQL A;  3GTP I;  4A3B I;  1NP6 A;  2LFU A;  3HOU I;  5D1P A;  3JAM f;  2OTJ 1;  1KQS Y;  1VQ5 Z;  3I4N I;  1X3W A;  4BY7 I;  1NJI 1;  2V3V A;  1KD1 2;  4A3G I;  1ML8 A;  4AYB A;  4DQY B;  4S1T A;  1K73 1;  3M4O I;  2QRC B;  2EGT A;  1QF8 A;  2JUB A;  1VQ7 1;  3GTM I;  2JNY A;  3I55 1;  1DL6 A;  2B63 I;  1S72 Z;  2E7Z A;  3MZL B;  3VTN A;  1KD1 1;  3CCU Z;  3RZD I;  2IV2 X;  2OTL Z;  4NBC A;  3VMH A;  2VPX A;  1N8R 1;  4E30 A;  5IP7 I;  1VQO Z;  1QVG Z;  3EED A;  2JR6 A;  2R7Z I;  3CPW Y; 
#chains in the Genus database with same CATH homology
 3U50 C;  3OW2 Z;  1ZB9 A;  1USP A;  2PM9 A;  1KC8 1;  3RZO I;  3T4N B;  1Q7Y 1;  4EWC A;  2Q4Z A;  3G71 1;  2YAD A;  1VQ8 Z;  2IZ3 A;  4NBF A;  3HOY I;  3S1M I;  4DGL A;  1Y1W I;  1TWA I;  3ESW A;  4NH1 C;  2QA4 1;  1VQP Z;  1K8A 1;  2PMZ A;  2NVQ I;  2GTI A;  4DK1 A;  5C4J I;  3HKZ A;  2KI7 B;  3S2D I;  2QLV B;  2P28 A;  1VQN Z;  5IT9 f;  5IP9 I;  2F4O A;  1VQ4 1;  1RQF A;  3CCE Z;  1KRL A;  1VQ6 1;  3PO3 I;  2JA5 I;  4RS4 A;  4XX2 A;  1K9M 1;  2RIQ A;  2OOX B;  3PO3 S;  3CC4 Z;  1Y1V I;  4MH4 A;  1SFO I;  5FLX b;  2QKD A;  1M90 1;  3J80 b;  1VQK Z;  3J81 b;  3CCS 1;  1VQL 1;  1W2B Y;  1Y1V S;  1M1K 1;  1YIJ 1;  3IX0 A;  3CMA 1;  3GTK I;  4HGZ A;  1YUK A;  5AN9 F;  5FLX f;  3CCR Z;  4A3L I;  1Q81 2;  3F3P C;  2JA6 I;  3J81 f;  1Z01 A;  4BBS I;  3CCV 1;  1VQ9 1;  1YI2 Z;  3KIH A;  5C4X I;  1YJW 1;  4A3M I;  3CC7 Z;  1N2F A;  4NBB A;  1Q81 1;  3VMG A;  2J6A A;  3I56 1;  2VUM I;  1S72 1;  1Q86 1;  2KPI A;  5C44 I;  1Q82 2;  3GTG I;  4NBH A;  1P9N A;  4MD9 A;  2K5R A;  4NBA A;  5FLM I;  3CXC Y;  1YIT Z;  1JJ2 Z;  4HH4 A;  3I07 A;  3NH5 A;  1YHQ 1;  4A3D I;  1L1O C;  3CD6 Z;  4NFR A;  3GTJ I;  1YJ9 1;  2VF1 A;  4Y52 I;  3G6E Z;  3CCM Z;  2QEX 1;  4A3F I;  2R92 I;  1VQM Z;  4E2Y A;  4E2W A;  3CCJ 1;  1VQP 1;  3GTM S;  3MZK B;  3H0G I;  1YJN Z;  1K83 I;  1Z03 A;  2DE5 A;  2R6M A;  5LL6 f;  2DE6 A;  1VQN 1;  2E9H A;  3CQZ I;  3CCL 1;  3HOV I;  4NOZ A;  2OTJ Z;  3CCE 1;  3CME Z;  1RNI A;  5D1O B;  5T67 A;  2I3C A;  1I3Q I;  2LIY A;  2V8I A;  2VUG A;  2O53 A;  1VQ7 Z;  4QTT A;  3I55 Z;  3CPW Z;  3S1N I;  4NBD A;  2PK7 A;  3D9X A;  1QYP A;  1X3Z A;  1TFI A;  2G2K A;  2RHB A;  2NVT I;  5A2Q b;  4X6A I;  4Y7N I;  2HF1 A;  2V8J A;  4NB9 A;  3CC2 Z;  5T64 A;  4E2Z A;  2IZ4 A;  4MRI A;  3CCQ 1;  2E2H I;  4BY1 I;  2JA8 I;  2RT9 A;  4A3I I;  2QA4 Z;  3BG0 B;  4E32 A;  2BJO A;  1RLY A;  2P3Y A;  4A3K I;  1VQ5 1;  2ZAE B;  1VQ4 Z;  3FQQ A;  4MD8 A;  2GTH A;  3J80 f;  5CM2 M;  3BG1 B;  1VQ6 Z;  3IFU A;  2YU9 I;  3F3F C;  3S16 I;  1USP B;  1TWC I;  4E31 A;  3Q87 A;  1RO2 A;  3G6E 1;  1W2B Z;  3S17 I;  3CCU 1;  3HOX I;  1JJ2 Y;  2OTL 1;  2M6N A;  1QVF Z;  1ZH1 A;  2JS4 A;  3JAM b;  4MXU A;  1JWH C;  1VQO 1;  1NJI 2;  3HOW I;  2NVX I;  4RV9 A;  2DE7 A;  3KIF A;  3IF8 A;  1VQL Z;  2V8K A;  3S15 I;  3GTQ I;  1K73 2;  1YIJ Z;  3CMA Z;  2F4M A;  1Q82 1;  3S1R I;  3I4M I;  1RO4 A;  3NFZ A;  3NH8 A;  1QVG Y;  3CME 1;  4RVD A;  1VQ8 1;  3TE5 B;  3OW2 Y;  3FQM A;  3G4S Z;  1KQS Z;  2NVY I;  1N8R 2;  3P5J B;  4BBR I;  3CCV Z;  1VQ9 Z;  2OZK A;  1YJW Z;  3CXC Z;  2R93 I;  2Q51 A;  3QWU A;  3I56 Z;  3LUS A;  2AKL A;  4HGY A;  5T6B A;  1S7M A;  3S1Q I;  2QR1 B;  1KC8 2;  4QTU A;  3TDH B;  3J7A 4;  1WCM I;  1Q7Y 2;  3NDJ A;  1X0T A;  1YHQ Z;  1K8A 2;  1NUI A;  3CC2 1;  2M48 A;  2W03 A;  1YJ9 Z;  3H3V J;  1RO0 A;  3VB9 A;  4E2X A;  3CC4 1;  2QEX Z;  1PFT A;  1R9T I;  4BXX I;  5IT9 b;  2H85 A;  3GTL I;  3GKQ A;  2WAQ A;  4A3E I;  2QRD B;  3CCJ Z;  2E2I I;  2JMO A;  1VQK 1;  2OOY B;  2RBL A;  1YUA A;  2E2J I;  4TNU A;  3NH4 A;  3CCL Z;  3CCR 1;  3GTO I;  1WII A;  5C3E I;  2HU9 A;  2JA7 I;  2O4H A;  3D6W A;  1K9M 2;  1I50 I;  3G71 Z;  5A2Q f;  1TWF I;  1VLA A;  3K7A I;  4RVF A;  3VMI A;  1YI2 1;  4NB8 A;  1M90 2;  2Y0S A;  3CC7 1;  3MON A;  3S14 I;  3HOZ I;  1I6H I;  3FKI I;  4A93 I;  2RPR A;  1M1K 2;  4CL1 A;  2WB1 A;  2QRE B;  4RVG A;  3EER A;  4MON A;  4RVH A;  1TWH I;  1YIT 1;  1WW9 A;  3M3Y I;  4NBG A;  3CD6 1;  5D1O A;  4NBE A;  4E33 A;  4A3J I;  1QVF Y;  3PO2 I;  3CCM 1;  3CCQ Z;  1TWG I;  3S2H I;  4A3C I;  1Q86 2;  2K3R A;  1VQM 1;  2W04 A;  3G4S 1;  4MD7 A;  1Z02 A;  2GU2 A;  1YJN 1;  3CCS Z;  1ZB8 A;  3GCF A;  3NDI A;  1LQL A;  3GTP I;  4A3B I;  1NP6 A;  2LFU A;  3HOU I;  5D1P A;  3JAM f;  2OTJ 1;  1KQS Y;  1VQ5 Z;  3I4N I;  1X3W A;  4BY7 I;  1NJI 1;  1KD1 2;  4A3G I;  1ML8 A;  4AYB A;  4DQY B;  4S1T A;  1K73 1;  3M4O I;  2QRC B;  2EGT A;  1QF8 A;  2JUB A;  1VQ7 1;  3GTM I;  2JNY A;  3I55 1;  1DL6 A;  2B63 I;  1S72 Z;  3MZL B;  3VTN A;  1KD1 1;  3CCU Z;  3RZD I;  2OTL Z;  4NBC A;  3VMH A;  1N8R 1;  4E30 A;  5IP7 I;  1VQO Z;  1QVG Z;  3EED A;  2JR6 A;  2R7Z I;  3CPW Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...