3CCRZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccrZ00
3G4SZ 1KD12 1VQP1 3CC2Z 2QEX1 3CCU1 2QA41 1VQOZ 1Q821 3CCSZ 1M1K2 1VQ7Z 3I561 3G711 1VQ5Z 3CCMZ 1K8A2 1Q862 1KQSZ 1K9M1 3G4S1 1KC82 1Q7Y1 1VQ6Z 1K731 1YJWZ 3CCS1 2OTJZ 1VQK1 3CCQZ 1K9M2 1YIJ1 1NJI1 1KQSY 3CCM1 3CD61 1KD11 3CCJ1 1YJNZ 3CCRZ 1JJ2Z 2OTJ1 1VQ81 1M1K1 3CCQ1 3CCVZ 3I55Z 1VQ9Z 1M902 1YJ91 1K8A1 1VQLZ 1Q861 3CXCZ 1KC81 3CC4Z 1JJ2Y 1YHQZ 1VQNZ 3G6EZ 3CCV1 3CC21 3CXCY 1VQO1 1VQL1 2OTLZ 3CPWZ 1VQ71 1YITZ 1S72Z 1W2BZ 1YHQ1 1VQ51 3G6E1 3CMEZ 1VQ61 1M901 1YJW1 3CPWY 1W2BY 1Q811 3CME1 3CMAZ 1VQ4Z 3CCR1 1YJN1 3OW2Z 1Q812 1N8R1 3I551 1VQMZ 1VQ91 2QEXZ 3CCUZ 3OW2Y 3CC41 1N8R2 1QVGZ 1VQN1 3CC7Z 3G71Z 1VQM1 2OTL1 1QVGY 1YIT1 3CCEZ 1VQKZ 1QVFZ 1S721 1YIJZ 3CC71 1Q822 3CD6Z 3CCLZ 3CCJZ 1YI2Z 1VQ8Z 1QVFY 3CCE1 1Q7Y2 1K732 1VQPZ 1YJ9Z 2QA4Z 3CMA1 3CCL1 1VQ41 1YI21 1NJI2 3I56Z
chains in the Genus database with same CATH superfamily
2VUMI 3G4SZ 3F3PC 1VQP1 4E2ZA 3GTPI 3CCU1 1VQOZ 3S14I 3D9XA 3VMGA 2F4OA 2RT9A 3G711 1VQ5Z 1K8A2 4E33A 3GTQI 4A3BI 3J80b 1USPA 1K731 4RS4A 4RVHA 2JIPA 1WW9A 3CCQZ 1K9M2 2RHBA 1ML8A 2V8IA 4HGZA 4QTTA 4MONA 3CD61 2B63I 3CCJ1 4Y52I 1JJ2Z 2QRDB 2E2JI 3S15I 2WAQA 3TE5B 3JAMb 2IZ3A 3CCVZ 2R7ZI 4MD9A 1M902 1YJ91 2DE5A 3VMHA 3CC4Z 3K7AI 3GTMS 1YHQZ 3Q87A 3G6EZ 4NBFA 3CC21 1TWGI 3CXCY 1YUAA 1RO0A 3PO3I 1VQ71 4NBCA 1YITZ 5AN9F 2Q51A 1RO2A 3VTNA 1RNIA 3CPWY 5T67A 1N2FA 2E7ZA 3J81f 3BG0B 3MONA 3PO3S 3S17I 5IT9b 3I551 3CCUZ 4DGLA 2F4MA 4NH1C 1VQN1 2J6AA 3CC7Z 4BXXI 3G71Z 1VQM1 2JA6I 4MD7A 3P5JB 3J80f 2JA5I 4NBBA 1QVGY 3CCEZ 5FLXb 2PMZA 4RVGA 3CD6Z 2JUBA 4A3CI 2LFUA 4NB9A 2JA8I 3CCJZ 3MZKB 3JAMf 1TWHI 1K732 3F3FC 1YJ9Z 2QA4Z 3S16I 2NVYI 3CCL1 1USPB 1VQ41 5CM2M 3QWUA 4EWCA 2GU2A 3CC2Z 2RIQA 3IFUA 1RQFA 1VQ7Z 3S2DI 1DL6A 2QKDA 3CCMZ 1KQSZ 2V3VA 3GKQA 4TNUA 3HOUI 2JS4A 2VF1A 5IP7I 3CCS1 2OZKA 1YIJ1 2JIRA 4HGYA 3EEDA 2E9HA 2OTJ1 4AYBA 1QXFA 5IT9f 3LUSA 3I55Z 2Q4ZA 3M4OI 2JIOA 3NFZA 2ZAEB 3I07A 1SIWA 1VQLZ 1KC81 3J7A4 2GTHA 1S7MA 1VQNZ 2W04A 2NVXI 3S1NI 5A2Qb 3GTMI 5IP9I 5FLXf 2HF1A 3CMEZ 3I56Z 1VQ61 2P3YA 2V8JA 2O4HA 3FQQA 2LIYA 1W2BY 1K83I 3NDJA 5T6BA 4NBAA 1ZH1A 3T4NB 1VQ4Z 3CCR1 3OW2Z 4BBRI 1Q812 5C4XI 2R93I 3IR7A 1I3QI 3I4MI 4DQYB 1Y8CA 2NVTI 3I4NI 5C44I 3VB9A 1N8R2 4A3GI 4XX2A 2DE7A 3KIHA 3TDHB 3H0GI 2OTL1 1WCMI 4DK1A 4HH4A 1S721 1YIJZ 1Z01A 1FDOA 3NH8A 2PM9A 1TWFI 1QVFY 2W03A 1VQPZ 5FLMI 2R6MA 4NBGA 1YI21 2JNYA 2HU9A 2JIMA 4A3JI 1TWCI 1Q821 3HKZA 4Y7NI 5C3EI 3I561 3FKII 1K9M1 3G4S1 1KC82 1VQ6Z 3BG1B 2LEXA 3D6WA 3S1MI 2V45A 4A3EI 2NVQI 3D2LA 1KD11 2KI7B 3HOYI 3CCRZ 3HOZI 3U50C 1VQ81 1M1K1 3CCQ1 2QRCB 4E2XA 1Q861 3CXCZ 1ZB9A 1SFOI 2KPIA 1JJ2Y 2YADA 1TFIA 1X0TA 2H85A 2Y0SA 3CCV1 2WB1A 3MZLB 4MH4A 2IZ4A 3S1RI 2OTLZ 3CPWZ 4NBHA 4MD8A 2M6NA 4E30A 1S72Z 1YHQ1 2RPRA 3G6E1 1FDIA 4A3FI 1YJW1 1QF8A 1WZNA 1YUKA 3CQZI 2DE6A 4RV9A 4BBSI 4MXUA 2RBLA 2I3CA 3HOVI 1YJN1 5D1OA 2AKLA 2BJOA 1VQMZ 3J81b 1VQ91 4S1TA 3H3VJ 1QVGZ 1Y1VS 4NFRA 1Z02A 4BY1I 3NH5A 2PK7A 2AYDA 2K5RA 1P9NA 3CC71 3ESWA 1JWHC 2VUGA 4CL1A 4A3II 1Q822 3CCLZ 3GCFA 3IX0A 3GTLI 1VQ8Z 3CCE1 4E2WA 4QTUA 1Q16A 3CMA1 1X3WA 3GTJI 5LL6f 2E2HI 4A3LI 3EERA 1KD12 1TWAI 2IV2X 2QEX1 3NDIA 2QA41 4BY7I 3CCSZ 1M1K2 2VPXA 2OOYB 3NH4A 3HOWI 1X3ZA 1Q862 4E2YA 4E31A 3GTGI 1Q7Y1 2EGTA 1YJWZ 2OTJZ 2P28A 1VQK1 1NJI1 3RZDI 3CCM1 1KQSY 1PFTA 2V8KA 4A3KI 1YJNZ 1NP6A 1Y1WI 5C4JI 2VPYA 1Z03A 1VQ9Z 2JIQA 4RVFA 1KRLA 4X6AI 2VPZA 1K8A1 5A2Qf 2QR1B 3KIFA 1QYPA 4E32A 1WJ2A 2G2KA 4NOZA 1VQO1 1VQL1 1RO4A 3RZOI 3FQMA 5D1OB 1W2BZ 1VQ51 5T64A 1M901 2YU9I 2E2II 1WIIA 3M3YI 1L1OC 1ZB8A 2GTIA 4NB8A 2R92I 2QREB 1Q811 3CME1 3CMAZ 3IF8A 1AA6A 2O53A 4NBEA 1LQLA 1N8R1 1I50I 1I6HI 2QEXZ 2JR6A 2VPWA 3S2HI 4MRIA 3OW2Y 3CC41 3GTOI 4A3DI 4NBDA 4A3MI 1R9TI 3GTKI 1YIT1 1NUIA 1VQKZ 1QVFZ 1Y1VI 5D1PA 2OOXB 4A93I 2K3RA 2JA7I 1RLYA 3VMIA 2M48A 1VLAA 1YI2Z 2NAPA 4RVDA 1Q7Y2 2JMOA 3S1QI 3PO2I 2QLVB 1NJI2 3HOXI
chains in the Genus database with same CATH topology
2VUMI 3G4SZ 3F3PC 1VQP1 4E2ZA 3GTPI 3CCU1 1VQOZ 3S14I 3D9XA 3VMGA 2F4OA 2RT9A 3G711 1VQ5Z 1K8A2 4E33A 3GTQI 4A3BI 3J80b 1USPA 1K731 4RS4A 4RVHA 1WW9A 3CCQZ 1K9M2 2RHBA 1ML8A 2V8IA 4HGZA 4QTTA 4MONA 3CD61 2B63I 3CCJ1 4Y52I 1JJ2Z 2QRDB 2E2JI 3S15I 2WAQA 3TE5B 3JAMb 2IZ3A 3CCVZ 2R7ZI 4MD9A 1M902 1YJ91 2DE5A 3VMHA 3CC4Z 3K7AI 3GTMS 1YHQZ 3Q87A 3G6EZ 4NBFA 3CC21 1TWGI 3CXCY 1YUAA 1RO0A 3PO3I 1VQ71 4NBCA 1YITZ 5AN9F 2Q51A 1RO2A 3VTNA 1RNIA 3CPWY 5T67A 1N2FA 3J81f 3BG0B 3MONA 3PO3S 3S17I 5IT9b 3I551 3CCUZ 4DGLA 2F4MA 4NH1C 1VQN1 2J6AA 3CC7Z 4BXXI 3G71Z 1VQM1 2JA6I 4MD7A 3P5JB 3J80f 2JA5I 4NBBA 1QVGY 3CCEZ 5FLXb 2PMZA 4RVGA 3CD6Z 2JUBA 4A3CI 2LFUA 4NB9A 2JA8I 3CCJZ 3MZKB 3JAMf 1TWHI 1K732 3F3FC 1YJ9Z 2QA4Z 3S16I 2NVYI 3CCL1 1USPB 1VQ41 5CM2M 3QWUA 4EWCA 2GU2A 3CC2Z 2RIQA 3IFUA 1RQFA 1VQ7Z 3S2DI 1DL6A 2QKDA 3CCMZ 1KQSZ 3GKQA 4TNUA 3HOUI 2JS4A 2VF1A 5IP7I 3CCS1 2OZKA 1YIJ1 4HGYA 3EEDA 2E9HA 2OTJ1 4AYBA 5IT9f 3LUSA 3I55Z 2Q4ZA 3M4OI 3NFZA 2ZAEB 3I07A 1VQLZ 1KC81 3J7A4 2GTHA 1S7MA 1VQNZ 2W04A 2NVXI 3S1NI 5A2Qb 3GTMI 5IP9I 5FLXf 2HF1A 3CMEZ 3I56Z 1VQ61 2P3YA 2V8JA 2O4HA 3FQQA 2LIYA 1W2BY 1K83I 3NDJA 5T6BA 4NBAA 1ZH1A 3T4NB 1VQ4Z 3CCR1 3OW2Z 4BBRI 1Q812 5C4XI 2R93I 1I3QI 3I4MI 4DQYB 2NVTI 3I4NI 5C44I 3VB9A 1N8R2 4A3GI 4XX2A 2DE7A 3KIHA 3TDHB 3H0GI 2OTL1 1WCMI 4DK1A 4HH4A 1S721 1YIJZ 1Z01A 3NH8A 2PM9A 1TWFI 1QVFY 2W03A 1VQPZ 5FLMI 2R6MA 4NBGA 1YI21 2JNYA 2HU9A 4A3JI 1TWCI 1Q821 3HKZA 4Y7NI 5C3EI 3I561 3FKII 1K9M1 3G4S1 1KC82 1VQ6Z 3BG1B 3D6WA 3S1MI 4A3EI 2NVQI 1KD11 2KI7B 3HOYI 3CCRZ 3HOZI 3U50C 1VQ81 1M1K1 3CCQ1 2QRCB 4E2XA 1Q861 3CXCZ 1ZB9A 1SFOI 2KPIA 1JJ2Y 2YADA 1TFIA 1X0TA 2H85A 2Y0SA 3CCV1 2WB1A 3MZLB 4MH4A 2IZ4A 3S1RI 2OTLZ 3CPWZ 4NBHA 4MD8A 2M6NA 4E30A 1S72Z 1YHQ1 2RPRA 3G6E1 4A3FI 1YJW1 1QF8A 1YUKA 3CQZI 2DE6A 4RV9A 4BBSI 4MXUA 2RBLA 2I3CA 3HOVI 1YJN1 5D1OA 2AKLA 2BJOA 1VQMZ 3J81b 1VQ91 4S1TA 3H3VJ 1QVGZ 1Y1VS 4NFRA 1Z02A 4BY1I 3NH5A 2PK7A 2K5RA 1P9NA 3CC71 3ESWA 1JWHC 2VUGA 4CL1A 4A3II 1Q822 3CCLZ 3GCFA 3IX0A 3GTLI 1VQ8Z 3CCE1 4E2WA 4QTUA 3CMA1 1X3WA 3GTJI 5LL6f 2E2HI 4A3LI 3EERA 1KD12 1TWAI 2QEX1 3NDIA 2QA41 4BY7I 3CCSZ 1M1K2 2OOYB 3NH4A 3HOWI 1X3ZA 1Q862 4E2YA 4E31A 3GTGI 1Q7Y1 2EGTA 1YJWZ 2OTJZ 2P28A 1VQK1 1NJI1 3RZDI 3CCM1 1KQSY 1PFTA 2V8KA 4A3KI 1YJNZ 1NP6A 1Y1WI 5C4JI 1Z03A 1VQ9Z 4RVFA 1KRLA 4X6AI 1K8A1 5A2Qf 2QR1B 3KIFA 1QYPA 4E32A 2G2KA 4NOZA 1VQO1 1VQL1 1RO4A 3RZOI 3FQMA 5D1OB 1W2BZ 1VQ51 5T64A 1M901 2YU9I 2E2II 1WIIA 3M3YI 1L1OC 1ZB8A 2GTIA 4NB8A 2R92I 2QREB 1Q811 3CME1 3CMAZ 3IF8A 2O53A 4NBEA 1LQLA 1N8R1 1I50I 1I6HI 2QEXZ 2JR6A 3S2HI 4MRIA 3OW2Y 3CC41 3GTOI 4A3DI 4NBDA 4A3MI 1R9TI 3GTKI 1YIT1 1NUIA 1VQKZ 1QVFZ 1Y1VI 5D1PA 2OOXB 4A93I 2K3RA 2JA7I 1RLYA 3VMIA 2M48A 1VLAA 1YI2Z 4RVDA 1Q7Y2 2JMOA 3S1QI 3PO2I 2QLVB 1NJI2 3HOXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S Z;  1KD1 2;  1VQP 1;  3CC2 Z;  2QEX 1;  3CCU 1;  2QA4 1;  1VQO Z;  1Q82 1;  3CCS Z;  1M1K 2;  1VQ7 Z;  3I56 1;  3G71 1;  1VQ5 Z;  3CCM Z;  1K8A 2;  1Q86 2;  1KQS Z;  1K9M 1;  3G4S 1;  1KC8 2;  1Q7Y 1;  1VQ6 Z;  1K73 1;  1YJW Z;  3CCS 1;  2OTJ Z;  1VQK 1;  3CCQ Z;  1K9M 2;  1YIJ 1;  1NJI 1;  1KQS Y;  3CCM 1;  3CD6 1;  1KD1 1;  3CCJ 1;  1YJN Z;  3CCR Z;  1JJ2 Z;  2OTJ 1;  1VQ8 1;  1M1K 1;  3CCQ 1;  3CCV Z;  3I55 Z;  1VQ9 Z;  1M90 2;  1YJ9 1;  1K8A 1;  1VQL Z;  1Q86 1;  3CXC Z;  1KC8 1;  3CC4 Z;  1JJ2 Y;  1YHQ Z;  1VQN Z;  3G6E Z;  3CCV 1;  3CC2 1;  3CXC Y;  1VQO 1;  1VQL 1;  2OTL Z;  3CPW Z;  1VQ7 1;  1YIT Z;  1S72 Z;  1W2B Z;  1YHQ 1;  1VQ5 1;  3G6E 1;  3CME Z;  1VQ6 1;  1M90 1;  1YJW 1;  3CPW Y;  1W2B Y;  1Q81 1;  3CME 1;  3CMA Z;  1VQ4 Z;  3CCR 1;  1YJN 1;  3OW2 Z;  1Q81 2;  1N8R 1;  3I55 1;  1VQM Z;  1VQ9 1;  2QEX Z;  3CCU Z;  3OW2 Y;  3CC4 1;  1N8R 2;  1QVG Z;  1VQN 1;  3CC7 Z;  3G71 Z;  1VQM 1;  2OTL 1;  1QVG Y;  1YIT 1;  3CCE Z;  1VQK Z;  1QVF Z;  1S72 1;  1YIJ Z;  3CC7 1;  1Q82 2;  3CD6 Z;  3CCL Z;  3CCJ Z;  1YI2 Z;  1VQ8 Z;  1QVF Y;  3CCE 1;  1Q7Y 2;  1K73 2;  1VQP Z;  1YJ9 Z;  2QA4 Z;  3CMA 1;  3CCL 1;  1VQ4 1;  1YI2 1;  1NJI 2;  3I56 Z; 
#chains in the Genus database with same CATH topology
 2VUM I;  3G4S Z;  3F3P C;  1VQP 1;  4E2Z A;  3GTP I;  3CCU 1;  1VQO Z;  3S14 I;  3D9X A;  3VMG A;  2F4O A;  2RT9 A;  3G71 1;  1VQ5 Z;  1K8A 2;  4E33 A;  3GTQ I;  4A3B I;  3J80 b;  1USP A;  1K73 1;  4RS4 A;  4RVH A;  2JIP A;  1WW9 A;  3CCQ Z;  1K9M 2;  2RHB A;  1ML8 A;  2V8I A;  4HGZ A;  4QTT A;  4MON A;  3CD6 1;  2B63 I;  3CCJ 1;  4Y52 I;  1JJ2 Z;  2QRD B;  2E2J I;  3S15 I;  2WAQ A;  3TE5 B;  3JAM b;  2IZ3 A;  3CCV Z;  2R7Z I;  4MD9 A;  1M90 2;  1YJ9 1;  2DE5 A;  3VMH A;  3CC4 Z;  3K7A I;  3GTM S;  1YHQ Z;  3Q87 A;  3G6E Z;  4NBF A;  3CC2 1;  1TWG I;  3CXC Y;  1YUA A;  1RO0 A;  3PO3 I;  1VQ7 1;  4NBC A;  1YIT Z;  5AN9 F;  2Q51 A;  1RO2 A;  3VTN A;  1RNI A;  3CPW Y;  5T67 A;  1N2F A;  2E7Z A;  3J81 f;  3BG0 B;  3MON A;  3PO3 S;  3S17 I;  5IT9 b;  3I55 1;  3CCU Z;  4DGL A;  2F4M A;  4NH1 C;  1VQN 1;  2J6A A;  3CC7 Z;  4BXX I;  3G71 Z;  1VQM 1;  2JA6 I;  4MD7 A;  3P5J B;  3J80 f;  2JA5 I;  4NBB A;  1QVG Y;  3CCE Z;  5FLX b;  2PMZ A;  4RVG A;  3CD6 Z;  2JUB A;  4A3C I;  2LFU A;  4NB9 A;  2JA8 I;  3CCJ Z;  3MZK B;  3JAM f;  1TWH I;  1K73 2;  3F3F C;  1YJ9 Z;  2QA4 Z;  3S16 I;  2NVY I;  3CCL 1;  1USP B;  1VQ4 1;  5CM2 M;  3QWU A;  4EWC A;  2GU2 A;  3CC2 Z;  2RIQ A;  3IFU A;  1RQF A;  1VQ7 Z;  3S2D I;  1DL6 A;  2QKD A;  3CCM Z;  1KQS Z;  2V3V A;  3GKQ A;  4TNU A;  3HOU I;  2JS4 A;  2VF1 A;  5IP7 I;  3CCS 1;  2OZK A;  1YIJ 1;  2JIR A;  4HGY A;  3EED A;  2E9H A;  2OTJ 1;  4AYB A;  1QXF A;  5IT9 f;  3LUS A;  3I55 Z;  2Q4Z A;  3M4O I;  2JIO A;  3NFZ A;  2ZAE B;  3I07 A;  1SIW A;  1VQL Z;  1KC8 1;  3J7A 4;  2GTH A;  1S7M A;  1VQN Z;  2W04 A;  2NVX I;  3S1N I;  5A2Q b;  3GTM I;  5IP9 I;  5FLX f;  2HF1 A;  3CME Z;  3I56 Z;  1VQ6 1;  2P3Y A;  2V8J A;  2O4H A;  3FQQ A;  2LIY A;  1W2B Y;  1K83 I;  3NDJ A;  5T6B A;  4NBA A;  1ZH1 A;  3T4N B;  1VQ4 Z;  3CCR 1;  3OW2 Z;  4BBR I;  1Q81 2;  5C4X I;  2R93 I;  3IR7 A;  1I3Q I;  3I4M I;  4DQY B;  1Y8C A;  2NVT I;  3I4N I;  5C44 I;  3VB9 A;  1N8R 2;  4A3G I;  4XX2 A;  2DE7 A;  3KIH A;  3TDH B;  3H0G I;  2OTL 1;  1WCM I;  4DK1 A;  4HH4 A;  1S72 1;  1YIJ Z;  1Z01 A;  1FDO A;  3NH8 A;  2PM9 A;  1TWF I;  1QVF Y;  2W03 A;  1VQP Z;  5FLM I;  2R6M A;  4NBG A;  1YI2 1;  2JNY A;  2HU9 A;  2JIM A;  4A3J I;  1TWC I;  1Q82 1;  3HKZ A;  4Y7N I;  5C3E I;  3I56 1;  3FKI I;  1K9M 1;  3G4S 1;  1KC8 2;  1VQ6 Z;  3BG1 B;  2LEX A;  3D6W A;  3S1M I;  2V45 A;  4A3E I;  2NVQ I;  3D2L A;  1KD1 1;  2KI7 B;  3HOY I;  3CCR Z;  3HOZ I;  3U50 C;  1VQ8 1;  1M1K 1;  3CCQ 1;  2QRC B;  4E2X A;  1Q86 1;  3CXC Z;  1ZB9 A;  1SFO I;  2KPI A;  1JJ2 Y;  2YAD A;  1TFI A;  1X0T A;  2H85 A;  2Y0S A;  3CCV 1;  2WB1 A;  3MZL B;  4MH4 A;  2IZ4 A;  3S1R I;  2OTL Z;  3CPW Z;  4NBH A;  4MD8 A;  2M6N A;  4E30 A;  1S72 Z;  1YHQ 1;  2RPR A;  3G6E 1;  1FDI A;  4A3F I;  1YJW 1;  1QF8 A;  1WZN A;  1YUK A;  3CQZ I;  2DE6 A;  4RV9 A;  4BBS I;  4MXU A;  2RBL A;  2I3C A;  3HOV I;  1YJN 1;  5D1O A;  2AKL A;  2BJO A;  1VQM Z;  3J81 b;  1VQ9 1;  4S1T A;  3H3V J;  1QVG Z;  1Y1V S;  4NFR A;  1Z02 A;  4BY1 I;  3NH5 A;  2PK7 A;  2AYD A;  2K5R A;  1P9N A;  3CC7 1;  3ESW A;  1JWH C;  2VUG A;  4CL1 A;  4A3I I;  1Q82 2;  3CCL Z;  3GCF A;  3IX0 A;  3GTL I;  1VQ8 Z;  3CCE 1;  4E2W A;  4QTU A;  1Q16 A;  3CMA 1;  1X3W A;  3GTJ I;  5LL6 f;  2E2H I;  4A3L I;  3EER A;  1KD1 2;  1TWA I;  2IV2 X;  2QEX 1;  3NDI A;  2QA4 1;  4BY7 I;  3CCS Z;  1M1K 2;  2VPX A;  2OOY B;  3NH4 A;  3HOW I;  1X3Z A;  1Q86 2;  4E2Y A;  4E31 A;  3GTG I;  1Q7Y 1;  2EGT A;  1YJW Z;  2OTJ Z;  2P28 A;  1VQK 1;  1NJI 1;  3RZD I;  3CCM 1;  1KQS Y;  1PFT A;  2V8K A;  4A3K I;  1YJN Z;  1NP6 A;  1Y1W I;  5C4J I;  2VPY A;  1Z03 A;  1VQ9 Z;  2JIQ A;  4RVF A;  1KRL A;  4X6A I;  2VPZ A;  1K8A 1;  5A2Q f;  2QR1 B;  3KIF A;  1QYP A;  4E32 A;  1WJ2 A;  2G2K A;  4NOZ A;  1VQO 1;  1VQL 1;  1RO4 A;  3RZO I;  3FQM A;  5D1O B;  1W2B Z;  1VQ5 1;  5T64 A;  1M90 1;  2YU9 I;  2E2I I;  1WII A;  3M3Y I;  1L1O C;  1ZB8 A;  2GTI A;  4NB8 A;  2R92 I;  2QRE B;  1Q81 1;  3CME 1;  3CMA Z;  3IF8 A;  1AA6 A;  2O53 A;  4NBE A;  1LQL A;  1N8R 1;  1I50 I;  1I6H I;  2QEX Z;  2JR6 A;  2VPW A;  3S2H I;  4MRI A;  3OW2 Y;  3CC4 1;  3GTO I;  4A3D I;  4NBD A;  4A3M I;  1R9T I;  3GTK I;  1YIT 1;  1NUI A;  1VQK Z;  1QVF Z;  1Y1V I;  5D1P A;  2OOX B;  4A93 I;  2K3R A;  2JA7 I;  1RLY A;  3VMI A;  2M48 A;  1VLA A;  1YI2 Z;  2NAP A;  4RVD A;  1Q7Y 2;  2JMO A;  3S1Q I;  3PO2 I;  2QLV B;  1NJI 2;  3HOX I; 
#chains in the Genus database with same CATH homology
 2VUM I;  3G4S Z;  3F3P C;  1VQP 1;  4E2Z A;  3GTP I;  3CCU 1;  1VQO Z;  3S14 I;  3D9X A;  3VMG A;  2F4O A;  2RT9 A;  3G71 1;  1VQ5 Z;  1K8A 2;  4E33 A;  3GTQ I;  4A3B I;  3J80 b;  1USP A;  1K73 1;  4RS4 A;  4RVH A;  1WW9 A;  3CCQ Z;  1K9M 2;  2RHB A;  1ML8 A;  2V8I A;  4HGZ A;  4QTT A;  4MON A;  3CD6 1;  2B63 I;  3CCJ 1;  4Y52 I;  1JJ2 Z;  2QRD B;  2E2J I;  3S15 I;  2WAQ A;  3TE5 B;  3JAM b;  2IZ3 A;  3CCV Z;  2R7Z I;  4MD9 A;  1M90 2;  1YJ9 1;  2DE5 A;  3VMH A;  3CC4 Z;  3K7A I;  3GTM S;  1YHQ Z;  3Q87 A;  3G6E Z;  4NBF A;  3CC2 1;  1TWG I;  3CXC Y;  1YUA A;  1RO0 A;  3PO3 I;  1VQ7 1;  4NBC A;  1YIT Z;  5AN9 F;  2Q51 A;  1RO2 A;  3VTN A;  1RNI A;  3CPW Y;  5T67 A;  1N2F A;  3J81 f;  3BG0 B;  3MON A;  3PO3 S;  3S17 I;  5IT9 b;  3I55 1;  3CCU Z;  4DGL A;  2F4M A;  4NH1 C;  1VQN 1;  2J6A A;  3CC7 Z;  4BXX I;  3G71 Z;  1VQM 1;  2JA6 I;  4MD7 A;  3P5J B;  3J80 f;  2JA5 I;  4NBB A;  1QVG Y;  3CCE Z;  5FLX b;  2PMZ A;  4RVG A;  3CD6 Z;  2JUB A;  4A3C I;  2LFU A;  4NB9 A;  2JA8 I;  3CCJ Z;  3MZK B;  3JAM f;  1TWH I;  1K73 2;  3F3F C;  1YJ9 Z;  2QA4 Z;  3S16 I;  2NVY I;  3CCL 1;  1USP B;  1VQ4 1;  5CM2 M;  3QWU A;  4EWC A;  2GU2 A;  3CC2 Z;  2RIQ A;  3IFU A;  1RQF A;  1VQ7 Z;  3S2D I;  1DL6 A;  2QKD A;  3CCM Z;  1KQS Z;  3GKQ A;  4TNU A;  3HOU I;  2JS4 A;  2VF1 A;  5IP7 I;  3CCS 1;  2OZK A;  1YIJ 1;  4HGY A;  3EED A;  2E9H A;  2OTJ 1;  4AYB A;  5IT9 f;  3LUS A;  3I55 Z;  2Q4Z A;  3M4O I;  3NFZ A;  2ZAE B;  3I07 A;  1VQL Z;  1KC8 1;  3J7A 4;  2GTH A;  1S7M A;  1VQN Z;  2W04 A;  2NVX I;  3S1N I;  5A2Q b;  3GTM I;  5IP9 I;  5FLX f;  2HF1 A;  3CME Z;  3I56 Z;  1VQ6 1;  2P3Y A;  2V8J A;  2O4H A;  3FQQ A;  2LIY A;  1W2B Y;  1K83 I;  3NDJ A;  5T6B A;  4NBA A;  1ZH1 A;  3T4N B;  1VQ4 Z;  3CCR 1;  3OW2 Z;  4BBR I;  1Q81 2;  5C4X I;  2R93 I;  1I3Q I;  3I4M I;  4DQY B;  2NVT I;  3I4N I;  5C44 I;  3VB9 A;  1N8R 2;  4A3G I;  4XX2 A;  2DE7 A;  3KIH A;  3TDH B;  3H0G I;  2OTL 1;  1WCM I;  4DK1 A;  4HH4 A;  1S72 1;  1YIJ Z;  1Z01 A;  3NH8 A;  2PM9 A;  1TWF I;  1QVF Y;  2W03 A;  1VQP Z;  5FLM I;  2R6M A;  4NBG A;  1YI2 1;  2JNY A;  2HU9 A;  4A3J I;  1TWC I;  1Q82 1;  3HKZ A;  4Y7N I;  5C3E I;  3I56 1;  3FKI I;  1K9M 1;  3G4S 1;  1KC8 2;  1VQ6 Z;  3BG1 B;  3D6W A;  3S1M I;  4A3E I;  2NVQ I;  1KD1 1;  2KI7 B;  3HOY I;  3CCR Z;  3HOZ I;  3U50 C;  1VQ8 1;  1M1K 1;  3CCQ 1;  2QRC B;  4E2X A;  1Q86 1;  3CXC Z;  1ZB9 A;  1SFO I;  2KPI A;  1JJ2 Y;  2YAD A;  1TFI A;  1X0T A;  2H85 A;  2Y0S A;  3CCV 1;  2WB1 A;  3MZL B;  4MH4 A;  2IZ4 A;  3S1R I;  2OTL Z;  3CPW Z;  4NBH A;  4MD8 A;  2M6N A;  4E30 A;  1S72 Z;  1YHQ 1;  2RPR A;  3G6E 1;  4A3F I;  1YJW 1;  1QF8 A;  1YUK A;  3CQZ I;  2DE6 A;  4RV9 A;  4BBS I;  4MXU A;  2RBL A;  2I3C A;  3HOV I;  1YJN 1;  5D1O A;  2AKL A;  2BJO A;  1VQM Z;  3J81 b;  1VQ9 1;  4S1T A;  3H3V J;  1QVG Z;  1Y1V S;  4NFR A;  1Z02 A;  4BY1 I;  3NH5 A;  2PK7 A;  2K5R A;  1P9N A;  3CC7 1;  3ESW A;  1JWH C;  2VUG A;  4CL1 A;  4A3I I;  1Q82 2;  3CCL Z;  3GCF A;  3IX0 A;  3GTL I;  1VQ8 Z;  3CCE 1;  4E2W A;  4QTU A;  3CMA 1;  1X3W A;  3GTJ I;  5LL6 f;  2E2H I;  4A3L I;  3EER A;  1KD1 2;  1TWA I;  2QEX 1;  3NDI A;  2QA4 1;  4BY7 I;  3CCS Z;  1M1K 2;  2OOY B;  3NH4 A;  3HOW I;  1X3Z A;  1Q86 2;  4E2Y A;  4E31 A;  3GTG I;  1Q7Y 1;  2EGT A;  1YJW Z;  2OTJ Z;  2P28 A;  1VQK 1;  1NJI 1;  3RZD I;  3CCM 1;  1KQS Y;  1PFT A;  2V8K A;  4A3K I;  1YJN Z;  1NP6 A;  1Y1W I;  5C4J I;  1Z03 A;  1VQ9 Z;  4RVF A;  1KRL A;  4X6A I;  1K8A 1;  5A2Q f;  2QR1 B;  3KIF A;  1QYP A;  4E32 A;  2G2K A;  4NOZ A;  1VQO 1;  1VQL 1;  1RO4 A;  3RZO I;  3FQM A;  5D1O B;  1W2B Z;  1VQ5 1;  5T64 A;  1M90 1;  2YU9 I;  2E2I I;  1WII A;  3M3Y I;  1L1O C;  1ZB8 A;  2GTI A;  4NB8 A;  2R92 I;  2QRE B;  1Q81 1;  3CME 1;  3CMA Z;  3IF8 A;  2O53 A;  4NBE A;  1LQL A;  1N8R 1;  1I50 I;  1I6H I;  2QEX Z;  2JR6 A;  3S2H I;  4MRI A;  3OW2 Y;  3CC4 1;  3GTO I;  4A3D I;  4NBD A;  4A3M I;  1R9T I;  3GTK I;  1YIT 1;  1NUI A;  1VQK Z;  1QVF Z;  1Y1V I;  5D1P A;  2OOX B;  4A93 I;  2K3R A;  2JA7 I;  1RLY A;  3VMI A;  2M48 A;  1VLA A;  1YI2 Z;  4RVD A;  1Q7Y 2;  2JMO A;  3S1Q I;  3PO2 I;  2QLV B;  1NJI 2;  3HOX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...