1Y1VS

Refined rna polymerase ii-tfiis complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
174
structure length
174
Chain Sequence
NDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 8
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vS01
2HF1A 1I3QI 4A3FI 3HOUI 3S1MI 1N2FA 2R7ZI 4BBSI 2J6AA 4NBCA 3EERA 4A3GI 1RLYA 4A3DI 2NVXI 4A3JI 3GTQI 1I50I 4QTUA 2YU9I 3S16I 4Y52I 2P3YA 3VMGA 3S2DI 1ML8A 2JS4A 5C4JI 1R9TI 4BXXI 2NVYI 4A3MI 4NBAA 2R93I 3U50C 3S17I 2E2JI 4Y7NI 4A3CI 2DE7A 2JR6A 1NUIA 4BBRI 5IP9I 2R92I 3I4MI 3HOZI 3GTMI 5C4XI 5IP7I 2E2II 1I6HI 3VMIA 4A3KI 3S1NI 2DE6A 1Y1WI 4NOZA 4NBEA 1DL6A 1X3ZA 1ZB9A 1TWHI 3FKII 4A3LI 1K83I 4X6AI 3LUSA 1L1OC 3GTPI 1TFIA 2AKLA 2E2HI 2DE5A 1RO4A 3PO3S 1WW9A 3CQZI 2BJOA 4NBGA 1USPB 1QYPA 3HOYI 2KPIA 4A3II 4BY1I 3I4NI 3PO3I 1ZB8A 3RZDI 2JA8I 2JA7I 3PO2I 2VUMI 1TWAI 4NB8A 5C44I 4A3BI 2NVQI 3S14I 4A3EI 4A93I 2JNYA 2PK7A 4NBDA 3Q87A 3GKQA 3HOXI 1TWCI 5CM2M 3VMHA 3GTGI 3GTKI 1PFTA 2F4OA 3M4OI 3HOVI 4NBBA 3GTLI 5C3EI 1VLAA 3VB9A 1Y1VS 4MH4A 3H0GI 4NBHA 1X3WA 3ESWA 4QTTA 3S1RI 1SFOI 3I07A 1TWGI 3S2HI 1Y1VI 1LQLA 2JA5I 3H3VJ 1USPA 2K5RA 3RZOI 1TWFI 2F4MA 3GTOI 3GTJI 2JA6I 4NB9A 1WCMI 5FLMI 2RBLA 4BY7I 3S1QI 3K7AI 3HOWI 2NVTI 4XX2A 2B63I 3S15I 4NBFA 3D6WA 3M3YI 3GCFA 1YUAA 3GTMS
chains in the Genus database with same CATH superfamily
2HU9A 3FQQA 2V8KA 4MONA 1VQ51 2E7ZA 3CC2Z 2V8IA 3MONA 2RPRA 2VPZA 2WAQA 1Q822 2W03A 2RT9A 4RVDA 1VQO1 2YU9I 2P3YA 4E30A 2JS4A 1R9TI 4BXXI 2NVYI 5LL6f 3CCQ1 4NBAA 3G6EZ 3S17I 4Y7NI 2DE7A 2JR6A 4BBRI 5IP9I 3I4MI 3HOZI 3GTMI 1YIT1 4AYBA 2VPXA 1VQOZ 1Q862 3QWUA 1I6HI 2OTL1 1K8A1 3S1NI 2DE6A 3OW2Y 2QA41 4NOZA 2M6NA 1ZB9A 2QREB 1VQ9Z 1N8R2 4X6AI 4HGYA 2JIQA 1M1K2 5T6BA 1YITZ 1YJN1 3NH4A 2AKLA 2E2HI 3PO3S 3CQZI 3CC7Z 2QA4Z 2GU2A 2BJOA 3J80f 3NH8A 1YHQ1 1VQ81 3CC4Z 3CCM1 4BY1I 3PO3I 3F3FC 2VF1A 1ZB8A 3RZDI 3IX0A 1TWAI 3CD61 3S14I 1QVFZ 4A93I 2PK7A 2VUGA 1Q812 3I56Z 3GKQA 1VQ8Z 1TWCI 5A2Qf 3NDJA 3CXCY 1YIJ1 3GTGI 3GTKI 1PFTA 2F4OA 3M4OI 1JWHC 3GTLI 1VLAA 3FQMA 3S1RI 1VQL1 1M902 3I07A 1YIJZ 2VPYA 2ZAEB 1Z01A 1USPA 3I55Z 3CPWZ 3KIHA 1AA6A 1VQLZ 1FDIA 3CCRZ 3K7AI 2JIPA 4EWCA 1S721 3F3PC 4MXUA 1X0TA 1I3QI 1SIWA 1K731 5FLXf 1S72Z 2GTHA 4BBSI 4A3GI 1KQSZ 2NVXI 2EGTA 2W04A 2IZ4A 3T4NB 2Q4ZA 3S16I 3VMGA 3S2DI 3CCS1 5C4JI 2LEXA 3G71Z 1VQ7Z 2R93I 1WZNA 2E2JI 5T64A 2IZ3A 2R92I 2Q51A 2M48A 3CCEZ 2QRDB 3VMIA 3JAMf 4A3KI 1Q821 3CXCZ 1Y1WI 1NP6A 4NBEA 2OTJ1 1VQM1 1Q16A 5D1PA 3FKII 4HH4A 5T67A 4S1TA 1VQ5Z 3CPWY 3GTPI 2PMZA 3BG0B 3J81f 1Q861 4A3II 4MD7A 2H85A 3PO2I 3P5JB 3KIFA 1RO2A 3J80b 3CME1 1YI21 1N8R1 4A3EI 1QXFA 2JNYA 4NBDA 3CCQZ 1M1K1 3Q87A 3HOXI 3VMHA 3CCV1 4E32A 3HOVI 2IV2X 1KQSY 3VB9A 2OTLZ 1Y1VS 4E2WA 4QTTA 1YJ91 1VQN1 1SFOI 2NAPA 1TWGI 2R6MA 1Q7Y1 4RVGA 1Y1VI 4MRIA 4NH1C 4E31A 1LQLA 2JA5I 1YJNZ 3H3VJ 3RZOI 1KRLA 1Q811 1TWFI 2RHBA 2JA6I 4RVHA 2JIMA 4NB9A 2JIRA 1RQFA 2RBLA 1K9M2 1JJ2Z 1YJW1 1YHQZ 3CCMZ 3HOWI 3NFZA 1VQP1 2O53A 1QF8A 4NBFA 3M3YI 1M901 2V8JA 1YUAA 2HF1A 3CD6Z 3S1MI 5D1OA 4RV9A 1Z03A 3NDIA 1VQK1 2J6AA 4NBCA 2QEX1 3EERA 1WJ2A 1RLYA 2V45A 3G4S1 3CMA1 4A3DI 1KD12 4A3JI 3GTQI 3VTNA 3IF8A 5FLXb 4Y52I 3TE5B 5IT9b 2VPWA 2OZKA 2LFUA 3MZLB 4A3MI 3U50C 2QLVB 1NUIA 1NJI2 2WB1A 5C4XI 2E2II 4E2XA 3J7A4 2YADA 1TWHI 4A3LI 4DK1A 3LUSA 3MZKB 1L1OC 3JAMb 1RO0A 1Y8CA 3EEDA 3CCL1 5D1OB 1JJ2Y 2JIOA 1VQ61 1USPB 1QYPA 1W2BY 3HOYI 3J81b 4MD9A 2RIQA 4NFRA 2VUMI 3CCLZ 3CCSZ 5C44I 1KC82 4HGZA 5CM2M 3CC21 1S7MA 3IFUA 2GTIA 3CCJ1 1YUKA 4MH4A 2AYDA 4NBHA 4MD8A 3HKZA 2OTJZ 1VQMZ 2I3CA 3S2HI 3CCJZ 4TNUA 3D2LA 2Y0SA 1ZH1A 1Z02A 3G6E1 3GTOI 3GTJI 3CCU1 3S1QI 1FDOA 4DGLA 2NVTI 4XX2A 1VQ41 2B63I 5AN9F 3GCFA 3GTMS 3CMEZ 1YI2Z 3CCUZ 4A3FI 3HOUI 1VQ91 2G2KA 1N2FA 2QRCB 5A2Qb 3CCVZ 1VQ4Z 2R7ZI 4RVFA 3CC71 4RS4A 1K9M1 1YJ9Z 2P28A 1K8A2 1VQNZ 3CC41 2O4HA 1I50I 4QTUA 1W2BZ 1ML8A 2OOXB 2PM9A 2E9HA 1QVGZ 2JMOA 3I561 4A3CI 3TDHB 1YJWZ 1VQPZ 1Q7Y2 5IP7I 1KD11 3BG1B 1DL6A 1X3ZA 2LIYA 4E2YA 1K83I 1TFIA 3I551 2DE5A 1RO4A 3NH5A 1VQKZ 1WW9A 2JUBA 2QEXZ 2K3RA 4NBGA 1NJI1 4DQYB 3G4SZ 3CCR1 3CMAZ 2KPIA 3I4NI 1RNIA 2JA8I 2KI7B 2QKDA 2JA7I 4NB8A 3IR7A 2NVQI 4A3BI 2QR1B 2OOYB 4NBBA 5C3EI 3H0GI 1X3WA 3ESWA 3OW2Z 1QVGY 1K732 2K5RA 5IT9f 1KC81 3G711 2F4MA 4CL1A 1VQ71 1WCMI 5FLMI 1VQ6Z 4BY7I 1WIIA 1P9NA 1QVFY 4E33A 3S15I 3CCE1 2V3VA 4E2ZA 3D9XA 3D6WA
chains in the Genus database with same CATH topology
2HU9A 3FQQA 2V8KA 4MONA 1VQ51 3CC2Z 2V8IA 3MONA 2RPRA 2WAQA 1Q822 2W03A 2RT9A 4RVDA 1VQO1 2YU9I 2P3YA 4E30A 2JS4A 1R9TI 4BXXI 2NVYI 5LL6f 3CCQ1 4NBAA 3G6EZ 3S17I 4Y7NI 2DE7A 2JR6A 4BBRI 5IP9I 3I4MI 3HOZI 3GTMI 1YIT1 4AYBA 1VQOZ 1Q862 3QWUA 1I6HI 2OTL1 1K8A1 3S1NI 2DE6A 3OW2Y 2QA41 4NOZA 2M6NA 1ZB9A 2QREB 1VQ9Z 1N8R2 4X6AI 4HGYA 1M1K2 5T6BA 1YITZ 1YJN1 3NH4A 2AKLA 2E2HI 3PO3S 3CQZI 3CC7Z 2QA4Z 2GU2A 2BJOA 3J80f 3NH8A 1YHQ1 1VQ81 3CC4Z 3CCM1 4BY1I 3PO3I 3F3FC 2VF1A 1ZB8A 3RZDI 3IX0A 1TWAI 3CD61 3S14I 1QVFZ 4A93I 2PK7A 2VUGA 1Q812 3I56Z 3GKQA 1VQ8Z 1TWCI 5A2Qf 3NDJA 3CXCY 1YIJ1 3GTGI 3GTKI 1PFTA 2F4OA 3M4OI 1JWHC 3GTLI 1VLAA 3FQMA 3S1RI 1VQL1 1M902 3I07A 1YIJZ 2ZAEB 1Z01A 1USPA 3I55Z 3CPWZ 3KIHA 1VQLZ 3CCRZ 3K7AI 4EWCA 1S721 3F3PC 4MXUA 1X0TA 1I3QI 1K731 5FLXf 1S72Z 2GTHA 4BBSI 4A3GI 1KQSZ 2NVXI 2EGTA 2W04A 2IZ4A 3T4NB 2Q4ZA 3S16I 3VMGA 3S2DI 3CCS1 5C4JI 3G71Z 1VQ7Z 2R93I 2E2JI 5T64A 2IZ3A 2R92I 2Q51A 2M48A 3CCEZ 2QRDB 3VMIA 3JAMf 4A3KI 1Q821 3CXCZ 1Y1WI 1NP6A 4NBEA 2OTJ1 1VQM1 5D1PA 3FKII 4HH4A 5T67A 4S1TA 1VQ5Z 3CPWY 3GTPI 2PMZA 3BG0B 3J81f 1Q861 4A3II 4MD7A 2H85A 3PO2I 3P5JB 3KIFA 1RO2A 3J80b 3CME1 1YI21 1N8R1 4A3EI 2JNYA 4NBDA 3CCQZ 1M1K1 3Q87A 3HOXI 3VMHA 3CCV1 4E32A 3HOVI 1KQSY 3VB9A 2OTLZ 1Y1VS 4E2WA 4QTTA 1YJ91 1VQN1 1SFOI 1TWGI 2R6MA 1Q7Y1 4RVGA 1Y1VI 4MRIA 4NH1C 4E31A 1LQLA 2JA5I 1YJNZ 3H3VJ 3RZOI 1KRLA 1Q811 1TWFI 2RHBA 2JA6I 4RVHA 4NB9A 2RBLA 1RQFA 1K9M2 1JJ2Z 1YJW1 1YHQZ 3CCMZ 3HOWI 3NFZA 1VQP1 2O53A 1QF8A 4NBFA 3M3YI 1M901 2V8JA 1YUAA 2HF1A 3CD6Z 3S1MI 5D1OA 4RV9A 1Z03A 3NDIA 1VQK1 2J6AA 4NBCA 2QEX1 3EERA 1RLYA 3G4S1 3CMA1 4A3DI 1KD12 4A3JI 3GTQI 3VTNA 3IF8A 5FLXb 4Y52I 3TE5B 5IT9b 2OZKA 2LFUA 3MZLB 4A3MI 3U50C 2QLVB 1NUIA 1NJI2 2WB1A 5C4XI 2E2II 4E2XA 3J7A4 2YADA 1TWHI 4A3LI 4DK1A 3LUSA 3MZKB 1L1OC 3JAMb 1RO0A 3EEDA 3CCL1 5D1OB 1JJ2Y 1VQ61 1USPB 1QYPA 1W2BY 3HOYI 3J81b 4MD9A 2RIQA 4NFRA 2VUMI 3CCLZ 3CCSZ 5C44I 1KC82 4HGZA 5CM2M 3CC21 1S7MA 3IFUA 2GTIA 3CCJ1 1YUKA 4MH4A 4NBHA 4MD8A 3HKZA 2OTJZ 1VQMZ 2I3CA 3S2HI 3CCJZ 4TNUA 2Y0SA 1ZH1A 1Z02A 3G6E1 3GTOI 3GTJI 3CCU1 3S1QI 4DGLA 2NVTI 4XX2A 1VQ41 2B63I 5AN9F 3GCFA 3GTMS 3CMEZ 1YI2Z 3CCUZ 4A3FI 3HOUI 1VQ91 2G2KA 1N2FA 2QRCB 5A2Qb 3CCVZ 1VQ4Z 2R7ZI 4RVFA 3CC71 4RS4A 1K9M1 1YJ9Z 2P28A 1K8A2 1VQNZ 3CC41 2O4HA 1I50I 4QTUA 1W2BZ 1ML8A 2OOXB 2PM9A 2E9HA 1QVGZ 2JMOA 3I561 4A3CI 3TDHB 1YJWZ 1VQPZ 1Q7Y2 5IP7I 1KD11 3BG1B 1DL6A 1X3ZA 2LIYA 4E2YA 1K83I 1TFIA 3I551 2DE5A 1RO4A 3NH5A 1VQKZ 1WW9A 2JUBA 2QEXZ 2K3RA 4NBGA 1NJI1 4DQYB 3G4SZ 3CCR1 3CMAZ 2KPIA 3I4NI 1RNIA 2JA8I 2KI7B 2QKDA 2JA7I 4NB8A 4A3BI 2NVQI 2QR1B 2OOYB 4NBBA 5C3EI 3H0GI 1X3WA 3ESWA 3OW2Z 1QVGY 1K732 2K5RA 5IT9f 1KC81 3G711 2F4MA 4CL1A 1VQ71 1WCMI 5FLMI 1VQ6Z 4BY7I 1WIIA 1P9NA 1QVFY 4E33A 3S15I 3CCE1 4E2ZA 3D9XA 3D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF1 A;  1I3Q I;  4A3F I;  3HOU I;  3S1M I;  1N2F A;  2R7Z I;  4BBS I;  2J6A A;  4NBC A;  3EER A;  4A3G I;  1RLY A;  4A3D I;  2NVX I;  4A3J I;  3GTQ I;  1I50 I;  4QTU A;  2YU9 I;  3S16 I;  4Y52 I;  2P3Y A;  3VMG A;  3S2D I;  1ML8 A;  2JS4 A;  5C4J I;  1R9T I;  4BXX I;  2NVY I;  4A3M I;  4NBA A;  2R93 I;  3U50 C;  3S17 I;  2E2J I;  4Y7N I;  4A3C I;  2DE7 A;  2JR6 A;  1NUI A;  4BBR I;  5IP9 I;  2R92 I;  3I4M I;  3HOZ I;  3GTM I;  5C4X I;  5IP7 I;  2E2I I;  1I6H I;  3VMI A;  4A3K I;  3S1N I;  2DE6 A;  1Y1W I;  4NOZ A;  4NBE A;  1DL6 A;  1X3Z A;  1ZB9 A;  1TWH I;  3FKI I;  4A3L I;  1K83 I;  4X6A I;  3LUS A;  1L1O C;  3GTP I;  1TFI A;  2AKL A;  2E2H I;  2DE5 A;  1RO4 A;  3PO3 S;  1WW9 A;  3CQZ I;  2BJO A;  4NBG A;  1USP B;  1QYP A;  3HOY I;  2KPI A;  4A3I I;  4BY1 I;  3I4N I;  3PO3 I;  1ZB8 A;  3RZD I;  2JA8 I;  2JA7 I;  3PO2 I;  2VUM I;  1TWA I;  4NB8 A;  5C44 I;  4A3B I;  2NVQ I;  3S14 I;  4A3E I;  4A93 I;  2JNY A;  2PK7 A;  4NBD A;  3Q87 A;  3GKQ A;  3HOX I;  1TWC I;  5CM2 M;  3VMH A;  3GTG I;  3GTK I;  1PFT A;  2F4O A;  3M4O I;  3HOV I;  4NBB A;  3GTL I;  5C3E I;  1VLA A;  3VB9 A;  1Y1V S;  4MH4 A;  3H0G I;  4NBH A;  1X3W A;  3ESW A;  4QTT A;  3S1R I;  1SFO I;  3I07 A;  1TWG I;  3S2H I;  1Y1V I;  1LQL A;  2JA5 I;  3H3V J;  1USP A;  2K5R A;  3RZO I;  1TWF I;  2F4M A;  3GTO I;  3GTJ I;  2JA6 I;  4NB9 A;  1WCM I;  5FLM I;  2RBL A;  4BY7 I;  3S1Q I;  3K7A I;  3HOW I;  2NVT I;  4XX2 A;  2B63 I;  3S15 I;  4NBF A;  3D6W A;  3M3Y I;  3GCF A;  1YUA A;  3GTM S; 
#chains in the Genus database with same CATH topology
 2HU9 A;  3FQQ A;  2V8K A;  4MON A;  1VQ5 1;  2E7Z A;  3CC2 Z;  2V8I A;  3MON A;  2RPR A;  2VPZ A;  2WAQ A;  1Q82 2;  2W03 A;  2RT9 A;  4RVD A;  1VQO 1;  2YU9 I;  2P3Y A;  4E30 A;  2JS4 A;  1R9T I;  4BXX I;  2NVY I;  5LL6 f;  3CCQ 1;  4NBA A;  3G6E Z;  3S17 I;  4Y7N I;  2DE7 A;  2JR6 A;  4BBR I;  5IP9 I;  3I4M I;  3HOZ I;  3GTM I;  1YIT 1;  4AYB A;  2VPX A;  1VQO Z;  1Q86 2;  3QWU A;  1I6H I;  2OTL 1;  1K8A 1;  3S1N I;  2DE6 A;  3OW2 Y;  2QA4 1;  4NOZ A;  2M6N A;  1ZB9 A;  2QRE B;  1VQ9 Z;  1N8R 2;  4X6A I;  4HGY A;  2JIQ A;  1M1K 2;  5T6B A;  1YIT Z;  1YJN 1;  3NH4 A;  2AKL A;  2E2H I;  3PO3 S;  3CQZ I;  3CC7 Z;  2QA4 Z;  2GU2 A;  2BJO A;  3J80 f;  3NH8 A;  1YHQ 1;  1VQ8 1;  3CC4 Z;  3CCM 1;  4BY1 I;  3PO3 I;  3F3F C;  2VF1 A;  1ZB8 A;  3RZD I;  3IX0 A;  1TWA I;  3CD6 1;  3S14 I;  1QVF Z;  4A93 I;  2PK7 A;  2VUG A;  1Q81 2;  3I56 Z;  3GKQ A;  1VQ8 Z;  1TWC I;  5A2Q f;  3NDJ A;  3CXC Y;  1YIJ 1;  3GTG I;  3GTK I;  1PFT A;  2F4O A;  3M4O I;  1JWH C;  3GTL I;  1VLA A;  3FQM A;  3S1R I;  1VQL 1;  1M90 2;  3I07 A;  1YIJ Z;  2VPY A;  2ZAE B;  1Z01 A;  1USP A;  3I55 Z;  3CPW Z;  3KIH A;  1AA6 A;  1VQL Z;  1FDI A;  3CCR Z;  3K7A I;  2JIP A;  4EWC A;  1S72 1;  3F3P C;  4MXU A;  1X0T A;  1I3Q I;  1SIW A;  1K73 1;  5FLX f;  1S72 Z;  2GTH A;  4BBS I;  4A3G I;  1KQS Z;  2NVX I;  2EGT A;  2W04 A;  2IZ4 A;  3T4N B;  2Q4Z A;  3S16 I;  3VMG A;  3S2D I;  3CCS 1;  5C4J I;  2LEX A;  3G71 Z;  1VQ7 Z;  2R93 I;  1WZN A;  2E2J I;  5T64 A;  2IZ3 A;  2R92 I;  2Q51 A;  2M48 A;  3CCE Z;  2QRD B;  3VMI A;  3JAM f;  4A3K I;  1Q82 1;  3CXC Z;  1Y1W I;  1NP6 A;  4NBE A;  2OTJ 1;  1VQM 1;  1Q16 A;  5D1P A;  3FKI I;  4HH4 A;  5T67 A;  4S1T A;  1VQ5 Z;  3CPW Y;  3GTP I;  2PMZ A;  3BG0 B;  3J81 f;  1Q86 1;  4A3I I;  4MD7 A;  2H85 A;  3PO2 I;  3P5J B;  3KIF A;  1RO2 A;  3J80 b;  3CME 1;  1YI2 1;  1N8R 1;  4A3E I;  1QXF A;  2JNY A;  4NBD A;  3CCQ Z;  1M1K 1;  3Q87 A;  3HOX I;  3VMH A;  3CCV 1;  4E32 A;  3HOV I;  2IV2 X;  1KQS Y;  3VB9 A;  2OTL Z;  1Y1V S;  4E2W A;  4QTT A;  1YJ9 1;  1VQN 1;  1SFO I;  2NAP A;  1TWG I;  2R6M A;  1Q7Y 1;  4RVG A;  1Y1V I;  4MRI A;  4NH1 C;  4E31 A;  1LQL A;  2JA5 I;  1YJN Z;  3H3V J;  3RZO I;  1KRL A;  1Q81 1;  1TWF I;  2RHB A;  2JA6 I;  4RVH A;  2JIM A;  4NB9 A;  2JIR A;  1RQF A;  2RBL A;  1K9M 2;  1JJ2 Z;  1YJW 1;  1YHQ Z;  3CCM Z;  3HOW I;  3NFZ A;  1VQP 1;  2O53 A;  1QF8 A;  4NBF A;  3M3Y I;  1M90 1;  2V8J A;  1YUA A;  2HF1 A;  3CD6 Z;  3S1M I;  5D1O A;  4RV9 A;  1Z03 A;  3NDI A;  1VQK 1;  2J6A A;  4NBC A;  2QEX 1;  3EER A;  1WJ2 A;  1RLY A;  2V45 A;  3G4S 1;  3CMA 1;  4A3D I;  1KD1 2;  4A3J I;  3GTQ I;  3VTN A;  3IF8 A;  5FLX b;  4Y52 I;  3TE5 B;  5IT9 b;  2VPW A;  2OZK A;  2LFU A;  3MZL B;  4A3M I;  3U50 C;  2QLV B;  1NUI A;  1NJI 2;  2WB1 A;  5C4X I;  2E2I I;  4E2X A;  3J7A 4;  2YAD A;  1TWH I;  4A3L I;  4DK1 A;  3LUS A;  3MZK B;  1L1O C;  3JAM b;  1RO0 A;  1Y8C A;  3EED A;  3CCL 1;  5D1O B;  1JJ2 Y;  2JIO A;  1VQ6 1;  1USP B;  1QYP A;  1W2B Y;  3HOY I;  3J81 b;  4MD9 A;  2RIQ A;  4NFR A;  2VUM I;  3CCL Z;  3CCS Z;  5C44 I;  1KC8 2;  4HGZ A;  5CM2 M;  3CC2 1;  1S7M A;  3IFU A;  2GTI A;  3CCJ 1;  1YUK A;  4MH4 A;  2AYD A;  4NBH A;  4MD8 A;  3HKZ A;  2OTJ Z;  1VQM Z;  2I3C A;  3S2H I;  3CCJ Z;  4TNU A;  3D2L A;  2Y0S A;  1ZH1 A;  1Z02 A;  3G6E 1;  3GTO I;  3GTJ I;  3CCU 1;  3S1Q I;  1FDO A;  4DGL A;  2NVT I;  4XX2 A;  1VQ4 1;  2B63 I;  5AN9 F;  3GCF A;  3GTM S;  3CME Z;  1YI2 Z;  3CCU Z;  4A3F I;  3HOU I;  1VQ9 1;  2G2K A;  1N2F A;  2QRC B;  5A2Q b;  3CCV Z;  1VQ4 Z;  2R7Z I;  4RVF A;  3CC7 1;  4RS4 A;  1K9M 1;  1YJ9 Z;  2P28 A;  1K8A 2;  1VQN Z;  3CC4 1;  2O4H A;  1I50 I;  4QTU A;  1W2B Z;  1ML8 A;  2OOX B;  2PM9 A;  2E9H A;  1QVG Z;  2JMO A;  3I56 1;  4A3C I;  3TDH B;  1YJW Z;  1VQP Z;  1Q7Y 2;  5IP7 I;  1KD1 1;  3BG1 B;  1DL6 A;  1X3Z A;  2LIY A;  4E2Y A;  1K83 I;  1TFI A;  3I55 1;  2DE5 A;  1RO4 A;  3NH5 A;  1VQK Z;  1WW9 A;  2JUB A;  2QEX Z;  2K3R A;  4NBG A;  1NJI 1;  4DQY B;  3G4S Z;  3CCR 1;  3CMA Z;  2KPI A;  3I4N I;  1RNI A;  2JA8 I;  2KI7 B;  2QKD A;  2JA7 I;  4NB8 A;  3IR7 A;  2NVQ I;  4A3B I;  2QR1 B;  2OOY B;  4NBB A;  5C3E I;  3H0G I;  1X3W A;  3ESW A;  3OW2 Z;  1QVG Y;  1K73 2;  2K5R A;  5IT9 f;  1KC8 1;  3G71 1;  2F4M A;  4CL1 A;  1VQ7 1;  1WCM I;  5FLM I;  1VQ6 Z;  4BY7 I;  1WII A;  1P9N A;  1QVF Y;  4E33 A;  3S15 I;  3CCE 1;  2V3V A;  4E2Z A;  3D9X A;  3D6W A; 
#chains in the Genus database with same CATH homology
 2HU9 A;  3FQQ A;  2V8K A;  4MON A;  1VQ5 1;  3CC2 Z;  2V8I A;  3MON A;  2RPR A;  2WAQ A;  1Q82 2;  2W03 A;  2RT9 A;  4RVD A;  1VQO 1;  2YU9 I;  2P3Y A;  4E30 A;  2JS4 A;  1R9T I;  4BXX I;  2NVY I;  5LL6 f;  3CCQ 1;  4NBA A;  3G6E Z;  3S17 I;  4Y7N I;  2DE7 A;  2JR6 A;  4BBR I;  5IP9 I;  3I4M I;  3HOZ I;  3GTM I;  1YIT 1;  4AYB A;  1VQO Z;  1Q86 2;  3QWU A;  1I6H I;  2OTL 1;  1K8A 1;  3S1N I;  2DE6 A;  3OW2 Y;  2QA4 1;  4NOZ A;  2M6N A;  1ZB9 A;  2QRE B;  1VQ9 Z;  1N8R 2;  4X6A I;  4HGY A;  1M1K 2;  5T6B A;  1YIT Z;  1YJN 1;  3NH4 A;  2AKL A;  2E2H I;  3PO3 S;  3CQZ I;  3CC7 Z;  2QA4 Z;  2GU2 A;  2BJO A;  3J80 f;  3NH8 A;  1YHQ 1;  1VQ8 1;  3CC4 Z;  3CCM 1;  4BY1 I;  3PO3 I;  3F3F C;  2VF1 A;  1ZB8 A;  3RZD I;  3IX0 A;  1TWA I;  3CD6 1;  3S14 I;  1QVF Z;  4A93 I;  2PK7 A;  2VUG A;  1Q81 2;  3I56 Z;  3GKQ A;  1VQ8 Z;  1TWC I;  5A2Q f;  3NDJ A;  3CXC Y;  1YIJ 1;  3GTG I;  3GTK I;  1PFT A;  2F4O A;  3M4O I;  1JWH C;  3GTL I;  1VLA A;  3FQM A;  3S1R I;  1VQL 1;  1M90 2;  3I07 A;  1YIJ Z;  2ZAE B;  1Z01 A;  1USP A;  3I55 Z;  3CPW Z;  3KIH A;  1VQL Z;  3CCR Z;  3K7A I;  4EWC A;  1S72 1;  3F3P C;  4MXU A;  1X0T A;  1I3Q I;  1K73 1;  5FLX f;  1S72 Z;  2GTH A;  4BBS I;  4A3G I;  1KQS Z;  2NVX I;  2EGT A;  2W04 A;  2IZ4 A;  3T4N B;  2Q4Z A;  3S16 I;  3VMG A;  3S2D I;  3CCS 1;  5C4J I;  3G71 Z;  1VQ7 Z;  2R93 I;  2E2J I;  5T64 A;  2IZ3 A;  2R92 I;  2Q51 A;  2M48 A;  3CCE Z;  2QRD B;  3VMI A;  3JAM f;  4A3K I;  1Q82 1;  3CXC Z;  1Y1W I;  1NP6 A;  4NBE A;  2OTJ 1;  1VQM 1;  5D1P A;  3FKI I;  4HH4 A;  5T67 A;  4S1T A;  1VQ5 Z;  3CPW Y;  3GTP I;  2PMZ A;  3BG0 B;  3J81 f;  1Q86 1;  4A3I I;  4MD7 A;  2H85 A;  3PO2 I;  3P5J B;  3KIF A;  1RO2 A;  3J80 b;  3CME 1;  1YI2 1;  1N8R 1;  4A3E I;  2JNY A;  4NBD A;  3CCQ Z;  1M1K 1;  3Q87 A;  3HOX I;  3VMH A;  3CCV 1;  4E32 A;  3HOV I;  1KQS Y;  3VB9 A;  2OTL Z;  1Y1V S;  4E2W A;  4QTT A;  1YJ9 1;  1VQN 1;  1SFO I;  1TWG I;  2R6M A;  1Q7Y 1;  4RVG A;  1Y1V I;  4MRI A;  4NH1 C;  4E31 A;  1LQL A;  2JA5 I;  1YJN Z;  3H3V J;  3RZO I;  1KRL A;  1Q81 1;  1TWF I;  2RHB A;  2JA6 I;  4RVH A;  4NB9 A;  2RBL A;  1RQF A;  1K9M 2;  1JJ2 Z;  1YJW 1;  1YHQ Z;  3CCM Z;  3HOW I;  3NFZ A;  1VQP 1;  2O53 A;  1QF8 A;  4NBF A;  3M3Y I;  1M90 1;  2V8J A;  1YUA A;  2HF1 A;  3CD6 Z;  3S1M I;  5D1O A;  4RV9 A;  1Z03 A;  3NDI A;  1VQK 1;  2J6A A;  4NBC A;  2QEX 1;  3EER A;  1RLY A;  3G4S 1;  3CMA 1;  4A3D I;  1KD1 2;  4A3J I;  3GTQ I;  3VTN A;  3IF8 A;  5FLX b;  4Y52 I;  3TE5 B;  5IT9 b;  2OZK A;  2LFU A;  3MZL B;  4A3M I;  3U50 C;  2QLV B;  1NUI A;  1NJI 2;  2WB1 A;  5C4X I;  2E2I I;  4E2X A;  3J7A 4;  2YAD A;  1TWH I;  4A3L I;  4DK1 A;  3LUS A;  3MZK B;  1L1O C;  3JAM b;  1RO0 A;  3EED A;  3CCL 1;  5D1O B;  1JJ2 Y;  1VQ6 1;  1USP B;  1QYP A;  1W2B Y;  3HOY I;  3J81 b;  4MD9 A;  2RIQ A;  4NFR A;  2VUM I;  3CCL Z;  3CCS Z;  5C44 I;  1KC8 2;  4HGZ A;  5CM2 M;  3CC2 1;  1S7M A;  3IFU A;  2GTI A;  3CCJ 1;  1YUK A;  4MH4 A;  4NBH A;  4MD8 A;  3HKZ A;  2OTJ Z;  1VQM Z;  2I3C A;  3S2H I;  3CCJ Z;  4TNU A;  2Y0S A;  1ZH1 A;  1Z02 A;  3G6E 1;  3GTO I;  3GTJ I;  3CCU 1;  3S1Q I;  4DGL A;  2NVT I;  4XX2 A;  1VQ4 1;  2B63 I;  5AN9 F;  3GCF A;  3GTM S;  3CME Z;  1YI2 Z;  3CCU Z;  4A3F I;  3HOU I;  1VQ9 1;  2G2K A;  1N2F A;  2QRC B;  5A2Q b;  3CCV Z;  1VQ4 Z;  2R7Z I;  4RVF A;  3CC7 1;  4RS4 A;  1K9M 1;  1YJ9 Z;  2P28 A;  1K8A 2;  1VQN Z;  3CC4 1;  2O4H A;  1I50 I;  4QTU A;  1W2B Z;  1ML8 A;  2OOX B;  2PM9 A;  2E9H A;  1QVG Z;  2JMO A;  3I56 1;  4A3C I;  3TDH B;  1YJW Z;  1VQP Z;  1Q7Y 2;  5IP7 I;  1KD1 1;  3BG1 B;  1DL6 A;  1X3Z A;  2LIY A;  4E2Y A;  1K83 I;  1TFI A;  3I55 1;  2DE5 A;  1RO4 A;  3NH5 A;  1VQK Z;  1WW9 A;  2JUB A;  2QEX Z;  2K3R A;  4NBG A;  1NJI 1;  4DQY B;  3G4S Z;  3CCR 1;  3CMA Z;  2KPI A;  3I4N I;  1RNI A;  2JA8 I;  2KI7 B;  2QKD A;  2JA7 I;  4NB8 A;  4A3B I;  2NVQ I;  2QR1 B;  2OOY B;  4NBB A;  5C3E I;  3H0G I;  1X3W A;  3ESW A;  3OW2 Z;  1QVG Y;  1K73 2;  2K5R A;  5IT9 f;  1KC8 1;  3G71 1;  2F4M A;  4CL1 A;  1VQ7 1;  1WCM I;  5FLM I;  1VQ6 Z;  4BY7 I;  1WII A;  1P9N A;  1QVF Y;  4E33 A;  3S15 I;  3CCE 1;  4E2Z A;  3D9X A;  3D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...