3CCRZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccrZ00
1YJ9Z 3I56Z 1VQ91 1S72Z 1VQ9Z 3CXCZ 3CCJZ 3CCL1 3CCR1 3CC21 3CCU1 1VQ6Z 3CCJ1 1M1K1 2QA4Z 1YHQZ 3CME1 1VQ61 3CCRZ 1VQ4Z 3CMA1 2QEXZ 3CCE1 1YJNZ 1M902 3CXCY 3CCEZ 1YJN1 1YJWZ 1YITZ 1KQSY 3CC2Z 1YIT1 1K8A2 1VQKZ 1S721 1K732 3OW2Z 3CMEZ 1Q7Y2 1YJW1 1Q812 1VQ41 1QVGY 1YI21 3CCQ1 1YI2Z 3G71Z 3CD61 3G6EZ 3I551 1K731 1Q821 1QVFZ 3CCVZ 3CCM1 1VQ5Z 1VQO1 1VQPZ 1YIJ1 3CCUZ 3CCLZ 1KD12 2OTJZ 1NJI1 1Q811 1VQNZ 1QVGZ 2QEX1 1N8R1 1VQM1 1JJ2Y 1VQ81 3G4SZ 3G4S1 1KC81 1Q862 3I561 3CC7Z 1W2BZ 1VQ71 1VQ7Z 3CC41 1VQ8Z 1VQL1 1NJI2 1VQLZ 3CC4Z 1K9M1 3CCS1 1M1K2 1KQSZ 3CC71 1KD11 1Q822 2QA41 1YHQ1 3I55Z 1Q861 1VQP1 3CCQZ 1W2BY 3CPWY 1QVFY 2OTL1 3CCSZ 2OTLZ 1K9M2 3CD6Z 1M901 1VQK1 3CPWZ 3G711 1VQMZ 1Q7Y1 3CCMZ 1N8R2 1VQ51 3CCV1 1VQOZ 3OW2Y 1JJ2Z 3G6E1 1KC82 1VQN1 2OTJ1 3CMAZ 1K8A1 1YJ91 1YIJZ
chains in the Genus database with same CATH superfamily
3I56Z 5IP7I 3CCU1 2HU9A 1VQ6Z 3I07A 1M1K1 1YHQZ 2VUGA 1I6HI 1VQ61 1VQ4Z 1WJ2A 3CCEZ 4E30A 4A3KI 2VF1A 3GTOI 1S721 3Q87A 3NH8A 3I4MI 3J80b 2W04A 3D2LA 1YJW1 2NVTI 1TWFI 4RVGA 2IV2X 1YI21 2KI7B 1QXFA 4A3FI 5IP9I 1K731 4MH4A 1Q821 1QVFZ 5T64A 3LUSA 3BG1B 1NUIA 4NFRA 3CCVZ 3CCM1 3GTLI 1VQ5Z 3MONA 1JWHC 3CCUZ 4Y7NI 3RZOI 2O53A 4NBEA 1QYPA 3F3PC 2IZ4A 3S14I 4RV9A 2RHBA 1KC81 1Q862 4A3BI 3PO3I 3D6WA 4CL1A 1W2BZ 2JIRA 3J80f 4NH1C 1NP6A 2AYDA 4A3JI 1Y1VI 2YU9I 3CC41 3GTKI 3D9XA 4A3CI 2V45A 1K9M1 4E31A 3K7AI 4NOZA 1Q822 3CCQZ 5A2Qb 3CPWY 3KIFA 2M48A 2ZAEB 2GTIA 1YUAA 3GTPI 3S16I 3CPWZ 1X3ZA 1RO2A 5D1OA 4A3EI 3CCMZ 2E2II 1TFIA 1YUKA 1RLYA 2DE6A 1X3WA 2E2JI 3OW2Y 3G6E1 2E7ZA 1VLAA 4MRIA 2OZKA 3FQMA 3IX0A 2NVQI 3S1QI 1Q16A 4NB9A 2V8IA 3J7A4 1DL6A 1VQ91 3HOWI 3CXCZ 3CCL1 3S1MI 1L1OC 3IR7A 5FLMI 3CCRZ 2R6MA 3CMA1 2R93I 1M902 2LEXA 3CXCY 1ZH1A 1YJN1 3HOXI 1YJWZ 1USPA 2Q51A 2R92I 3GTGI 1N2FA 1YIT1 2QRDB 4MXUA 4NBCA 1RO4A 3BG0B 3RZDI 3M3YI 1K732 3F3FC 1RNIA 5D1PA 3ESWA 4RVDA 1Z03A 1ZB8A 4A3DI 1P9NA 2RBLA 4EWCA 5A2Qf 2BJOA 1QF8A 2JA5I 4HH4A 2JA8I 3H3VJ 1YIJ1 4A93I 2NAPA 2OTJZ 1Y8CA 2QRCB 1Q811 2F4MA 1QVGZ 2QEX1 3HKZA 1I50I 2W03A 3FQQA 2JA7I 3G4SZ 3GCFA 2H85A 3G4S1 4NBHA 1ZB9A 2JNYA 4E2ZA 2GU2A 2HF1A 4DQYB 4E2XA 5IT9f 1FDIA 4BBRI 1VQ71 4BXXI 2G2KA 4AYBA 3GKQA 1RQFA 1PFTA 3CC4Z 2JIMA 3CCS1 1M1K2 2AKLA 2LIYA 2JIQA 1WZNA 3GTQI 3P5JB 1YHQ1 3NDIA 2IZ3A 3I55Z 2QLVB 3S15I 2OTL1 2R7ZI 3TDHB 2OTLZ 1K9M2 1VQK1 2V8KA 1VQMZ 1Q7Y1 2RT9A 2JMOA 3NH4A 3VB9A 2LFUA 4MONA 3HOYI 3NDJA 2JS4A 1VQN1 2O4HA 2B63I 5IT9b 2OOXB 4E33A 1YJ91 3NH5A 4BBSI 1YJ9Z 2YADA 1WW9A 3MZLB 1VQ9Z 3PO3S 2F4OA 4QTTA 3NFZA 2JA6I 2DE7A 2QA4Z 3CME1 2K3RA 2QEXZ 1YJNZ 1SFOI 1Y1VS 3CQZI 1KQSY 4BY1I 3CC2Z 3HOUI 1K8A2 1VQKZ 4XX2A 2DE5A 2JUBA 4NBBA 5C4XI 3CMEZ 1Z01A 1Q7Y2 1VQ41 1QVGY 4NB8A 3QWUA 3CCQ1 2QR1B 3G6EZ 3GTJI 2P28A 2VUMI 3VMIA 1VQO1 4RS4A 4MD8A 1KD12 2J6AA 2OOYB 4NBFA 4Y52I 1VQM1 4NBAA 5D1OB 3J81b 3I4NI 3FKII 2I3CA 3S1RI 3EERA 1R9TI 4S1TA 3TE5B 2E9HA 1FDOA 1VQ8Z 2PK7A 1WIIA 1VQLZ 4HGZA 3S1NI 2P3YA 5C4JI 3KIHA 3CC71 4A3II 3S2DI 1VQP1 1Q861 3H0GI 5T6BA 1S7MA 1QVFY 3CCSZ 2RIQA 2VPWA 3CD6Z 2M6NA 3VTNA 2NVXI 3G711 5C44I 4A3LI 4E32A 4A3MI 4HGYA 1VQ51 4QTUA 3CCV1 1K83I 3GTMS 3S17I 2K5RA 1KC82 5FLXf 2Q4ZA 3JAMf 1USPB 1TWGI 2PMZA 1LQLA 1S72Z 3CCJZ 3CCR1 3CC21 5AN9F 2JIPA 3CCJ1 3CCE1 4RVFA 1YITZ 4NBDA 3HOZI 3IF8A 3IFUA 2NVYI 3OW2Z 2QKDA 1Q812 4E2YA 2E2HI 1Y1WI 2JR6A 2V3VA 3T4NB 5FLXb 1YI2Z 3G71Z 4MD7A 1SIWA 2GTHA 4DK1A 3CD61 3JAMb 3I551 1Z02A 3M4OI 1VQPZ 4X6AI 3EEDA 4E2WA 3CCLZ 2VPZA 1NJI1 4MD9A 3MZKB 1VQNZ 3HOVI 1N8R1 1TWAI 1JJ2Y 1VQ81 3VMHA 2V8JA 2EGTA 3I561 1I3QI 4DGLA 4RVHA 3CC7Z 4NBGA 1WCMI 5CM2M 2VPXA 5T67A 2KPIA 1TWCI 1VQ7Z 1VQL1 1NJI2 2Y0SA 2PM9A 5C3EI 2QREB 1TWHI 1AA6A 2VPYA 1KQSZ 3GTMI 1KD11 2QA41 2JIOA 1W2BY 3S2HI 3U50C 3PO2I 1M901 4TNUA 1X0TA 2WAQA 1RO0A 4BY7I 1N8R2 2RPRA 4A3GI 5LL6f 1VQOZ 2WB1A 1JJ2Z 1KRLA 1ML8A 3VMGA 2OTJ1 3CMAZ 1K8A1 3J81f 1YIJZ
chains in the Genus database with same CATH topology
3I56Z 5IP7I 3CCU1 2HU9A 1VQ6Z 3I07A 1M1K1 1YHQZ 2VUGA 1I6HI 1VQ61 1VQ4Z 3CCEZ 4E30A 4A3KI 2VF1A 3GTOI 1S721 3Q87A 3NH8A 3I4MI 3J80b 2W04A 1YJW1 2NVTI 1TWFI 4RVGA 1YI21 2KI7B 4A3FI 5IP9I 1K731 4MH4A 1Q821 1QVFZ 5T64A 3LUSA 3BG1B 1NUIA 4NFRA 3CCVZ 3CCM1 3GTLI 1VQ5Z 3MONA 1JWHC 3CCUZ 4Y7NI 3RZOI 2O53A 4NBEA 1QYPA 3F3PC 2IZ4A 3S14I 4RV9A 2RHBA 1KC81 1Q862 4A3BI 3PO3I 3D6WA 4CL1A 1W2BZ 3J80f 4NH1C 1NP6A 4A3JI 1Y1VI 2YU9I 3CC41 3GTKI 3D9XA 4A3CI 1K9M1 4E31A 3K7AI 4NOZA 1Q822 3CCQZ 5A2Qb 3CPWY 3KIFA 2M48A 2ZAEB 2GTIA 1YUAA 3GTPI 3S16I 3CPWZ 1X3ZA 1RO2A 5D1OA 4A3EI 3CCMZ 2E2II 1TFIA 1YUKA 1RLYA 1X3WA 2DE6A 2E2JI 3OW2Y 3G6E1 1VLAA 4MRIA 2OZKA 3FQMA 3IX0A 2NVQI 3S1QI 4NB9A 2V8IA 3J7A4 1DL6A 1VQ91 3HOWI 3CXCZ 3CCL1 3S1MI 1L1OC 5FLMI 3CCRZ 2R6MA 3CMA1 2R93I 1M902 3CXCY 1ZH1A 1YJN1 1YJWZ 3HOXI 1USPA 2Q51A 2R92I 3GTGI 1N2FA 1YIT1 2QRDB 4MXUA 4NBCA 1RO4A 3BG0B 3RZDI 3M3YI 1K732 3F3FC 1RNIA 5D1PA 3ESWA 4RVDA 1Z03A 1ZB8A 4A3DI 1P9NA 2RBLA 4EWCA 5A2Qf 2BJOA 1QF8A 2JA5I 4HH4A 2JA8I 3H3VJ 1YIJ1 4A93I 2OTJZ 2QRCB 1Q811 2F4MA 1QVGZ 2QEX1 3HKZA 1I50I 2W03A 3FQQA 2JA7I 3G4SZ 3GCFA 2H85A 3G4S1 4NBHA 1ZB9A 2JNYA 4E2ZA 2GU2A 2HF1A 4E2XA 4DQYB 5IT9f 1VQ71 4BBRI 4BXXI 2G2KA 4AYBA 3GKQA 1RQFA 1PFTA 3CC4Z 3CCS1 1M1K2 2AKLA 2LIYA 3GTQI 3P5JB 1YHQ1 3NDIA 2IZ3A 3I55Z 2QLVB 3S15I 2OTL1 2R7ZI 3TDHB 2OTLZ 1K9M2 1VQK1 2V8KA 1VQMZ 1Q7Y1 2RT9A 2JMOA 3NH4A 3VB9A 2LFUA 4MONA 3HOYI 3NDJA 2JS4A 1VQN1 2O4HA 2B63I 5IT9b 2OOXB 4E33A 1YJ91 3NH5A 4BBSI 1YJ9Z 2YADA 1WW9A 3MZLB 1VQ9Z 3PO3S 2F4OA 4QTTA 3NFZA 2JA6I 2DE7A 2QA4Z 3CME1 2K3RA 2QEXZ 1YJNZ 1SFOI 1Y1VS 3CQZI 1KQSY 4BY1I 3CC2Z 3HOUI 1K8A2 1VQKZ 4XX2A 2DE5A 2JUBA 4NBBA 5C4XI 3CMEZ 1Z01A 1Q7Y2 1VQ41 1QVGY 4NB8A 3QWUA 3CCQ1 2QR1B 3G6EZ 3GTJI 2P28A 2VUMI 3VMIA 1VQO1 4RS4A 4MD8A 1KD12 2J6AA 2OOYB 4NBFA 4Y52I 1VQM1 4NBAA 5D1OB 3J81b 3I4NI 3FKII 2I3CA 3S1RI 3EERA 1R9TI 4S1TA 3TE5B 2E9HA 1VQ8Z 2PK7A 1WIIA 1VQLZ 4HGZA 3S1NI 2P3YA 5C4JI 3KIHA 3CC71 4A3II 3S2DI 1VQP1 1Q861 3H0GI 5T6BA 1S7MA 1QVFY 3CCSZ 2RIQA 3CD6Z 2M6NA 3VTNA 2NVXI 3G711 5C44I 4A3LI 4E32A 4A3MI 4HGYA 1VQ51 4QTUA 3CCV1 1K83I 3GTMS 3S17I 2K5RA 1KC82 5FLXf 2Q4ZA 3JAMf 1USPB 1TWGI 2PMZA 1LQLA 1S72Z 3CCJZ 3CCR1 3CC21 5AN9F 3CCJ1 3CCE1 4RVFA 1YITZ 4NBDA 3HOZI 3IF8A 3IFUA 2NVYI 3OW2Z 2QKDA 1Q812 4E2YA 2E2HI 1Y1WI 2JR6A 3T4NB 5FLXb 1YI2Z 3G71Z 4MD7A 2GTHA 4DK1A 3CD61 3JAMb 3I551 1Z02A 3M4OI 1VQPZ 4X6AI 3EEDA 4E2WA 3CCLZ 1NJI1 4MD9A 3MZKB 1VQNZ 3HOVI 1N8R1 1TWAI 1JJ2Y 1VQ81 3VMHA 2V8JA 2EGTA 3I561 1I3QI 4DGLA 4RVHA 3CC7Z 4NBGA 1WCMI 5CM2M 5T67A 2KPIA 1TWCI 1VQ7Z 1VQL1 1NJI2 2Y0SA 2PM9A 5C3EI 2QREB 1TWHI 1KQSZ 3GTMI 1KD11 2QA41 1W2BY 3S2HI 3U50C 3PO2I 1M901 4TNUA 1X0TA 2WAQA 1RO0A 4BY7I 1N8R2 2RPRA 4A3GI 5LL6f 1VQOZ 2WB1A 1JJ2Z 1KRLA 1ML8A 3VMGA 2OTJ1 3CMAZ 1K8A1 3J81f 1YIJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ9 Z;  3I56 Z;  1VQ9 1;  1S72 Z;  1VQ9 Z;  3CXC Z;  3CCJ Z;  3CCL 1;  3CCR 1;  3CC2 1;  3CCU 1;  1VQ6 Z;  3CCJ 1;  1M1K 1;  2QA4 Z;  1YHQ Z;  3CME 1;  1VQ6 1;  3CCR Z;  1VQ4 Z;  3CMA 1;  2QEX Z;  3CCE 1;  1YJN Z;  1M90 2;  3CXC Y;  3CCE Z;  1YJN 1;  1YJW Z;  1YIT Z;  1KQS Y;  3CC2 Z;  1YIT 1;  1K8A 2;  1VQK Z;  1S72 1;  1K73 2;  3OW2 Z;  3CME Z;  1Q7Y 2;  1YJW 1;  1Q81 2;  1VQ4 1;  1QVG Y;  1YI2 1;  3CCQ 1;  1YI2 Z;  3G71 Z;  3CD6 1;  3G6E Z;  3I55 1;  1K73 1;  1Q82 1;  1QVF Z;  3CCV Z;  3CCM 1;  1VQ5 Z;  1VQO 1;  1VQP Z;  1YIJ 1;  3CCU Z;  3CCL Z;  1KD1 2;  2OTJ Z;  1NJI 1;  1Q81 1;  1VQN Z;  1QVG Z;  2QEX 1;  1N8R 1;  1VQM 1;  1JJ2 Y;  1VQ8 1;  3G4S Z;  3G4S 1;  1KC8 1;  1Q86 2;  3I56 1;  3CC7 Z;  1W2B Z;  1VQ7 1;  1VQ7 Z;  3CC4 1;  1VQ8 Z;  1VQL 1;  1NJI 2;  1VQL Z;  3CC4 Z;  1K9M 1;  3CCS 1;  1M1K 2;  1KQS Z;  3CC7 1;  1KD1 1;  1Q82 2;  2QA4 1;  1YHQ 1;  3I55 Z;  1Q86 1;  1VQP 1;  3CCQ Z;  1W2B Y;  3CPW Y;  1QVF Y;  2OTL 1;  3CCS Z;  2OTL Z;  1K9M 2;  3CD6 Z;  1M90 1;  1VQK 1;  3CPW Z;  3G71 1;  1VQM Z;  1Q7Y 1;  3CCM Z;  1N8R 2;  1VQ5 1;  3CCV 1;  1VQO Z;  3OW2 Y;  1JJ2 Z;  3G6E 1;  1KC8 2;  1VQN 1;  2OTJ 1;  3CMA Z;  1K8A 1;  1YJ9 1;  1YIJ Z; 
#chains in the Genus database with same CATH topology
 3I56 Z;  5IP7 I;  3CCU 1;  2HU9 A;  1VQ6 Z;  3I07 A;  1M1K 1;  1YHQ Z;  2VUG A;  1I6H I;  1VQ6 1;  1VQ4 Z;  1WJ2 A;  3CCE Z;  4E30 A;  4A3K I;  2VF1 A;  3GTO I;  1S72 1;  3Q87 A;  3NH8 A;  3I4M I;  3J80 b;  2W04 A;  3D2L A;  1YJW 1;  2NVT I;  1TWF I;  4RVG A;  2IV2 X;  1YI2 1;  2KI7 B;  1QXF A;  4A3F I;  5IP9 I;  1K73 1;  4MH4 A;  1Q82 1;  1QVF Z;  5T64 A;  3LUS A;  3BG1 B;  1NUI A;  4NFR A;  3CCV Z;  3CCM 1;  3GTL I;  1VQ5 Z;  3MON A;  1JWH C;  3CCU Z;  4Y7N I;  3RZO I;  2O53 A;  4NBE A;  1QYP A;  3F3P C;  2IZ4 A;  3S14 I;  4RV9 A;  2RHB A;  1KC8 1;  1Q86 2;  4A3B I;  3PO3 I;  3D6W A;  4CL1 A;  1W2B Z;  2JIR A;  3J80 f;  4NH1 C;  1NP6 A;  2AYD A;  4A3J I;  1Y1V I;  2YU9 I;  3CC4 1;  3GTK I;  3D9X A;  4A3C I;  2V45 A;  1K9M 1;  4E31 A;  3K7A I;  4NOZ A;  1Q82 2;  3CCQ Z;  5A2Q b;  3CPW Y;  3KIF A;  2M48 A;  2ZAE B;  2GTI A;  1YUA A;  3GTP I;  3S16 I;  3CPW Z;  1X3Z A;  1RO2 A;  5D1O A;  4A3E I;  3CCM Z;  2E2I I;  1TFI A;  1YUK A;  1RLY A;  2DE6 A;  1X3W A;  2E2J I;  3OW2 Y;  3G6E 1;  2E7Z A;  1VLA A;  4MRI A;  2OZK A;  3FQM A;  3IX0 A;  2NVQ I;  3S1Q I;  1Q16 A;  4NB9 A;  2V8I A;  3J7A 4;  1DL6 A;  1VQ9 1;  3HOW I;  3CXC Z;  3CCL 1;  3S1M I;  1L1O C;  3IR7 A;  5FLM I;  3CCR Z;  2R6M A;  3CMA 1;  2R93 I;  1M90 2;  2LEX A;  3CXC Y;  1ZH1 A;  1YJN 1;  3HOX I;  1YJW Z;  1USP A;  2Q51 A;  2R92 I;  3GTG I;  1N2F A;  1YIT 1;  2QRD B;  4MXU A;  4NBC A;  1RO4 A;  3BG0 B;  3RZD I;  3M3Y I;  1K73 2;  3F3F C;  1RNI A;  5D1P A;  3ESW A;  4RVD A;  1Z03 A;  1ZB8 A;  4A3D I;  1P9N A;  2RBL A;  4EWC A;  5A2Q f;  2BJO A;  1QF8 A;  2JA5 I;  4HH4 A;  2JA8 I;  3H3V J;  1YIJ 1;  4A93 I;  2NAP A;  2OTJ Z;  1Y8C A;  2QRC B;  1Q81 1;  2F4M A;  1QVG Z;  2QEX 1;  3HKZ A;  1I50 I;  2W03 A;  3FQQ A;  2JA7 I;  3G4S Z;  3GCF A;  2H85 A;  3G4S 1;  4NBH A;  1ZB9 A;  2JNY A;  4E2Z A;  2GU2 A;  2HF1 A;  4DQY B;  4E2X A;  5IT9 f;  1FDI A;  4BBR I;  1VQ7 1;  4BXX I;  2G2K A;  4AYB A;  3GKQ A;  1RQF A;  1PFT A;  3CC4 Z;  2JIM A;  3CCS 1;  1M1K 2;  2AKL A;  2LIY A;  2JIQ A;  1WZN A;  3GTQ I;  3P5J B;  1YHQ 1;  3NDI A;  2IZ3 A;  3I55 Z;  2QLV B;  3S15 I;  2OTL 1;  2R7Z I;  3TDH B;  2OTL Z;  1K9M 2;  1VQK 1;  2V8K A;  1VQM Z;  1Q7Y 1;  2RT9 A;  2JMO A;  3NH4 A;  3VB9 A;  2LFU A;  4MON A;  3HOY I;  3NDJ A;  2JS4 A;  1VQN 1;  2O4H A;  2B63 I;  5IT9 b;  2OOX B;  4E33 A;  1YJ9 1;  3NH5 A;  4BBS I;  1YJ9 Z;  2YAD A;  1WW9 A;  3MZL B;  1VQ9 Z;  3PO3 S;  2F4O A;  4QTT A;  3NFZ A;  2JA6 I;  2DE7 A;  2QA4 Z;  3CME 1;  2K3R A;  2QEX Z;  1YJN Z;  1SFO I;  1Y1V S;  3CQZ I;  1KQS Y;  4BY1 I;  3CC2 Z;  3HOU I;  1K8A 2;  1VQK Z;  4XX2 A;  2DE5 A;  2JUB A;  4NBB A;  5C4X I;  3CME Z;  1Z01 A;  1Q7Y 2;  1VQ4 1;  1QVG Y;  4NB8 A;  3QWU A;  3CCQ 1;  2QR1 B;  3G6E Z;  3GTJ I;  2P28 A;  2VUM I;  3VMI A;  1VQO 1;  4RS4 A;  4MD8 A;  1KD1 2;  2J6A A;  2OOY B;  4NBF A;  4Y52 I;  1VQM 1;  4NBA A;  5D1O B;  3J81 b;  3I4N I;  3FKI I;  2I3C A;  3S1R I;  3EER A;  1R9T I;  4S1T A;  3TE5 B;  2E9H A;  1FDO A;  1VQ8 Z;  2PK7 A;  1WII A;  1VQL Z;  4HGZ A;  3S1N I;  2P3Y A;  5C4J I;  3KIH A;  3CC7 1;  4A3I I;  3S2D I;  1VQP 1;  1Q86 1;  3H0G I;  5T6B A;  1S7M A;  1QVF Y;  3CCS Z;  2RIQ A;  2VPW A;  3CD6 Z;  2M6N A;  3VTN A;  2NVX I;  3G71 1;  5C44 I;  4A3L I;  4E32 A;  4A3M I;  4HGY A;  1VQ5 1;  4QTU A;  3CCV 1;  1K83 I;  3GTM S;  3S17 I;  2K5R A;  1KC8 2;  5FLX f;  2Q4Z A;  3JAM f;  1USP B;  1TWG I;  2PMZ A;  1LQL A;  1S72 Z;  3CCJ Z;  3CCR 1;  3CC2 1;  5AN9 F;  2JIP A;  3CCJ 1;  3CCE 1;  4RVF A;  1YIT Z;  4NBD A;  3HOZ I;  3IF8 A;  3IFU A;  2NVY I;  3OW2 Z;  2QKD A;  1Q81 2;  4E2Y A;  2E2H I;  1Y1W I;  2JR6 A;  2V3V A;  3T4N B;  5FLX b;  1YI2 Z;  3G71 Z;  4MD7 A;  1SIW A;  2GTH A;  4DK1 A;  3CD6 1;  3JAM b;  3I55 1;  1Z02 A;  3M4O I;  1VQP Z;  4X6A I;  3EED A;  4E2W A;  3CCL Z;  2VPZ A;  1NJI 1;  4MD9 A;  3MZK B;  1VQN Z;  3HOV I;  1N8R 1;  1TWA I;  1JJ2 Y;  1VQ8 1;  3VMH A;  2V8J A;  2EGT A;  3I56 1;  1I3Q I;  4DGL A;  4RVH A;  3CC7 Z;  4NBG A;  1WCM I;  5CM2 M;  2VPX A;  5T67 A;  2KPI A;  1TWC I;  1VQ7 Z;  1VQL 1;  1NJI 2;  2Y0S A;  2PM9 A;  5C3E I;  2QRE B;  1TWH I;  1AA6 A;  2VPY A;  1KQS Z;  3GTM I;  1KD1 1;  2QA4 1;  2JIO A;  1W2B Y;  3S2H I;  3U50 C;  3PO2 I;  1M90 1;  4TNU A;  1X0T A;  2WAQ A;  1RO0 A;  4BY7 I;  1N8R 2;  2RPR A;  4A3G I;  5LL6 f;  1VQO Z;  2WB1 A;  1JJ2 Z;  1KRL A;  1ML8 A;  3VMG A;  2OTJ 1;  3CMA Z;  1K8A 1;  3J81 f;  1YIJ Z; 
#chains in the Genus database with same CATH homology
 3I56 Z;  5IP7 I;  3CCU 1;  2HU9 A;  1VQ6 Z;  3I07 A;  1M1K 1;  1YHQ Z;  2VUG A;  1I6H I;  1VQ6 1;  1VQ4 Z;  3CCE Z;  4E30 A;  4A3K I;  2VF1 A;  3GTO I;  1S72 1;  3Q87 A;  3NH8 A;  3I4M I;  3J80 b;  2W04 A;  1YJW 1;  2NVT I;  1TWF I;  4RVG A;  1YI2 1;  2KI7 B;  4A3F I;  5IP9 I;  1K73 1;  4MH4 A;  1Q82 1;  1QVF Z;  5T64 A;  3LUS A;  3BG1 B;  1NUI A;  4NFR A;  3CCV Z;  3CCM 1;  3GTL I;  1VQ5 Z;  3MON A;  1JWH C;  3CCU Z;  4Y7N I;  3RZO I;  2O53 A;  4NBE A;  1QYP A;  3F3P C;  2IZ4 A;  3S14 I;  4RV9 A;  2RHB A;  1KC8 1;  1Q86 2;  4A3B I;  3PO3 I;  3D6W A;  4CL1 A;  1W2B Z;  3J80 f;  4NH1 C;  1NP6 A;  4A3J I;  1Y1V I;  2YU9 I;  3CC4 1;  3GTK I;  3D9X A;  4A3C I;  1K9M 1;  4E31 A;  3K7A I;  4NOZ A;  1Q82 2;  3CCQ Z;  5A2Q b;  3CPW Y;  3KIF A;  2M48 A;  2ZAE B;  2GTI A;  1YUA A;  3GTP I;  3S16 I;  3CPW Z;  1X3Z A;  1RO2 A;  5D1O A;  4A3E I;  3CCM Z;  2E2I I;  1TFI A;  1YUK A;  1RLY A;  1X3W A;  2DE6 A;  2E2J I;  3OW2 Y;  3G6E 1;  1VLA A;  4MRI A;  2OZK A;  3FQM A;  3IX0 A;  2NVQ I;  3S1Q I;  4NB9 A;  2V8I A;  3J7A 4;  1DL6 A;  1VQ9 1;  3HOW I;  3CXC Z;  3CCL 1;  3S1M I;  1L1O C;  5FLM I;  3CCR Z;  2R6M A;  3CMA 1;  2R93 I;  1M90 2;  3CXC Y;  1ZH1 A;  1YJN 1;  1YJW Z;  3HOX I;  1USP A;  2Q51 A;  2R92 I;  3GTG I;  1N2F A;  1YIT 1;  2QRD B;  4MXU A;  4NBC A;  1RO4 A;  3BG0 B;  3RZD I;  3M3Y I;  1K73 2;  3F3F C;  1RNI A;  5D1P A;  3ESW A;  4RVD A;  1Z03 A;  1ZB8 A;  4A3D I;  1P9N A;  2RBL A;  4EWC A;  5A2Q f;  2BJO A;  1QF8 A;  2JA5 I;  4HH4 A;  2JA8 I;  3H3V J;  1YIJ 1;  4A93 I;  2OTJ Z;  2QRC B;  1Q81 1;  2F4M A;  1QVG Z;  2QEX 1;  3HKZ A;  1I50 I;  2W03 A;  3FQQ A;  2JA7 I;  3G4S Z;  3GCF A;  2H85 A;  3G4S 1;  4NBH A;  1ZB9 A;  2JNY A;  4E2Z A;  2GU2 A;  2HF1 A;  4E2X A;  4DQY B;  5IT9 f;  1VQ7 1;  4BBR I;  4BXX I;  2G2K A;  4AYB A;  3GKQ A;  1RQF A;  1PFT A;  3CC4 Z;  3CCS 1;  1M1K 2;  2AKL A;  2LIY A;  3GTQ I;  3P5J B;  1YHQ 1;  3NDI A;  2IZ3 A;  3I55 Z;  2QLV B;  3S15 I;  2OTL 1;  2R7Z I;  3TDH B;  2OTL Z;  1K9M 2;  1VQK 1;  2V8K A;  1VQM Z;  1Q7Y 1;  2RT9 A;  2JMO A;  3NH4 A;  3VB9 A;  2LFU A;  4MON A;  3HOY I;  3NDJ A;  2JS4 A;  1VQN 1;  2O4H A;  2B63 I;  5IT9 b;  2OOX B;  4E33 A;  1YJ9 1;  3NH5 A;  4BBS I;  1YJ9 Z;  2YAD A;  1WW9 A;  3MZL B;  1VQ9 Z;  3PO3 S;  2F4O A;  4QTT A;  3NFZ A;  2JA6 I;  2DE7 A;  2QA4 Z;  3CME 1;  2K3R A;  2QEX Z;  1YJN Z;  1SFO I;  1Y1V S;  3CQZ I;  1KQS Y;  4BY1 I;  3CC2 Z;  3HOU I;  1K8A 2;  1VQK Z;  4XX2 A;  2DE5 A;  2JUB A;  4NBB A;  5C4X I;  3CME Z;  1Z01 A;  1Q7Y 2;  1VQ4 1;  1QVG Y;  4NB8 A;  3QWU A;  3CCQ 1;  2QR1 B;  3G6E Z;  3GTJ I;  2P28 A;  2VUM I;  3VMI A;  1VQO 1;  4RS4 A;  4MD8 A;  1KD1 2;  2J6A A;  2OOY B;  4NBF A;  4Y52 I;  1VQM 1;  4NBA A;  5D1O B;  3J81 b;  3I4N I;  3FKI I;  2I3C A;  3S1R I;  3EER A;  1R9T I;  4S1T A;  3TE5 B;  2E9H A;  1VQ8 Z;  2PK7 A;  1WII A;  1VQL Z;  4HGZ A;  3S1N I;  2P3Y A;  5C4J I;  3KIH A;  3CC7 1;  4A3I I;  3S2D I;  1VQP 1;  1Q86 1;  3H0G I;  5T6B A;  1S7M A;  1QVF Y;  3CCS Z;  2RIQ A;  3CD6 Z;  2M6N A;  3VTN A;  2NVX I;  3G71 1;  5C44 I;  4A3L I;  4E32 A;  4A3M I;  4HGY A;  1VQ5 1;  4QTU A;  3CCV 1;  1K83 I;  3GTM S;  3S17 I;  2K5R A;  1KC8 2;  5FLX f;  2Q4Z A;  3JAM f;  1USP B;  1TWG I;  2PMZ A;  1LQL A;  1S72 Z;  3CCJ Z;  3CCR 1;  3CC2 1;  5AN9 F;  3CCJ 1;  3CCE 1;  4RVF A;  1YIT Z;  4NBD A;  3HOZ I;  3IF8 A;  3IFU A;  2NVY I;  3OW2 Z;  2QKD A;  1Q81 2;  4E2Y A;  2E2H I;  1Y1W I;  2JR6 A;  3T4N B;  5FLX b;  1YI2 Z;  3G71 Z;  4MD7 A;  2GTH A;  4DK1 A;  3CD6 1;  3JAM b;  3I55 1;  1Z02 A;  3M4O I;  1VQP Z;  4X6A I;  3EED A;  4E2W A;  3CCL Z;  1NJI 1;  4MD9 A;  3MZK B;  1VQN Z;  3HOV I;  1N8R 1;  1TWA I;  1JJ2 Y;  1VQ8 1;  3VMH A;  2V8J A;  2EGT A;  3I56 1;  1I3Q I;  4DGL A;  4RVH A;  3CC7 Z;  4NBG A;  1WCM I;  5CM2 M;  5T67 A;  2KPI A;  1TWC I;  1VQ7 Z;  1VQL 1;  1NJI 2;  2Y0S A;  2PM9 A;  5C3E I;  2QRE B;  1TWH I;  1KQS Z;  3GTM I;  1KD1 1;  2QA4 1;  1W2B Y;  3S2H I;  3U50 C;  3PO2 I;  1M90 1;  4TNU A;  1X0T A;  2WAQ A;  1RO0 A;  4BY7 I;  1N8R 2;  2RPR A;  4A3G I;  5LL6 f;  1VQO Z;  2WB1 A;  1JJ2 Z;  1KRL A;  1ML8 A;  3VMG A;  2OTJ 1;  3CMA Z;  1K8A 1;  3J81 f;  1YIJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...