3CCRZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccrZ00
3CCM1 3I55Z 3G71Z 1K732 1YHQZ 1VQOZ 1N8R1 1YJ9Z 2OTL1 2OTJZ 3CCJZ 3CCUZ 3CCQ1 3G6EZ 1Q7Y2 2QA4Z 1M901 1K8A1 1VQ4Z 3I56Z 1KC82 1M1K2 3CCEZ 1S72Z 1VQPZ 1QVGY 1K9M1 1KQSY 3CCV1 1VQKZ 1Q861 1VQ51 1VQ91 3CC4Z 2QEX1 1VQ6Z 1VQ71 3OW2Z 1Q821 1YIJ1 1VQ8Z 1NJI1 1KQSZ 1W2BY 1JJ2Z 1VQL1 3CMAZ 1VQM1 3CC21 1VQNZ 3CCLZ 3CCS1 1YIT1 1YJN1 1YI21 3CC71 1N8R2 3G4S1 1YJWZ 3CMEZ 3CCR1 3CD61 1Q811 3CCMZ 3CPWY 3CXCY 3I551 3G711 1YHQ1 1VQO1 2OTLZ 1YJ91 1KD11 1QVGZ 1M902 1K8A2 3CPWZ 3CXCZ 1K9M2 2OTJ1 3CCJ1 1Q862 3CCU1 1K731 3CCQZ 3G6E1 1W2BZ 1Q822 2QA41 1NJI2 1VQ41 3I561 3CCE1 1S721 1VQP1 3CCVZ 1VQK1 1VQ5Z 1VQ9Z 1QVFY 3CC41 2QEXZ 1VQ61 1VQ7Z 1YIJZ 1Q7Y1 1VQ81 1KC81 1M1K1 3CME1 1VQLZ 1QVFZ 1Q812 3CMA1 1VQMZ 3CC2Z 1VQN1 3CCL1 3CCSZ 1YITZ 1YI2Z 1YJNZ 3CC7Z 1KD12 3G4SZ 3OW2Y 1YJW1 3CCRZ 3CD6Z 1JJ2Y
chains in the Genus database with same CATH superfamily
3I55Z 1Q16A 4NBFA 2RIQA 2VPYA 2JIOA 1YJ9Z 4A3FI 3IX0A 2OTJZ 4RVDA 3H3VJ 2QLVB 3P5JB 2OZKA 1RO2A 3QWUA 3G6EZ 1Q7Y2 2QA4Z 3I56Z 3JAMf 1M1K2 5C3EI 1S72Z 1VQPZ 2V8KA 4A3DI 1X3WA 3GTKI 3PO3S 1VLAA 1Y1WI 3GTJI 3FKII 1VQ6Z 1Y1VI 3GTGI 1NJI1 2NVYI 2E2JI 2K5RA 2HF1A 2M48A 1DL6A 1YIT1 1YJN1 1N8R2 4XX2A 1Q811 3I4MI 3LUSA 3CXCY 2M6NA 2IZ3A 1X0TA 3TDHB 4E2WA 1KD11 4NOZA 3GKQA 2GTIA 1M902 2YU9I 1K8A2 2IZ4A 2DE5A 3CCJ1 2NVTI 2F4MA 2E2II 4S1TA 3D2LA 2VUGA 3M4OI 1TWGI 3IR7A 2QR1B 4NH1C 1WCMI 3S1NI 1Q7Y1 1VQ81 1M1K1 2JIRA 3I4NI 2E7ZA 3NH5A 2LIYA 1RO0A 1YITZ 1YJNZ 4E32A 3KIHA 2VPWA 2F4OA 3GTLI 4MRIA 1YJW1 4NB9A 2JUBA 1WJ2A 3EERA 1FDIA 1JJ2Y 3GTQI 3BG0B 4NBCA 3T4NB 3J81f 1N8R1 1I6HI 1TWAI 4A3MI 1ML8A 5FLXb 2JA6I 3CCJZ 3NFZA 1NUIA 2VF1A 2R93I 3ESWA 3CCQ1 2AYDA 1M901 2JA7I 1K8A1 1KC82 5T6BA 1QYPA 1QVGY 2E2HI 1TWCI 1VQ51 4BY7I 3IF8A 4A3JI 3HOWI 5IP9I 1YIJ1 1VQ8Z 1W2BY 1JJ2Z 4A3LI 3GTPI 4E2YA 4MXUA 3CC21 4HH4A 2RT9A 2KI7B 4QTUA 1YI21 2IV2X 3GTOI 1YJWZ 1RO4A 1ZH1A 2G2KA 2H85A 2JS4A 3G711 1TFIA 1N2FA 1QF8A 4E2XA 5FLMI 3GCFA 3HKZA 4AYBA 3HOUI 1VQO1 2NAPA 1WIIA 1QVGZ 1P9NA 4RVHA 3NDJA 3NH4A 1Q862 2DE7A 2RHBA 3CCU1 1YUAA 1KRLA 3MZKB 3JAMb 3CCQZ 4E31A 3FQMA 1Y8CA 3VMHA 1W2BZ 1VQ41 3CCE1 4NBEA 2JMOA 1VQ5Z 5IT9f 2R6MA 1YIJZ 3KIFA 4NBBA 4BBRI 1KC81 1Z02A 2RPRA 1TWHI 2R92I 2K3RA 3CMA1 3S2HI 3D9XA 3HOXI 3CC2Z 1VQN1 3CCL1 1YI2Z 1WZNA 4MONA 3HOYI 3VMIA 4Y52I 5IT9b 4A3CI 3CME1 5A2Qf 2OOXB 2W04A 3G71Z 3BG1B 1K732 1PFTA 1VQOZ 2OTL1 1SIWA 5D1OB 3CQZI 1RLYA 3U50C 5D1OA 3CCUZ 1K83I 2JIPA 2JA5I 3J7A4 1VQ4Z 2QRCB 3VB9A 4MH4A 3CCEZ 4BXXI 3CCV1 5LL6f 3TE5B 1NP6A 2NVQI 3M3YI 1Q861 4NFRA 2ZAEB 1VQ91 2VPZA 2QEX1 2Q4ZA 1VQ71 4MD8A 1KQSZ 3J80f 1S7MA 3HOVI 1USPB 4Y7NI 3RZDI 3CMAZ 1VQM1 1USPA 3CCLZ 1VQNZ 2KPIA 3MONA 3CC71 2V8IA 5C4JI 2JNYA 2LEXA 4MD9A 2V45A 3S1RI 1TWFI 3CMEZ 2RBLA 3CCR1 3CD61 5T64A 3J81b 1I3QI 3S1QI 1JWHC 4A3EI 2AKLA 1YHQ1 1I50I 3F3FC 2I3CA 1RQFA 4TNUA 2OTLZ 2PM9A 2GU2A 3CPWZ 1K9M2 1YUKA 4BY1I 4E33A 1RNIA 3HOZI 1Z01A 2BJOA 4EWCA 1K731 4BBSI 2PK7A 1Q822 2GTHA 4NBDA 3CCVZ 2PMZA 2YADA 1VQK1 4A3BI 1QXFA 1VQ9Z 2P28A 2O4HA 3CC41 2QEXZ 1VQ7Z 3EEDA 2DE6A 3S1MI 1QVFZ 1VQMZ 3Q87A 4RS4A 3CC7Z 3VMGA 4A3KI 2OOYB 4QTTA 3S16I 1ZB8A 3OW2Y 2NVXI 3CCRZ 1R9TI 3CD6Z 3CCM1 2B63I 3S2DI 3I07A 1YHQZ 2Q51A 2VPXA 5IP7I 2JA8I 3GTMS 1Z03A 2JIMA 4DK1A 3K7AI 2QREB 4E2ZA 2LFUA 4NBAA 2P3YA 2VUMI 2Y0SA 4A3II 4RVGA 1K9M1 1KQSY 2WB1A 3MZLB 1VQKZ 2O53A 3VTNA 4NBHA 2WAQA 3CC4Z 1WW9A 3OW2Z 1Q821 5C4XI 1VQL1 2E9HA 4A3GI 3CCS1 3S14I 3NDIA 5D1PA 3H0GI 5A2Qb 3G4S1 4DGLA 1LQLA 2QRDB 3CCMZ 3CPWY 4DQYB 3I551 3PO3I 3NH8A 2J6AA 1SFOI 1FDOA 4CL1A 3S17I 1YJ91 2HU9A 2W03A 3CXCZ 2OTJ1 3PO2I 4NBGA 3GTMI 3F3PC 2V8JA 5FLXf 3G6E1 4HGZA 2EGTA 2QA41 1NJI2 4RV9A 3I561 1S721 1VQP1 4MD7A 2JIQA 5CM2M 1QVFY 4E30A 2QKDA 3J80b 4X6AI 1Y1VS 3D6WA 4HGYA 4RVFA 1VQ61 3RZOI 5AN9F 4A93I 1VQLZ 1Q812 2R7ZI 1L1OC 5C44I 3IFUA 5T67A 1AA6A 3CCSZ 1ZB9A 3FQQA 1KD12 3S15I 3G4SZ 2JR6A 2V3VA 1X3ZA 4NB8A
chains in the Genus database with same CATH topology
3I55Z 4NBFA 2RIQA 1YJ9Z 4A3FI 3IX0A 2OTJZ 4RVDA 3H3VJ 2QLVB 3P5JB 2OZKA 1RO2A 3QWUA 3G6EZ 1Q7Y2 2QA4Z 3I56Z 3JAMf 1M1K2 5C3EI 1S72Z 1VQPZ 2V8KA 4A3DI 1X3WA 3GTKI 3PO3S 1VLAA 1Y1WI 3GTJI 3FKII 1VQ6Z 1Y1VI 3GTGI 1NJI1 2NVYI 2E2JI 2K5RA 2HF1A 2M48A 1DL6A 1YIT1 1YJN1 1N8R2 4XX2A 1Q811 3I4MI 3LUSA 3CXCY 2M6NA 2IZ3A 1X0TA 3TDHB 4E2WA 1KD11 4NOZA 3GKQA 2GTIA 1M902 2YU9I 1K8A2 2IZ4A 2DE5A 3CCJ1 2NVTI 2F4MA 2E2II 4S1TA 2VUGA 3M4OI 1TWGI 2QR1B 4NH1C 1WCMI 3S1NI 1Q7Y1 1VQ81 1M1K1 3I4NI 3NH5A 2LIYA 1RO0A 1YITZ 1YJNZ 4E32A 3KIHA 2F4OA 3GTLI 4MRIA 1YJW1 4NB9A 2JUBA 3EERA 1JJ2Y 3GTQI 3BG0B 4NBCA 3T4NB 3J81f 1N8R1 1I6HI 1TWAI 4A3MI 1ML8A 5FLXb 2JA6I 3CCJZ 3NFZA 1NUIA 2VF1A 2R93I 3ESWA 3CCQ1 1M901 2JA7I 1K8A1 1KC82 5T6BA 1QYPA 1QVGY 2E2HI 1TWCI 1VQ51 4BY7I 3IF8A 4A3JI 3HOWI 5IP9I 1YIJ1 1VQ8Z 1W2BY 1JJ2Z 4A3LI 3GTPI 4E2YA 4MXUA 3CC21 4HH4A 2RT9A 2KI7B 4QTUA 1YI21 3GTOI 1YJWZ 1RO4A 1ZH1A 2G2KA 2H85A 2JS4A 3G711 1TFIA 1N2FA 1QF8A 4E2XA 5FLMI 3GCFA 3HKZA 4AYBA 3HOUI 1VQO1 1WIIA 1QVGZ 1P9NA 4RVHA 3NDJA 3NH4A 1Q862 2DE7A 2RHBA 3CCU1 1YUAA 1KRLA 3MZKB 3JAMb 3CCQZ 4E31A 3FQMA 3VMHA 1W2BZ 1VQ41 3CCE1 4NBEA 2JMOA 1VQ5Z 5IT9f 2R6MA 1YIJZ 3KIFA 4NBBA 4BBRI 1KC81 1Z02A 2RPRA 1TWHI 2R92I 2K3RA 3CMA1 3S2HI 3D9XA 3HOXI 3CC2Z 1VQN1 3CCL1 1YI2Z 4MONA 3HOYI 3VMIA 4Y52I 5IT9b 4A3CI 3CME1 5A2Qf 2OOXB 2W04A 3G71Z 3BG1B 1K732 1PFTA 1VQOZ 2OTL1 5D1OB 3CQZI 1RLYA 3U50C 5D1OA 3CCUZ 1K83I 2JA5I 3J7A4 1VQ4Z 2QRCB 3VB9A 4MH4A 3CCEZ 4BXXI 3CCV1 5LL6f 3TE5B 1NP6A 2NVQI 3M3YI 1Q861 4NFRA 2ZAEB 1VQ91 2QEX1 2Q4ZA 1VQ71 4MD8A 1KQSZ 3J80f 1S7MA 3HOVI 1USPB 4Y7NI 3RZDI 3CMAZ 1VQM1 1USPA 3CCLZ 1VQNZ 2KPIA 3MONA 3CC71 2V8IA 5C4JI 2JNYA 4MD9A 3S1RI 1TWFI 3CMEZ 2RBLA 3CCR1 3CD61 5T64A 3J81b 1I3QI 3S1QI 1JWHC 4A3EI 2AKLA 1YHQ1 1I50I 3F3FC 2I3CA 1RQFA 4TNUA 2OTLZ 2PM9A 2GU2A 3CPWZ 1K9M2 1YUKA 4BY1I 4E33A 1RNIA 3HOZI 1Z01A 2BJOA 4EWCA 1K731 4BBSI 2PK7A 1Q822 2GTHA 4NBDA 3CCVZ 2PMZA 2YADA 1VQK1 4A3BI 1VQ9Z 2P28A 2O4HA 3CC41 2QEXZ 1VQ7Z 3EEDA 2DE6A 3S1MI 1QVFZ 1VQMZ 3Q87A 4RS4A 3CC7Z 3VMGA 4A3KI 2OOYB 4QTTA 3S16I 1ZB8A 3OW2Y 2NVXI 3CCRZ 1R9TI 3CD6Z 3CCM1 2B63I 3S2DI 3I07A 1YHQZ 2Q51A 5IP7I 2JA8I 3GTMS 1Z03A 4DK1A 3K7AI 2QREB 4E2ZA 2LFUA 4NBAA 2P3YA 2VUMI 2Y0SA 4A3II 4RVGA 1K9M1 1KQSY 2WB1A 3MZLB 1VQKZ 2O53A 3VTNA 4NBHA 2WAQA 3CC4Z 1WW9A 3OW2Z 1Q821 5C4XI 1VQL1 2E9HA 4A3GI 3CCS1 3S14I 3NDIA 5D1PA 3H0GI 5A2Qb 3G4S1 4DGLA 1LQLA 2QRDB 3CCMZ 3CPWY 4DQYB 3I551 3PO3I 3NH8A 2J6AA 1SFOI 4CL1A 3S17I 1YJ91 2HU9A 2W03A 3CXCZ 2OTJ1 3PO2I 4NBGA 3GTMI 3F3PC 2V8JA 5FLXf 3G6E1 4HGZA 2EGTA 2QA41 1NJI2 4RV9A 3I561 1S721 1VQP1 4MD7A 5CM2M 1QVFY 4E30A 2QKDA 3J80b 4X6AI 1Y1VS 3D6WA 4HGYA 4RVFA 1VQ61 3RZOI 5AN9F 4A93I 1VQLZ 1Q812 2R7ZI 1L1OC 5C44I 3IFUA 5T67A 3CCSZ 1ZB9A 3FQQA 1KD12 3S15I 3G4SZ 2JR6A 1X3ZA 4NB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM 1;  3I55 Z;  3G71 Z;  1K73 2;  1YHQ Z;  1VQO Z;  1N8R 1;  1YJ9 Z;  2OTL 1;  2OTJ Z;  3CCJ Z;  3CCU Z;  3CCQ 1;  3G6E Z;  1Q7Y 2;  2QA4 Z;  1M90 1;  1K8A 1;  1VQ4 Z;  3I56 Z;  1KC8 2;  1M1K 2;  3CCE Z;  1S72 Z;  1VQP Z;  1QVG Y;  1K9M 1;  1KQS Y;  3CCV 1;  1VQK Z;  1Q86 1;  1VQ5 1;  1VQ9 1;  3CC4 Z;  2QEX 1;  1VQ6 Z;  1VQ7 1;  3OW2 Z;  1Q82 1;  1YIJ 1;  1VQ8 Z;  1NJI 1;  1KQS Z;  1W2B Y;  1JJ2 Z;  1VQL 1;  3CMA Z;  1VQM 1;  3CC2 1;  1VQN Z;  3CCL Z;  3CCS 1;  1YIT 1;  1YJN 1;  1YI2 1;  3CC7 1;  1N8R 2;  3G4S 1;  1YJW Z;  3CME Z;  3CCR 1;  3CD6 1;  1Q81 1;  3CCM Z;  3CPW Y;  3CXC Y;  3I55 1;  3G71 1;  1YHQ 1;  1VQO 1;  2OTL Z;  1YJ9 1;  1KD1 1;  1QVG Z;  1M90 2;  1K8A 2;  3CPW Z;  3CXC Z;  1K9M 2;  2OTJ 1;  3CCJ 1;  1Q86 2;  3CCU 1;  1K73 1;  3CCQ Z;  3G6E 1;  1W2B Z;  1Q82 2;  2QA4 1;  1NJI 2;  1VQ4 1;  3I56 1;  3CCE 1;  1S72 1;  1VQP 1;  3CCV Z;  1VQK 1;  1VQ5 Z;  1VQ9 Z;  1QVF Y;  3CC4 1;  2QEX Z;  1VQ6 1;  1VQ7 Z;  1YIJ Z;  1Q7Y 1;  1VQ8 1;  1KC8 1;  1M1K 1;  3CME 1;  1VQL Z;  1QVF Z;  1Q81 2;  3CMA 1;  1VQM Z;  3CC2 Z;  1VQN 1;  3CCL 1;  3CCS Z;  1YIT Z;  1YI2 Z;  1YJN Z;  3CC7 Z;  1KD1 2;  3G4S Z;  3OW2 Y;  1YJW 1;  3CCR Z;  3CD6 Z;  1JJ2 Y; 
#chains in the Genus database with same CATH topology
 3I55 Z;  1Q16 A;  4NBF A;  2RIQ A;  2VPY A;  2JIO A;  1YJ9 Z;  4A3F I;  3IX0 A;  2OTJ Z;  4RVD A;  3H3V J;  2QLV B;  3P5J B;  2OZK A;  1RO2 A;  3QWU A;  3G6E Z;  1Q7Y 2;  2QA4 Z;  3I56 Z;  3JAM f;  1M1K 2;  5C3E I;  1S72 Z;  1VQP Z;  2V8K A;  4A3D I;  1X3W A;  3GTK I;  3PO3 S;  1VLA A;  1Y1W I;  3GTJ I;  3FKI I;  1VQ6 Z;  1Y1V I;  3GTG I;  1NJI 1;  2NVY I;  2E2J I;  2K5R A;  2HF1 A;  2M48 A;  1DL6 A;  1YIT 1;  1YJN 1;  1N8R 2;  4XX2 A;  1Q81 1;  3I4M I;  3LUS A;  3CXC Y;  2M6N A;  2IZ3 A;  1X0T A;  3TDH B;  4E2W A;  1KD1 1;  4NOZ A;  3GKQ A;  2GTI A;  1M90 2;  2YU9 I;  1K8A 2;  2IZ4 A;  2DE5 A;  3CCJ 1;  2NVT I;  2F4M A;  2E2I I;  4S1T A;  3D2L A;  2VUG A;  3M4O I;  1TWG I;  3IR7 A;  2QR1 B;  4NH1 C;  1WCM I;  3S1N I;  1Q7Y 1;  1VQ8 1;  1M1K 1;  2JIR A;  3I4N I;  2E7Z A;  3NH5 A;  2LIY A;  1RO0 A;  1YIT Z;  1YJN Z;  4E32 A;  3KIH A;  2VPW A;  2F4O A;  3GTL I;  4MRI A;  1YJW 1;  4NB9 A;  2JUB A;  1WJ2 A;  3EER A;  1FDI A;  1JJ2 Y;  3GTQ I;  3BG0 B;  4NBC A;  3T4N B;  3J81 f;  1N8R 1;  1I6H I;  1TWA I;  4A3M I;  1ML8 A;  5FLX b;  2JA6 I;  3CCJ Z;  3NFZ A;  1NUI A;  2VF1 A;  2R93 I;  3ESW A;  3CCQ 1;  2AYD A;  1M90 1;  2JA7 I;  1K8A 1;  1KC8 2;  5T6B A;  1QYP A;  1QVG Y;  2E2H I;  1TWC I;  1VQ5 1;  4BY7 I;  3IF8 A;  4A3J I;  3HOW I;  5IP9 I;  1YIJ 1;  1VQ8 Z;  1W2B Y;  1JJ2 Z;  4A3L I;  3GTP I;  4E2Y A;  4MXU A;  3CC2 1;  4HH4 A;  2RT9 A;  2KI7 B;  4QTU A;  1YI2 1;  2IV2 X;  3GTO I;  1YJW Z;  1RO4 A;  1ZH1 A;  2G2K A;  2H85 A;  2JS4 A;  3G71 1;  1TFI A;  1N2F A;  1QF8 A;  4E2X A;  5FLM I;  3GCF A;  3HKZ A;  4AYB A;  3HOU I;  1VQO 1;  2NAP A;  1WII A;  1QVG Z;  1P9N A;  4RVH A;  3NDJ A;  3NH4 A;  1Q86 2;  2DE7 A;  2RHB A;  3CCU 1;  1YUA A;  1KRL A;  3MZK B;  3JAM b;  3CCQ Z;  4E31 A;  3FQM A;  1Y8C A;  3VMH A;  1W2B Z;  1VQ4 1;  3CCE 1;  4NBE A;  2JMO A;  1VQ5 Z;  5IT9 f;  2R6M A;  1YIJ Z;  3KIF A;  4NBB A;  4BBR I;  1KC8 1;  1Z02 A;  2RPR A;  1TWH I;  2R92 I;  2K3R A;  3CMA 1;  3S2H I;  3D9X A;  3HOX I;  3CC2 Z;  1VQN 1;  3CCL 1;  1YI2 Z;  1WZN A;  4MON A;  3HOY I;  3VMI A;  4Y52 I;  5IT9 b;  4A3C I;  3CME 1;  5A2Q f;  2OOX B;  2W04 A;  3G71 Z;  3BG1 B;  1K73 2;  1PFT A;  1VQO Z;  2OTL 1;  1SIW A;  5D1O B;  3CQZ I;  1RLY A;  3U50 C;  5D1O A;  3CCU Z;  1K83 I;  2JIP A;  2JA5 I;  3J7A 4;  1VQ4 Z;  2QRC B;  3VB9 A;  4MH4 A;  3CCE Z;  4BXX I;  3CCV 1;  5LL6 f;  3TE5 B;  1NP6 A;  2NVQ I;  3M3Y I;  1Q86 1;  4NFR A;  2ZAE B;  1VQ9 1;  2VPZ A;  2QEX 1;  2Q4Z A;  1VQ7 1;  4MD8 A;  1KQS Z;  3J80 f;  1S7M A;  3HOV I;  1USP B;  4Y7N I;  3RZD I;  3CMA Z;  1VQM 1;  1USP A;  3CCL Z;  1VQN Z;  2KPI A;  3MON A;  3CC7 1;  2V8I A;  5C4J I;  2JNY A;  2LEX A;  4MD9 A;  2V45 A;  3S1R I;  1TWF I;  3CME Z;  2RBL A;  3CCR 1;  3CD6 1;  5T64 A;  3J81 b;  1I3Q I;  3S1Q I;  1JWH C;  4A3E I;  2AKL A;  1YHQ 1;  1I50 I;  3F3F C;  2I3C A;  1RQF A;  4TNU A;  2OTL Z;  2PM9 A;  2GU2 A;  3CPW Z;  1K9M 2;  1YUK A;  4BY1 I;  4E33 A;  1RNI A;  3HOZ I;  1Z01 A;  2BJO A;  4EWC A;  1K73 1;  4BBS I;  2PK7 A;  1Q82 2;  2GTH A;  4NBD A;  3CCV Z;  2PMZ A;  2YAD A;  1VQK 1;  4A3B I;  1QXF A;  1VQ9 Z;  2P28 A;  2O4H A;  3CC4 1;  2QEX Z;  1VQ7 Z;  3EED A;  2DE6 A;  3S1M I;  1QVF Z;  1VQM Z;  3Q87 A;  4RS4 A;  3CC7 Z;  3VMG A;  4A3K I;  2OOY B;  4QTT A;  3S16 I;  1ZB8 A;  3OW2 Y;  2NVX I;  3CCR Z;  1R9T I;  3CD6 Z;  3CCM 1;  2B63 I;  3S2D I;  3I07 A;  1YHQ Z;  2Q51 A;  2VPX A;  5IP7 I;  2JA8 I;  3GTM S;  1Z03 A;  2JIM A;  4DK1 A;  3K7A I;  2QRE B;  4E2Z A;  2LFU A;  4NBA A;  2P3Y A;  2VUM I;  2Y0S A;  4A3I I;  4RVG A;  1K9M 1;  1KQS Y;  2WB1 A;  3MZL B;  1VQK Z;  2O53 A;  3VTN A;  4NBH A;  2WAQ A;  3CC4 Z;  1WW9 A;  3OW2 Z;  1Q82 1;  5C4X I;  1VQL 1;  2E9H A;  4A3G I;  3CCS 1;  3S14 I;  3NDI A;  5D1P A;  3H0G I;  5A2Q b;  3G4S 1;  4DGL A;  1LQL A;  2QRD B;  3CCM Z;  3CPW Y;  4DQY B;  3I55 1;  3PO3 I;  3NH8 A;  2J6A A;  1SFO I;  1FDO A;  4CL1 A;  3S17 I;  1YJ9 1;  2HU9 A;  2W03 A;  3CXC Z;  2OTJ 1;  3PO2 I;  4NBG A;  3GTM I;  3F3P C;  2V8J A;  5FLX f;  3G6E 1;  4HGZ A;  2EGT A;  2QA4 1;  1NJI 2;  4RV9 A;  3I56 1;  1S72 1;  1VQP 1;  4MD7 A;  2JIQ A;  5CM2 M;  1QVF Y;  4E30 A;  2QKD A;  3J80 b;  4X6A I;  1Y1V S;  3D6W A;  4HGY A;  4RVF A;  1VQ6 1;  3RZO I;  5AN9 F;  4A93 I;  1VQL Z;  1Q81 2;  2R7Z I;  1L1O C;  5C44 I;  3IFU A;  5T67 A;  1AA6 A;  3CCS Z;  1ZB9 A;  3FQQ A;  1KD1 2;  3S15 I;  3G4S Z;  2JR6 A;  2V3V A;  1X3Z A;  4NB8 A; 
#chains in the Genus database with same CATH homology
 3I55 Z;  4NBF A;  2RIQ A;  1YJ9 Z;  4A3F I;  3IX0 A;  2OTJ Z;  4RVD A;  3H3V J;  2QLV B;  3P5J B;  2OZK A;  1RO2 A;  3QWU A;  3G6E Z;  1Q7Y 2;  2QA4 Z;  3I56 Z;  3JAM f;  1M1K 2;  5C3E I;  1S72 Z;  1VQP Z;  2V8K A;  4A3D I;  1X3W A;  3GTK I;  3PO3 S;  1VLA A;  1Y1W I;  3GTJ I;  3FKI I;  1VQ6 Z;  1Y1V I;  3GTG I;  1NJI 1;  2NVY I;  2E2J I;  2K5R A;  2HF1 A;  2M48 A;  1DL6 A;  1YIT 1;  1YJN 1;  1N8R 2;  4XX2 A;  1Q81 1;  3I4M I;  3LUS A;  3CXC Y;  2M6N A;  2IZ3 A;  1X0T A;  3TDH B;  4E2W A;  1KD1 1;  4NOZ A;  3GKQ A;  2GTI A;  1M90 2;  2YU9 I;  1K8A 2;  2IZ4 A;  2DE5 A;  3CCJ 1;  2NVT I;  2F4M A;  2E2I I;  4S1T A;  2VUG A;  3M4O I;  1TWG I;  2QR1 B;  4NH1 C;  1WCM I;  3S1N I;  1Q7Y 1;  1VQ8 1;  1M1K 1;  3I4N I;  3NH5 A;  2LIY A;  1RO0 A;  1YIT Z;  1YJN Z;  4E32 A;  3KIH A;  2F4O A;  3GTL I;  4MRI A;  1YJW 1;  4NB9 A;  2JUB A;  3EER A;  1JJ2 Y;  3GTQ I;  3BG0 B;  4NBC A;  3T4N B;  3J81 f;  1N8R 1;  1I6H I;  1TWA I;  4A3M I;  1ML8 A;  5FLX b;  2JA6 I;  3CCJ Z;  3NFZ A;  1NUI A;  2VF1 A;  2R93 I;  3ESW A;  3CCQ 1;  1M90 1;  2JA7 I;  1K8A 1;  1KC8 2;  5T6B A;  1QYP A;  1QVG Y;  2E2H I;  1TWC I;  1VQ5 1;  4BY7 I;  3IF8 A;  4A3J I;  3HOW I;  5IP9 I;  1YIJ 1;  1VQ8 Z;  1W2B Y;  1JJ2 Z;  4A3L I;  3GTP I;  4E2Y A;  4MXU A;  3CC2 1;  4HH4 A;  2RT9 A;  2KI7 B;  4QTU A;  1YI2 1;  3GTO I;  1YJW Z;  1RO4 A;  1ZH1 A;  2G2K A;  2H85 A;  2JS4 A;  3G71 1;  1TFI A;  1N2F A;  1QF8 A;  4E2X A;  5FLM I;  3GCF A;  3HKZ A;  4AYB A;  3HOU I;  1VQO 1;  1WII A;  1QVG Z;  1P9N A;  4RVH A;  3NDJ A;  3NH4 A;  1Q86 2;  2DE7 A;  2RHB A;  3CCU 1;  1YUA A;  1KRL A;  3MZK B;  3JAM b;  3CCQ Z;  4E31 A;  3FQM A;  3VMH A;  1W2B Z;  1VQ4 1;  3CCE 1;  4NBE A;  2JMO A;  1VQ5 Z;  5IT9 f;  2R6M A;  1YIJ Z;  3KIF A;  4NBB A;  4BBR I;  1KC8 1;  1Z02 A;  2RPR A;  1TWH I;  2R92 I;  2K3R A;  3CMA 1;  3S2H I;  3D9X A;  3HOX I;  3CC2 Z;  1VQN 1;  3CCL 1;  1YI2 Z;  4MON A;  3HOY I;  3VMI A;  4Y52 I;  5IT9 b;  4A3C I;  3CME 1;  5A2Q f;  2OOX B;  2W04 A;  3G71 Z;  3BG1 B;  1K73 2;  1PFT A;  1VQO Z;  2OTL 1;  5D1O B;  3CQZ I;  1RLY A;  3U50 C;  5D1O A;  3CCU Z;  1K83 I;  2JA5 I;  3J7A 4;  1VQ4 Z;  2QRC B;  3VB9 A;  4MH4 A;  3CCE Z;  4BXX I;  3CCV 1;  5LL6 f;  3TE5 B;  1NP6 A;  2NVQ I;  3M3Y I;  1Q86 1;  4NFR A;  2ZAE B;  1VQ9 1;  2QEX 1;  2Q4Z A;  1VQ7 1;  4MD8 A;  1KQS Z;  3J80 f;  1S7M A;  3HOV I;  1USP B;  4Y7N I;  3RZD I;  3CMA Z;  1VQM 1;  1USP A;  3CCL Z;  1VQN Z;  2KPI A;  3MON A;  3CC7 1;  2V8I A;  5C4J I;  2JNY A;  4MD9 A;  3S1R I;  1TWF I;  3CME Z;  2RBL A;  3CCR 1;  3CD6 1;  5T64 A;  3J81 b;  1I3Q I;  3S1Q I;  1JWH C;  4A3E I;  2AKL A;  1YHQ 1;  1I50 I;  3F3F C;  2I3C A;  1RQF A;  4TNU A;  2OTL Z;  2PM9 A;  2GU2 A;  3CPW Z;  1K9M 2;  1YUK A;  4BY1 I;  4E33 A;  1RNI A;  3HOZ I;  1Z01 A;  2BJO A;  4EWC A;  1K73 1;  4BBS I;  2PK7 A;  1Q82 2;  2GTH A;  4NBD A;  3CCV Z;  2PMZ A;  2YAD A;  1VQK 1;  4A3B I;  1VQ9 Z;  2P28 A;  2O4H A;  3CC4 1;  2QEX Z;  1VQ7 Z;  3EED A;  2DE6 A;  3S1M I;  1QVF Z;  1VQM Z;  3Q87 A;  4RS4 A;  3CC7 Z;  3VMG A;  4A3K I;  2OOY B;  4QTT A;  3S16 I;  1ZB8 A;  3OW2 Y;  2NVX I;  3CCR Z;  1R9T I;  3CD6 Z;  3CCM 1;  2B63 I;  3S2D I;  3I07 A;  1YHQ Z;  2Q51 A;  5IP7 I;  2JA8 I;  3GTM S;  1Z03 A;  4DK1 A;  3K7A I;  2QRE B;  4E2Z A;  2LFU A;  4NBA A;  2P3Y A;  2VUM I;  2Y0S A;  4A3I I;  4RVG A;  1K9M 1;  1KQS Y;  2WB1 A;  3MZL B;  1VQK Z;  2O53 A;  3VTN A;  4NBH A;  2WAQ A;  3CC4 Z;  1WW9 A;  3OW2 Z;  1Q82 1;  5C4X I;  1VQL 1;  2E9H A;  4A3G I;  3CCS 1;  3S14 I;  3NDI A;  5D1P A;  3H0G I;  5A2Q b;  3G4S 1;  4DGL A;  1LQL A;  2QRD B;  3CCM Z;  3CPW Y;  4DQY B;  3I55 1;  3PO3 I;  3NH8 A;  2J6A A;  1SFO I;  4CL1 A;  3S17 I;  1YJ9 1;  2HU9 A;  2W03 A;  3CXC Z;  2OTJ 1;  3PO2 I;  4NBG A;  3GTM I;  3F3P C;  2V8J A;  5FLX f;  3G6E 1;  4HGZ A;  2EGT A;  2QA4 1;  1NJI 2;  4RV9 A;  3I56 1;  1S72 1;  1VQP 1;  4MD7 A;  5CM2 M;  1QVF Y;  4E30 A;  2QKD A;  3J80 b;  4X6A I;  1Y1V S;  3D6W A;  4HGY A;  4RVF A;  1VQ6 1;  3RZO I;  5AN9 F;  4A93 I;  1VQL Z;  1Q81 2;  2R7Z I;  1L1O C;  5C44 I;  3IFU A;  5T67 A;  3CCS Z;  1ZB9 A;  3FQQ A;  1KD1 2;  3S15 I;  3G4S Z;  2JR6 A;  1X3Z A;  4NB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...