3CCRZ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation a2488c. density for anisomycin is visible but not included in the model.
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01780 Ribosomal_L37ae Ribosomal L37ae protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ccrZ00
1JJ2Y 3CCSZ 2OTJZ 3I551 1VQ81 1S72Z 3CCQZ 1K8A2 2QEX1 3CC4Z 3CCE1 3CMA1 1Q7Y1 3OW2Z 1VQM1 3CCM1 1YHQZ 3CCVZ 3CC2Z 1KD12 3CCRZ 1KQSZ 1VQO1 3I56Z 1K8A1 3CC71 1VQPZ 1QVGZ 3CCJZ 1VQLZ 1VQ9Z 3CD6Z 1NJI2 1VQN1 1YJNZ 1VQ6Z 1KD11 1VQK1 2OTL1 1YIJZ 1K9M1 1N8R2 1YJW1 1VQ71 1Q862 3G6EZ 1YJ9Z 3CCS1 1YI2Z 1VQ5Z 1Q811 1QVFZ 1S721 3CXCY 1K732 3CCQ1 1W2BZ 1NJI1 3CME1 3I55Z 3G71Z 3CPWZ 1K9M2 1YHQ1 1KC82 2QA41 1Q821 1N8R1 1Q812 3CCR1 1Q861 1VQMZ 3CCLZ 3G4SZ 1JJ2Z 1YITZ 1K731 3CCUZ 1VQP1 1VQ4Z 3CCJ1 1VQL1 3CD61 3OW2Y 1Q822 1KC81 1YJN1 2OTJ1 1M902 1KQSY 1YIJ1 3CC41 1VQ8Z 1VQKZ 3G6E1 2QEXZ 1QVGY 3CCEZ 3CMAZ 1YJWZ 1VQ7Z 3CC21 3CCV1 3CCMZ 3G711 1M901 3I561 3CMEZ 1VQOZ 1M1K2 3CCL1 1VQ91 3G4S1 2QA4Z 1QVFY 3CC7Z 1YIT1 3CCU1 1VQ61 1W2BY 3CXCZ 1VQ41 1VQNZ 3CPWY 1Q7Y2 1VQ51 1YI21 1YJ91 2OTLZ 1M1K1
chains in the Genus database with same CATH superfamily
1I3QI 2V8KA 4XX2A 1WJ2A 3M4OI 4BY7I 2RT9A 2LIYA 3VTNA 3CC4Z 1Q7Y1 4NH1C 4Y7NI 5D1PA 4QTUA 2WAQA 5LL6f 2JR6A 2JUBA 4MD7A 3I4NI 1K8A1 4NBEA 3K7AI 3IR7A 1VQPZ 1YUAA 2P28A 2KPIA 3J80b 1VQ6Z 1YUKA 1Z02A 4E2WA 3IF8A 2RBLA 4MH4A 1YJW1 1Q862 1YJ9Z 3CCS1 1R9TI 3J81f 1QYPA 4DQYB 1K732 3HOWI 2E2HI 3CCQ1 1Z01A 1NJI1 2QRDB 3S14I 4RS4A 5T6BA 2JA5I 1NUIA 1YHQ1 1NP6A 1Q812 2GU2A 2Y0SA 3GTOI 2DE6A 3S1NI 1JJ2Z 4DK1A 5FLMI 1VLAA 3GTLI 1VQ4Z 2DE7A 2BJOA 3OW2Y 1Q822 3TE5B 1ZH1A 3S15I 1SFOI 2YU9I 2ZAEB 1M902 4A3EI 1YIJ1 1FDOA 4NOZA 3CC41 2GTHA 2I3CA 3IX0A 3G6E1 1I6HI 2M6NA 1K83I 3D2LA 3NDJA 1TWFI 3LUSA 3J81b 3CCL1 3G4S1 2VPZA 2Q51A 2W04A 1X3ZA 2OOXB 1TWHI 5IP7I 1VQ61 3CXCZ 2P3YA 1Q7Y2 2E2II 1YJ91 2NVYI 1M1K1 5IP9I 3CCSZ 3CCQZ 1K8A2 2QEX1 1TWGI 2O53A 2JNYA 2HU9A 3U50C 3CCM1 1YHQZ 4E31A 3GCFA 3CCVZ 3CC2Z 2R6MA 3EEDA 4RVGA 4BBRI 1VQO1 1WW9A 4NBAA 1VQ9Z 2RPRA 1NJI2 2JA8I 1L1OC 1VQN1 5T64A 2NVTI 2OTL1 1YIJZ 2V8IA 4E2YA 3PO3I 3G6EZ 1YI2Z 1DL6A 1TWCI 4HGYA 5CM2M 2VPWA 1QVFZ 1RNIA 3EERA 3S17I 2V8JA 3T4NB 2QR1B 2YADA 1K9M2 1Y1WI 2WB1A 3NH4A 1N8R1 3CCR1 1Z03A 4AYBA 3CCLZ 2LEXA 3G4SZ 1RO2A 3S1MI 2JIMA 5C4JI 4A3II 1VQL1 4RVDA 3CD61 1TWAI 3IFUA 1KQSY 3HOUI 3NFZA 3MZLB 1VQKZ 2F4MA 4NBHA 4A3JI 2QEXZ 3BG0B 2M48A 1QVGY 3CCV1 3CC21 2J6AA 1VQ7Z 2H85A 1RO4A 3CCMZ 3G711 4E2ZA 5AN9F 1X0TA 1VQOZ 1M1K2 1USPA 2VPXA 1VQ91 3I4MI 2QA4Z 1YIT1 4BBSI 4MXUA 1W2BY 3PO2I 3HOZI 2AKLA 1VQNZ 3CPWY 1Y1VS 2Q4ZA 3S2DI 1YI21 5A2Qf 2VUGA 2OTLZ 2V45A 4A93I 4X6AI 1RO0A 4A3FI 1N2FA 3CQZI 4NBCA 2JS4A 2JMOA 1USPB 1VQ81 2E7ZA 4A3CI 2KI7B 4RV9A 3NDIA 3OW2Z 3RZOI 4E2XA 2RHBA 3CCRZ 2HF1A 4Y52I 3I56Z 4S1TA 3P5JB 3I07A 4QTTA 2EGTA 3CC71 3S2HI 1AA6A 1VQLZ 1ZB8A 3CD6Z 3VMHA 4HGZA 4MD9A 2B63I 3FKII 1KD11 1VQK1 3S16I 2K3RA 1I50I 1N8R2 1VQ71 1VQ5Z 1Q811 1S721 3I55Z 5A2Qb 3GTMS 2OOYB 3G71Z 3VB9A 4RVHA 3D9XA 3ESWA 3HOXI 2QA41 4EWCA 1Q821 2IZ3A 3GTQI 3F3FC 1VQMZ 4NBGA 4BY1I 3GTMI 1YITZ 2IV2X 5D1OA 4A3KI 3CCJ1 3GTPI 3MZKB 3VMIA 3S1RI 1KC81 1YJN1 5IT9f 2IZ4A 2QRCB 2VPYA 3TDHB 2JIOA 1VQ8Z 2QREB 2QLVB 5C44I 5D1OB 4E32A 1JWHC 4A3GI 2JA6I 3I561 4A3LI 3CMEZ 3FQQA 4MD8A 5C4XI 3JAMf 3CC7Z 3CCU1 1X3WA 2JIPA 4DGLA 1RLYA 3MONA 4NBDA 1ML8A 1VQ51 4NBBA 3QWUA 1JJ2Y 2OTJZ 3Q87A 3I551 1S72Z 2NAPA 1RQFA 1TFIA 2W03A 1WCMI 3CCE1 3CMA1 2QKDA 2V3VA 1LQLA 4MRIA 5IT9b 1Y8CA 1VQM1 3HOVI 4HH4A 1QF8A 4NB8A 2R92I 1KD12 1KQSZ 2OZKA 4CL1A 3M3YI 2K5RA 3NH5A 1QVGZ 3CCJZ 4A3DI 2R93I 1YJNZ 4NB9A 2R7ZI 5FLXf 4MONA 1Y1VI 3KIHA 3JAMb 1K9M1 3BG1B 4E33A 3H3VJ 2GTIA 4RVFA 1S7MA 2JIQA 3HKZA 4TNUA 2F4OA 3CXCY 3S1QI 4A3BI 1W2BZ 3CME1 2JIRA 2VF1A 2E9HA 3CPWZ 1KC82 3RZDI 1Q16A 3NH8A 2G2KA 1Q861 1K731 3CCUZ 1VQP1 3VMGA 2O4HA 1P9NA 5T67A 3F3PC 1FDIA 2PM9A 4E30A 2OTJ1 1QXFA 5C3EI 2PK7A 1SIWA 4A3MI 3FQMA 3GTKI 2VUMI 2RIQA 2NVQI 3D6WA 3CCEZ 3CMAZ 1YJWZ 3H0GI 1PFTA 5FLXb 3J7A4 2NVXI 3GTJI 2LFUA 1WZNA 1M901 3KIFA 1KRLA 2AYDA 3J80f 2E2JI 4NBFA 1QVFY 3GKQA 2PMZA 3HOYI 1ZB9A 1VQ41 2JA7I 2DE5A 4NFRA 3GTGI 1WIIA 3PO3S 4BXXI
chains in the Genus database with same CATH topology
1I3QI 2V8KA 4XX2A 4BY7I 3M4OI 2RT9A 2LIYA 3VTNA 3CC4Z 1Q7Y1 4NH1C 4Y7NI 5D1PA 4QTUA 2WAQA 5LL6f 2JR6A 2JUBA 4MD7A 3I4NI 1K8A1 4NBEA 3K7AI 1VQPZ 1YUAA 2P28A 2KPIA 3J80b 1VQ6Z 1YUKA 1Z02A 4E2WA 3IF8A 2RBLA 4MH4A 1YJW1 1Q862 1YJ9Z 3CCS1 1R9TI 3J81f 1QYPA 4DQYB 1K732 3HOWI 2E2HI 3CCQ1 1Z01A 1NJI1 2QRDB 3S14I 4RS4A 5T6BA 2JA5I 1NUIA 1YHQ1 1NP6A 1Q812 2GU2A 2Y0SA 3GTOI 2DE6A 3S1NI 1JJ2Z 4DK1A 5FLMI 1VLAA 3GTLI 1VQ4Z 2DE7A 2BJOA 3OW2Y 1Q822 3TE5B 1ZH1A 3S15I 1SFOI 2YU9I 2ZAEB 1M902 4A3EI 1YIJ1 4NOZA 3CC41 2GTHA 2I3CA 3IX0A 3G6E1 1I6HI 2M6NA 1K83I 3NDJA 1TWFI 3LUSA 3J81b 3CCL1 3G4S1 2Q51A 2W04A 1X3ZA 2OOXB 1TWHI 5IP7I 1VQ61 3CXCZ 2P3YA 1Q7Y2 2E2II 1YJ91 2NVYI 1M1K1 5IP9I 3CCSZ 3CCQZ 1K8A2 2QEX1 1TWGI 2O53A 2JNYA 2HU9A 3U50C 3CCM1 1YHQZ 4E31A 3GCFA 3CCVZ 3CC2Z 2R6MA 3EEDA 4RVGA 4BBRI 1VQO1 1WW9A 4NBAA 1VQ9Z 2RPRA 1NJI2 2JA8I 1L1OC 1VQN1 5T64A 2NVTI 2OTL1 1YIJZ 2V8IA 4E2YA 3PO3I 3G6EZ 1YI2Z 1DL6A 1TWCI 4HGYA 5CM2M 1QVFZ 1RNIA 3EERA 3S17I 2V8JA 3T4NB 2QR1B 2YADA 1K9M2 1Y1WI 2WB1A 3NH4A 1N8R1 3CCR1 1Z03A 4AYBA 3CCLZ 3G4SZ 1RO2A 3S1MI 5C4JI 4A3II 1VQL1 4RVDA 3CD61 1TWAI 3IFUA 1KQSY 3HOUI 3NFZA 3MZLB 1VQKZ 2F4MA 4NBHA 4A3JI 2QEXZ 3BG0B 2M48A 1QVGY 3CCV1 3CC21 2J6AA 1VQ7Z 2H85A 1RO4A 3CCMZ 3G711 4E2ZA 5AN9F 1X0TA 1VQOZ 1M1K2 1USPA 1VQ91 3I4MI 2QA4Z 1YIT1 4BBSI 4MXUA 1W2BY 3PO2I 3HOZI 2AKLA 1VQNZ 3CPWY 1Y1VS 2Q4ZA 3S2DI 1YI21 5A2Qf 2VUGA 2OTLZ 4A93I 4X6AI 1RO0A 4A3FI 1N2FA 3CQZI 4NBCA 2JS4A 2JMOA 1USPB 1VQ81 4A3CI 2KI7B 4RV9A 3NDIA 3OW2Z 3RZOI 4E2XA 2RHBA 3CCRZ 2HF1A 4Y52I 3I56Z 4S1TA 3P5JB 3I07A 4QTTA 2EGTA 3CC71 3S2HI 1VQLZ 1ZB8A 3CD6Z 3VMHA 4HGZA 4MD9A 2B63I 3FKII 1KD11 1VQK1 3S16I 2K3RA 1I50I 1N8R2 1VQ71 1VQ5Z 1Q811 1S721 3I55Z 5A2Qb 3GTMS 2OOYB 3G71Z 3VB9A 4RVHA 3D9XA 3ESWA 3HOXI 2QA41 4EWCA 1Q821 2IZ3A 3GTQI 3F3FC 1VQMZ 4NBGA 4BY1I 3GTMI 1YITZ 5D1OA 4A3KI 3CCJ1 3GTPI 3MZKB 3VMIA 3S1RI 1KC81 1YJN1 5IT9f 2IZ4A 2QRCB 3TDHB 1VQ8Z 2QREB 2QLVB 5C44I 5D1OB 4E32A 1JWHC 4A3GI 2JA6I 3I561 4A3LI 3CMEZ 3FQQA 4MD8A 5C4XI 3JAMf 3CC7Z 3CCU1 1X3WA 4DGLA 1RLYA 3MONA 4NBDA 1ML8A 1VQ51 4NBBA 3QWUA 1JJ2Y 2OTJZ 3Q87A 3I551 1S72Z 1RQFA 1TFIA 2W03A 1WCMI 3CCE1 3CMA1 2QKDA 1LQLA 4MRIA 5IT9b 1VQM1 3HOVI 4HH4A 1QF8A 4NB8A 2R92I 1KD12 1KQSZ 2OZKA 4CL1A 3M3YI 2K5RA 3NH5A 1QVGZ 3CCJZ 4A3DI 2R93I 1YJNZ 4NB9A 2R7ZI 5FLXf 4MONA 1Y1VI 3KIHA 3JAMb 1K9M1 3BG1B 4E33A 3H3VJ 2GTIA 4RVFA 1S7MA 3HKZA 4TNUA 2F4OA 3CXCY 3S1QI 4A3BI 1W2BZ 3CME1 2VF1A 2E9HA 3CPWZ 1KC82 3RZDI 3NH8A 2G2KA 1Q861 1K731 3CCUZ 1VQP1 3VMGA 2O4HA 1P9NA 5T67A 3F3PC 2PM9A 4E30A 2OTJ1 5C3EI 2PK7A 4A3MI 3FQMA 3GTKI 2VUMI 2RIQA 2NVQI 3D6WA 3CCEZ 3CMAZ 1YJWZ 3H0GI 1PFTA 5FLXb 3J7A4 2NVXI 3GTJI 2LFUA 1M901 3KIFA 1KRLA 3J80f 2E2JI 4NBFA 1QVFY 3GKQA 2PMZA 3HOYI 1ZB9A 1VQ41 2JA7I 2DE5A 4NFRA 3GTGI 1WIIA 3PO3S 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 Y;  3CCS Z;  2OTJ Z;  3I55 1;  1VQ8 1;  1S72 Z;  3CCQ Z;  1K8A 2;  2QEX 1;  3CC4 Z;  3CCE 1;  3CMA 1;  1Q7Y 1;  3OW2 Z;  1VQM 1;  3CCM 1;  1YHQ Z;  3CCV Z;  3CC2 Z;  1KD1 2;  3CCR Z;  1KQS Z;  1VQO 1;  3I56 Z;  1K8A 1;  3CC7 1;  1VQP Z;  1QVG Z;  3CCJ Z;  1VQL Z;  1VQ9 Z;  3CD6 Z;  1NJI 2;  1VQN 1;  1YJN Z;  1VQ6 Z;  1KD1 1;  1VQK 1;  2OTL 1;  1YIJ Z;  1K9M 1;  1N8R 2;  1YJW 1;  1VQ7 1;  1Q86 2;  3G6E Z;  1YJ9 Z;  3CCS 1;  1YI2 Z;  1VQ5 Z;  1Q81 1;  1QVF Z;  1S72 1;  3CXC Y;  1K73 2;  3CCQ 1;  1W2B Z;  1NJI 1;  3CME 1;  3I55 Z;  3G71 Z;  3CPW Z;  1K9M 2;  1YHQ 1;  1KC8 2;  2QA4 1;  1Q82 1;  1N8R 1;  1Q81 2;  3CCR 1;  1Q86 1;  1VQM Z;  3CCL Z;  3G4S Z;  1JJ2 Z;  1YIT Z;  1K73 1;  3CCU Z;  1VQP 1;  1VQ4 Z;  3CCJ 1;  1VQL 1;  3CD6 1;  3OW2 Y;  1Q82 2;  1KC8 1;  1YJN 1;  2OTJ 1;  1M90 2;  1KQS Y;  1YIJ 1;  3CC4 1;  1VQ8 Z;  1VQK Z;  3G6E 1;  2QEX Z;  1QVG Y;  3CCE Z;  3CMA Z;  1YJW Z;  1VQ7 Z;  3CC2 1;  3CCV 1;  3CCM Z;  3G71 1;  1M90 1;  3I56 1;  3CME Z;  1VQO Z;  1M1K 2;  3CCL 1;  1VQ9 1;  3G4S 1;  2QA4 Z;  1QVF Y;  3CC7 Z;  1YIT 1;  3CCU 1;  1VQ6 1;  1W2B Y;  3CXC Z;  1VQ4 1;  1VQN Z;  3CPW Y;  1Q7Y 2;  1VQ5 1;  1YI2 1;  1YJ9 1;  2OTL Z;  1M1K 1; 
#chains in the Genus database with same CATH topology
 1I3Q I;  2V8K A;  4XX2 A;  1WJ2 A;  3M4O I;  4BY7 I;  2RT9 A;  2LIY A;  3VTN A;  3CC4 Z;  1Q7Y 1;  4NH1 C;  4Y7N I;  5D1P A;  4QTU A;  2WAQ A;  5LL6 f;  2JR6 A;  2JUB A;  4MD7 A;  3I4N I;  1K8A 1;  4NBE A;  3K7A I;  3IR7 A;  1VQP Z;  1YUA A;  2P28 A;  2KPI A;  3J80 b;  1VQ6 Z;  1YUK A;  1Z02 A;  4E2W A;  3IF8 A;  2RBL A;  4MH4 A;  1YJW 1;  1Q86 2;  1YJ9 Z;  3CCS 1;  1R9T I;  3J81 f;  1QYP A;  4DQY B;  1K73 2;  3HOW I;  2E2H I;  3CCQ 1;  1Z01 A;  1NJI 1;  2QRD B;  3S14 I;  4RS4 A;  5T6B A;  2JA5 I;  1NUI A;  1YHQ 1;  1NP6 A;  1Q81 2;  2GU2 A;  2Y0S A;  3GTO I;  2DE6 A;  3S1N I;  1JJ2 Z;  4DK1 A;  5FLM I;  1VLA A;  3GTL I;  1VQ4 Z;  2DE7 A;  2BJO A;  3OW2 Y;  1Q82 2;  3TE5 B;  1ZH1 A;  3S15 I;  1SFO I;  2YU9 I;  2ZAE B;  1M90 2;  4A3E I;  1YIJ 1;  1FDO A;  4NOZ A;  3CC4 1;  2GTH A;  2I3C A;  3IX0 A;  3G6E 1;  1I6H I;  2M6N A;  1K83 I;  3D2L A;  3NDJ A;  1TWF I;  3LUS A;  3J81 b;  3CCL 1;  3G4S 1;  2VPZ A;  2Q51 A;  2W04 A;  1X3Z A;  2OOX B;  1TWH I;  5IP7 I;  1VQ6 1;  3CXC Z;  2P3Y A;  1Q7Y 2;  2E2I I;  1YJ9 1;  2NVY I;  1M1K 1;  5IP9 I;  3CCS Z;  3CCQ Z;  1K8A 2;  2QEX 1;  1TWG I;  2O53 A;  2JNY A;  2HU9 A;  3U50 C;  3CCM 1;  1YHQ Z;  4E31 A;  3GCF A;  3CCV Z;  3CC2 Z;  2R6M A;  3EED A;  4RVG A;  4BBR I;  1VQO 1;  1WW9 A;  4NBA A;  1VQ9 Z;  2RPR A;  1NJI 2;  2JA8 I;  1L1O C;  1VQN 1;  5T64 A;  2NVT I;  2OTL 1;  1YIJ Z;  2V8I A;  4E2Y A;  3PO3 I;  3G6E Z;  1YI2 Z;  1DL6 A;  1TWC I;  4HGY A;  5CM2 M;  2VPW A;  1QVF Z;  1RNI A;  3EER A;  3S17 I;  2V8J A;  3T4N B;  2QR1 B;  2YAD A;  1K9M 2;  1Y1W I;  2WB1 A;  3NH4 A;  1N8R 1;  3CCR 1;  1Z03 A;  4AYB A;  3CCL Z;  2LEX A;  3G4S Z;  1RO2 A;  3S1M I;  2JIM A;  5C4J I;  4A3I I;  1VQL 1;  4RVD A;  3CD6 1;  1TWA I;  3IFU A;  1KQS Y;  3HOU I;  3NFZ A;  3MZL B;  1VQK Z;  2F4M A;  4NBH A;  4A3J I;  2QEX Z;  3BG0 B;  2M48 A;  1QVG Y;  3CCV 1;  3CC2 1;  2J6A A;  1VQ7 Z;  2H85 A;  1RO4 A;  3CCM Z;  3G71 1;  4E2Z A;  5AN9 F;  1X0T A;  1VQO Z;  1M1K 2;  1USP A;  2VPX A;  1VQ9 1;  3I4M I;  2QA4 Z;  1YIT 1;  4BBS I;  4MXU A;  1W2B Y;  3PO2 I;  3HOZ I;  2AKL A;  1VQN Z;  3CPW Y;  1Y1V S;  2Q4Z A;  3S2D I;  1YI2 1;  5A2Q f;  2VUG A;  2OTL Z;  2V45 A;  4A93 I;  4X6A I;  1RO0 A;  4A3F I;  1N2F A;  3CQZ I;  4NBC A;  2JS4 A;  2JMO A;  1USP B;  1VQ8 1;  2E7Z A;  4A3C I;  2KI7 B;  4RV9 A;  3NDI A;  3OW2 Z;  3RZO I;  4E2X A;  2RHB A;  3CCR Z;  2HF1 A;  4Y52 I;  3I56 Z;  4S1T A;  3P5J B;  3I07 A;  4QTT A;  2EGT A;  3CC7 1;  3S2H I;  1AA6 A;  1VQL Z;  1ZB8 A;  3CD6 Z;  3VMH A;  4HGZ A;  4MD9 A;  2B63 I;  3FKI I;  1KD1 1;  1VQK 1;  3S16 I;  2K3R A;  1I50 I;  1N8R 2;  1VQ7 1;  1VQ5 Z;  1Q81 1;  1S72 1;  3I55 Z;  5A2Q b;  3GTM S;  2OOY B;  3G71 Z;  3VB9 A;  4RVH A;  3D9X A;  3ESW A;  3HOX I;  2QA4 1;  4EWC A;  1Q82 1;  2IZ3 A;  3GTQ I;  3F3F C;  1VQM Z;  4NBG A;  4BY1 I;  3GTM I;  1YIT Z;  2IV2 X;  5D1O A;  4A3K I;  3CCJ 1;  3GTP I;  3MZK B;  3VMI A;  3S1R I;  1KC8 1;  1YJN 1;  5IT9 f;  2IZ4 A;  2QRC B;  2VPY A;  3TDH B;  2JIO A;  1VQ8 Z;  2QRE B;  2QLV B;  5C44 I;  5D1O B;  4E32 A;  1JWH C;  4A3G I;  2JA6 I;  3I56 1;  4A3L I;  3CME Z;  3FQQ A;  4MD8 A;  5C4X I;  3JAM f;  3CC7 Z;  3CCU 1;  1X3W A;  2JIP A;  4DGL A;  1RLY A;  3MON A;  4NBD A;  1ML8 A;  1VQ5 1;  4NBB A;  3QWU A;  1JJ2 Y;  2OTJ Z;  3Q87 A;  3I55 1;  1S72 Z;  2NAP A;  1RQF A;  1TFI A;  2W03 A;  1WCM I;  3CCE 1;  3CMA 1;  2QKD A;  2V3V A;  1LQL A;  4MRI A;  5IT9 b;  1Y8C A;  1VQM 1;  3HOV I;  4HH4 A;  1QF8 A;  4NB8 A;  2R92 I;  1KD1 2;  1KQS Z;  2OZK A;  4CL1 A;  3M3Y I;  2K5R A;  3NH5 A;  1QVG Z;  3CCJ Z;  4A3D I;  2R93 I;  1YJN Z;  4NB9 A;  2R7Z I;  5FLX f;  4MON A;  1Y1V I;  3KIH A;  3JAM b;  1K9M 1;  3BG1 B;  4E33 A;  3H3V J;  2GTI A;  4RVF A;  1S7M A;  2JIQ A;  3HKZ A;  4TNU A;  2F4O A;  3CXC Y;  3S1Q I;  4A3B I;  1W2B Z;  3CME 1;  2JIR A;  2VF1 A;  2E9H A;  3CPW Z;  1KC8 2;  3RZD I;  1Q16 A;  3NH8 A;  2G2K A;  1Q86 1;  1K73 1;  3CCU Z;  1VQP 1;  3VMG A;  2O4H A;  1P9N A;  5T67 A;  3F3P C;  1FDI A;  2PM9 A;  4E30 A;  2OTJ 1;  1QXF A;  5C3E I;  2PK7 A;  1SIW A;  4A3M I;  3FQM A;  3GTK I;  2VUM I;  2RIQ A;  2NVQ I;  3D6W A;  3CCE Z;  3CMA Z;  1YJW Z;  3H0G I;  1PFT A;  5FLX b;  3J7A 4;  2NVX I;  3GTJ I;  2LFU A;  1WZN A;  1M90 1;  3KIF A;  1KRL A;  2AYD A;  3J80 f;  2E2J I;  4NBF A;  1QVF Y;  3GKQ A;  2PMZ A;  3HOY I;  1ZB9 A;  1VQ4 1;  2JA7 I;  2DE5 A;  4NFR A;  3GTG I;  1WII A;  3PO3 S;  4BXX I; 
#chains in the Genus database with same CATH homology
 1I3Q I;  2V8K A;  4XX2 A;  4BY7 I;  3M4O I;  2RT9 A;  2LIY A;  3VTN A;  3CC4 Z;  1Q7Y 1;  4NH1 C;  4Y7N I;  5D1P A;  4QTU A;  2WAQ A;  5LL6 f;  2JR6 A;  2JUB A;  4MD7 A;  3I4N I;  1K8A 1;  4NBE A;  3K7A I;  1VQP Z;  1YUA A;  2P28 A;  2KPI A;  3J80 b;  1VQ6 Z;  1YUK A;  1Z02 A;  4E2W A;  3IF8 A;  2RBL A;  4MH4 A;  1YJW 1;  1Q86 2;  1YJ9 Z;  3CCS 1;  1R9T I;  3J81 f;  1QYP A;  4DQY B;  1K73 2;  3HOW I;  2E2H I;  3CCQ 1;  1Z01 A;  1NJI 1;  2QRD B;  3S14 I;  4RS4 A;  5T6B A;  2JA5 I;  1NUI A;  1YHQ 1;  1NP6 A;  1Q81 2;  2GU2 A;  2Y0S A;  3GTO I;  2DE6 A;  3S1N I;  1JJ2 Z;  4DK1 A;  5FLM I;  1VLA A;  3GTL I;  1VQ4 Z;  2DE7 A;  2BJO A;  3OW2 Y;  1Q82 2;  3TE5 B;  1ZH1 A;  3S15 I;  1SFO I;  2YU9 I;  2ZAE B;  1M90 2;  4A3E I;  1YIJ 1;  4NOZ A;  3CC4 1;  2GTH A;  2I3C A;  3IX0 A;  3G6E 1;  1I6H I;  2M6N A;  1K83 I;  3NDJ A;  1TWF I;  3LUS A;  3J81 b;  3CCL 1;  3G4S 1;  2Q51 A;  2W04 A;  1X3Z A;  2OOX B;  1TWH I;  5IP7 I;  1VQ6 1;  3CXC Z;  2P3Y A;  1Q7Y 2;  2E2I I;  1YJ9 1;  2NVY I;  1M1K 1;  5IP9 I;  3CCS Z;  3CCQ Z;  1K8A 2;  2QEX 1;  1TWG I;  2O53 A;  2JNY A;  2HU9 A;  3U50 C;  3CCM 1;  1YHQ Z;  4E31 A;  3GCF A;  3CCV Z;  3CC2 Z;  2R6M A;  3EED A;  4RVG A;  4BBR I;  1VQO 1;  1WW9 A;  4NBA A;  1VQ9 Z;  2RPR A;  1NJI 2;  2JA8 I;  1L1O C;  1VQN 1;  5T64 A;  2NVT I;  2OTL 1;  1YIJ Z;  2V8I A;  4E2Y A;  3PO3 I;  3G6E Z;  1YI2 Z;  1DL6 A;  1TWC I;  4HGY A;  5CM2 M;  1QVF Z;  1RNI A;  3EER A;  3S17 I;  2V8J A;  3T4N B;  2QR1 B;  2YAD A;  1K9M 2;  1Y1W I;  2WB1 A;  3NH4 A;  1N8R 1;  3CCR 1;  1Z03 A;  4AYB A;  3CCL Z;  3G4S Z;  1RO2 A;  3S1M I;  5C4J I;  4A3I I;  1VQL 1;  4RVD A;  3CD6 1;  1TWA I;  3IFU A;  1KQS Y;  3HOU I;  3NFZ A;  3MZL B;  1VQK Z;  2F4M A;  4NBH A;  4A3J I;  2QEX Z;  3BG0 B;  2M48 A;  1QVG Y;  3CCV 1;  3CC2 1;  2J6A A;  1VQ7 Z;  2H85 A;  1RO4 A;  3CCM Z;  3G71 1;  4E2Z A;  5AN9 F;  1X0T A;  1VQO Z;  1M1K 2;  1USP A;  1VQ9 1;  3I4M I;  2QA4 Z;  1YIT 1;  4BBS I;  4MXU A;  1W2B Y;  3PO2 I;  3HOZ I;  2AKL A;  1VQN Z;  3CPW Y;  1Y1V S;  2Q4Z A;  3S2D I;  1YI2 1;  5A2Q f;  2VUG A;  2OTL Z;  4A93 I;  4X6A I;  1RO0 A;  4A3F I;  1N2F A;  3CQZ I;  4NBC A;  2JS4 A;  2JMO A;  1USP B;  1VQ8 1;  4A3C I;  2KI7 B;  4RV9 A;  3NDI A;  3OW2 Z;  3RZO I;  4E2X A;  2RHB A;  3CCR Z;  2HF1 A;  4Y52 I;  3I56 Z;  4S1T A;  3P5J B;  3I07 A;  4QTT A;  2EGT A;  3CC7 1;  3S2H I;  1VQL Z;  1ZB8 A;  3CD6 Z;  3VMH A;  4HGZ A;  4MD9 A;  2B63 I;  3FKI I;  1KD1 1;  1VQK 1;  3S16 I;  2K3R A;  1I50 I;  1N8R 2;  1VQ7 1;  1VQ5 Z;  1Q81 1;  1S72 1;  3I55 Z;  5A2Q b;  3GTM S;  2OOY B;  3G71 Z;  3VB9 A;  4RVH A;  3D9X A;  3ESW A;  3HOX I;  2QA4 1;  4EWC A;  1Q82 1;  2IZ3 A;  3GTQ I;  3F3F C;  1VQM Z;  4NBG A;  4BY1 I;  3GTM I;  1YIT Z;  5D1O A;  4A3K I;  3CCJ 1;  3GTP I;  3MZK B;  3VMI A;  3S1R I;  1KC8 1;  1YJN 1;  5IT9 f;  2IZ4 A;  2QRC B;  3TDH B;  1VQ8 Z;  2QRE B;  2QLV B;  5C44 I;  5D1O B;  4E32 A;  1JWH C;  4A3G I;  2JA6 I;  3I56 1;  4A3L I;  3CME Z;  3FQQ A;  4MD8 A;  5C4X I;  3JAM f;  3CC7 Z;  3CCU 1;  1X3W A;  4DGL A;  1RLY A;  3MON A;  4NBD A;  1ML8 A;  1VQ5 1;  4NBB A;  3QWU A;  1JJ2 Y;  2OTJ Z;  3Q87 A;  3I55 1;  1S72 Z;  1RQF A;  1TFI A;  2W03 A;  1WCM I;  3CCE 1;  3CMA 1;  2QKD A;  1LQL A;  4MRI A;  5IT9 b;  1VQM 1;  3HOV I;  4HH4 A;  1QF8 A;  4NB8 A;  2R92 I;  1KD1 2;  1KQS Z;  2OZK A;  4CL1 A;  3M3Y I;  2K5R A;  3NH5 A;  1QVG Z;  3CCJ Z;  4A3D I;  2R93 I;  1YJN Z;  4NB9 A;  2R7Z I;  5FLX f;  4MON A;  1Y1V I;  3KIH A;  3JAM b;  1K9M 1;  3BG1 B;  4E33 A;  3H3V J;  2GTI A;  4RVF A;  1S7M A;  3HKZ A;  4TNU A;  2F4O A;  3CXC Y;  3S1Q I;  4A3B I;  1W2B Z;  3CME 1;  2VF1 A;  2E9H A;  3CPW Z;  1KC8 2;  3RZD I;  3NH8 A;  2G2K A;  1Q86 1;  1K73 1;  3CCU Z;  1VQP 1;  3VMG A;  2O4H A;  1P9N A;  5T67 A;  3F3P C;  2PM9 A;  4E30 A;  2OTJ 1;  5C3E I;  2PK7 A;  4A3M I;  3FQM A;  3GTK I;  2VUM I;  2RIQ A;  2NVQ I;  3D6W A;  3CCE Z;  3CMA Z;  1YJW Z;  3H0G I;  1PFT A;  5FLX b;  3J7A 4;  2NVX I;  3GTJ I;  2LFU A;  1M90 1;  3KIF A;  1KRL A;  3J80 f;  2E2J I;  4NBF A;  1QVF Y;  3GKQ A;  2PMZ A;  3HOY I;  1ZB9 A;  1VQ4 1;  2JA7 I;  2DE5 A;  4NFR A;  3GTG I;  1WII A;  3PO3 S;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...