1Y1VS

Refined rna polymerase ii-tfiis complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
174
structure length
174
Chain Sequence
b'NDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
molecule tags Transferase/transcription
source organism Saccharomyces cerevisiae
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
total genus 8
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vS01
1Y1VI 4Y52I 2R92I 3CQZI 3HOXI 1TWCI 3I4MI 5IP7I 4NBDA 3HOUI 2JNYA 4A3II 3RZDI 2B63I 2JA6I 2JA8I 4NB8A 1USPB 3VMGA 3S15I 2DE5A 3GCFA 2HF1A 3VMHA 2NVYI 3GTMS 2YU9I 4A3CI 4A3GI 2DE7A 2E2JI 4A3EI 3GTPI 1I3QI 1ZB8A 4NBEA 3I4NI 4A3DI 3HOWI 3I07A 2JR6A 4NBHA 2P3YA 3GTKI 3K7AI 1USPA 3S16I 2BJOA 4A93I 2JA5I 3U50C 4MH4A 3H3VJ 3GKQA 1N2FA 2R93I 2NVXI 3HOVI 2DE6A 2J6AA 4A3BI 4BBSI 1TWFI 3GTLI 3GTMI 2JA7I 3PO3S 3PO3I 3S17I 1RLYA 1I50I 3GTOI 3FKII 1TWHI 2NVTI 1I6HI 1WCMI 1NUIA 4BY7I 1DL6A 1YUAA 2E2II 1X3ZA 1L1OC 3S1MI 1ML8A 4NBGA 1SFOI 1LQLA 3Q87A 1Y1WI 1QYPA 3S1NI 5FLMI 5C4JI 4A3KI 2NVQI 4NBAA 3S2DI 1TWAI 4QTUA 4BXXI 3S1RI 3M4OI 2F4OA 4NB9A 1X3WA 4A3FI 4A3MI 4X6AI 3S1QI 1RO4A 2VUMI 5C4XI 3VB9A 3HOYI 3EERA 1R9TI 3RZOI 2KPIA 5IP9I 3S14I 2AKLA 4BY1I 3HOZI 4A3JI 3S2HI 5C3EI 4BBRI 2PK7A 3D6WA 1Y1VS 1PFTA 3ESWA 3H0GI 4A3LI 4Y7NI 3LUSA 4NBCA 1TFIA 1TWGI 2F4MA 4NBBA 4QTTA 1K83I 1ZB9A 4NBFA 5CM2M 2E2HI 3GTGI 3GTQI 3M3YI 4NOZA 4XX2A 2R7ZI 2JS4A 5C44I 1WW9A 3PO2I 1VLAA 2K5RA 3GTJI 2RBLA 3VMIA
chains in the Genus database with same CATH superfamily
4E2ZA 3TDHB 1YITZ 3CPWZ 5IP7I 1YJN1 1YJ91 3IX0A 1VQLZ 4E32A 2JA8I 4NB8A 3VMGA 3GCFA 3CMAZ 4NH1C 2VPZA 3GTMS 4A3CI 4A3GI 3NDIA 4A3EI 4HGZA 2KI7B 1I3QI 2GU2A 4MD9A 5T6BA 2JIPA 2BJOA 5D1PA 4A93I 1VQL1 2IV2X 1YJNZ 1VQ41 3J80b 3CCSZ 1YIJZ 2IZ3A 3PO3S 2Q51A 1RLYA 1I50I 3GTOI 2GTHA 3I551 1YJW1 1KRLA 1YUAA 3CCR1 1QVFY 1ML8A 1Q7Y2 4RS4A 3J80f 1SFOI 3P5JB 1YJWZ 2G2KA 2IZ4A 4BXXI 2EGTA 2F4OA 2JIRA 1AA6A 4NB9A 1KD11 3CC4Z 3CCE1 3RZOI 4BY1I 3QWUA 1VQP1 3CCUZ 4E30A 1RO2A 3NH4A 1YHQ1 3OW2Y 1Y1VS 1Q861 2E7ZA 1PFTA 3F3FC 3I561 4E2WA 2RIQA 1JWHC 2JIOA 3GTQI 4NOZA 1VQ61 2R7ZI 1YUKA 5C44I 1K731 2JIQA 1K732 3PO2I 1YJ9Z 2K5RA 3CD61 1YIT1 3JAMb 3VMIA 1M902 2RT9A 1M901 1VQ6Z 1Y1VI 5D1OB 1Z03A 2R92I 2I3CA 1TWCI 3HOUI 4E31A 2QRDB 3NFZA 4A3II 2K3RA 2JA6I 3S15I 1WJ2A 3T4NB 3VTNA 2NVYI 1WZNA 2RHBA 2YU9I 3JAMf 2OTJ1 1Z02A 2PMZA 2VPWA 3CCEZ 3HOWI 1X0TA 3CCL1 2JR6A 2P28A 3S16I 3TE5B 2JA5I 3U50C 2QA41 4DQYB 2OTLZ 1Z01A 3NDJA 1VQ51 2J6AA 4BBSI 3J81b 4RVDA 1VQMZ 1TWFI 3GTMI 2JA7I 3CCJ1 1WIIA 2QRCB 1SIWA 1DL6A 2JMOA 3CCV1 2E2II 3I55Z 5T64A 5A2Qf 1RNIA 2V3VA 3KIFA 2V8IA 2VF1A 1M1K2 1ZH1A 1LQLA 3CCS1 2OZKA 2LFUA 2NVQI 1NP6A 1VQ4Z 1Q862 2HU9A 2O4HA 4QTUA 3M4OI 2Y0SA 4A3FI 3G4S1 4MD7A 2VUMI 2ZAEB 2OOYB 1R9TI 2KPIA 1VQ8Z 3HOZI 1VQ81 2QEX1 3D6WA 3CMA1 4E2XA 3G711 3ESWA 5FLXf 1KC81 1N8R2 4NBBA 4QTTA 1ZB9A 3CC2Z 2QR1B 3OW2Z 3M3YI 3EEDA 2R6MA 1QXFA 2VUGA 2JUBA 1VLAA 2E9HA 2WAQA 1Q821 3G6EZ 1VQN1 3KIHA 3CCVZ 2W04A 4E2YA 4NBDA 3CME1 2JNYA 3RZDI 1USPB 1VQ5Z 4S1TA 1VQKZ 2HF1A 2Q4ZA 1S721 2LIYA 3HKZA 4TNUA 2O53A 4MD8A 2QA4Z 4HGYA 3CCQZ 1QVFZ 2M48A 3J81f 2DE7A 1Q16A 2E2JI 3GTPI 1VQ71 3D9XA 4HH4A 3NH8A 3IR7A 2P3YA 4DGLA 1USPA 2RPRA 3GKQA 4RV9A 3CMEZ 2R93I 1NJI2 2QKDA 4NFRA 3NH5A 2NVXI 3HOVI 2DE6A 3G6E1 3S17I 3FKII 2NVTI 4DK1A 4BY7I 2V45A 2QREB 1X3ZA 1K9M1 3CC21 3S1MI 3CC7Z 5IT9f 1Y8CA 3F3PC 3IF8A 2PM9A 1QYPA 3G71Z 3S1NI 1NJI1 4A3KI 2QEXZ 5FLXb 3S2DI 1TWAI 3MZLB 3IFUA 1X3WA 3CPWY 4A3MI 2QLVB 4X6AI 1RO4A 5C4XI 2V8KA 3VB9A 5IT9b 3S14I 3CCU1 2AKLA 1VQPZ 1K9M2 2V8JA 1KQSZ 5C3EI 1QVGY 2NAPA 4BBRI 1VQ7Z 1YI2Z 3CC41 1VQO1 4A3LI 3LUSA 4NBCA 1TFIA 2F4MA 2M6NA 1N8R1 1K83I 4XX2A 2JS4A 1VQ9Z 5D1OA 1VQ91 1VQM1 5AN9F 3GTJI 3CCRZ 4Y52I 3CQZI 5LL6f 3HOXI 1VQNZ 3FQMA 3I4MI 4RVGA 1FDOA 2VPYA 1YIJ1 2B63I 1VQOZ 1M1K1 1JJ2Y 2DE5A 1YI21 3VMHA 2WB1A 2W03A 1RO0A 3CXCY 1S7MA 1ZB8A 4NBEA 2GTIA 3I4NI 4A3DI 1W2BZ 3I07A 4NBHA 3GTKI 3MONA 3K7AI 1P9NA 2LEXA 4MH4A 3H3VJ 4RVHA 1N2FA 2OOXB 1RQFA 4AYBA 3G4SZ 2VPXA 3BG0B 1K8A2 4A3BI 3CD6Z 3GTLI 4MRIA 3CC71 3PO3I 1Q822 1FDIA 1TWHI 1QF8A 1I6HI 1WCMI 1NUIA 1W2BY 4EWCA 2AYDA 3CXCZ 1L1OC 4NBGA 3I56Z 2H85A 3Q87A 1Y1WI 4MONA 1JJ2Z 5FLMI 5C4JI 4NBAA 1YHQZ 3CCJZ 3S1RI 1K8A1 1KC82 5T67A 3S1QI 3FQQA 4E33A 2OTL1 3HOYI 3EERA 5A2Qb 3CCMZ 5IP9I 3MZKB 3CCQ1 3CCM1 4A3JI 3S2HI 1Q7Y1 3CCLZ 1S72Z 2PK7A 1VQK1 4CL1A 3H0GI 4Y7NI 2OTJZ 4MXUA 1TWGI 1KD12 3D2LA 4NBFA 5CM2M 1Q812 2YADA 2E2HI 3GTGI 1Q811 3BG1B 1QVGZ 1KQSY 1WW9A 4RVFA 2JIMA 3J7A4 2RBLA
chains in the Genus database with same CATH topology
4E2ZA 3TDHB 1YITZ 3CPWZ 5IP7I 1YJN1 1YJ91 3IX0A 1VQLZ 4E32A 2JA8I 4NB8A 3VMGA 3GCFA 3CMAZ 4NH1C 3GTMS 4A3CI 4A3GI 3NDIA 4A3EI 4HGZA 2KI7B 1I3QI 2GU2A 4MD9A 5T6BA 2BJOA 5D1PA 4A93I 1VQL1 1YJNZ 1VQ41 3J80b 3CCSZ 1YIJZ 2IZ3A 3PO3S 2Q51A 1RLYA 1I50I 3GTOI 2GTHA 3I551 1YJW1 1KRLA 1YUAA 3CCR1 1QVFY 1ML8A 1Q7Y2 4RS4A 3J80f 1SFOI 3P5JB 1YJWZ 2G2KA 2IZ4A 4BXXI 2EGTA 2F4OA 4NB9A 1KD11 3CC4Z 3CCE1 3RZOI 4BY1I 3QWUA 1VQP1 3CCUZ 4E30A 1RO2A 3NH4A 1YHQ1 3OW2Y 1Y1VS 1Q861 1PFTA 3F3FC 3I561 4E2WA 2RIQA 1JWHC 3GTQI 4NOZA 1VQ61 2R7ZI 1YUKA 5C44I 1K731 1K732 3PO2I 1YJ9Z 2K5RA 3CD61 1YIT1 3JAMb 3VMIA 1M902 2RT9A 1M901 1VQ6Z 1Y1VI 5D1OB 1Z03A 2R92I 2I3CA 1TWCI 3HOUI 4E31A 2QRDB 3NFZA 4A3II 2K3RA 2JA6I 3S15I 3T4NB 3VTNA 2NVYI 2RHBA 2YU9I 3JAMf 2OTJ1 1Z02A 2PMZA 3CCEZ 3HOWI 1X0TA 3CCL1 2JR6A 2P28A 3S16I 3TE5B 2JA5I 3U50C 2QA41 4DQYB 2OTLZ 1Z01A 3NDJA 1VQ51 2J6AA 4BBSI 3J81b 4RVDA 1VQMZ 1TWFI 3GTMI 2JA7I 3CCJ1 1WIIA 2QRCB 1DL6A 2JMOA 3CCV1 2E2II 3I55Z 5T64A 5A2Qf 1RNIA 3KIFA 2V8IA 2VF1A 1M1K2 1ZH1A 1LQLA 3CCS1 2OZKA 2LFUA 2NVQI 1NP6A 1VQ4Z 1Q862 2HU9A 2O4HA 4QTUA 3M4OI 2Y0SA 4A3FI 3G4S1 4MD7A 2VUMI 2ZAEB 2OOYB 1R9TI 2KPIA 1VQ8Z 3HOZI 1VQ81 2QEX1 3D6WA 3CMA1 4E2XA 3G711 3ESWA 5FLXf 1KC81 1N8R2 4NBBA 4QTTA 1ZB9A 3CC2Z 2QR1B 3OW2Z 3M3YI 3EEDA 2R6MA 2VUGA 2JUBA 1VLAA 2E9HA 2WAQA 1Q821 3G6EZ 1VQN1 3KIHA 3CCVZ 2W04A 4E2YA 4NBDA 3CME1 2JNYA 3RZDI 1USPB 1VQ5Z 4S1TA 1VQKZ 2HF1A 2Q4ZA 1S721 2LIYA 3HKZA 4TNUA 2O53A 4MD8A 2QA4Z 4HGYA 3CCQZ 1QVFZ 2M48A 3J81f 2DE7A 2E2JI 3GTPI 1VQ71 3D9XA 3NH8A 4HH4A 2P3YA 4DGLA 1USPA 2RPRA 3GKQA 4RV9A 3CMEZ 2R93I 1NJI2 2QKDA 4NFRA 3NH5A 2NVXI 3HOVI 2DE6A 3G6E1 3S17I 3FKII 2NVTI 4DK1A 4BY7I 2QREB 1X3ZA 1K9M1 3CC21 3S1MI 3CC7Z 5IT9f 3IF8A 3F3PC 2PM9A 1QYPA 3G71Z 3S1NI 1NJI1 4A3KI 2QEXZ 5FLXb 3S2DI 1TWAI 3MZLB 3IFUA 1X3WA 3CPWY 4A3MI 2QLVB 4X6AI 1RO4A 5C4XI 2V8KA 3VB9A 5IT9b 3S14I 3CCU1 2AKLA 1VQPZ 1K9M2 2V8JA 1KQSZ 5C3EI 1QVGY 4BBRI 1VQ7Z 1YI2Z 3CC41 1VQO1 4A3LI 3LUSA 4NBCA 1TFIA 2F4MA 2M6NA 1N8R1 1K83I 4XX2A 2JS4A 1VQ9Z 5D1OA 1VQ91 1VQM1 5AN9F 3GTJI 3CCRZ 4Y52I 3CQZI 5LL6f 3HOXI 1VQNZ 3FQMA 3I4MI 4RVGA 1YIJ1 2B63I 1VQOZ 1M1K1 1JJ2Y 2DE5A 1YI21 3VMHA 2WB1A 2W03A 1RO0A 3CXCY 1S7MA 1ZB8A 4NBEA 2GTIA 3I4NI 4A3DI 1W2BZ 3I07A 4NBHA 3GTKI 3MONA 3K7AI 1P9NA 4MH4A 3H3VJ 4RVHA 1N2FA 2OOXB 1RQFA 4AYBA 3G4SZ 3BG0B 1K8A2 4A3BI 3CD6Z 3GTLI 4MRIA 3CC71 3PO3I 1Q822 1TWHI 1QF8A 1I6HI 1WCMI 1NUIA 1W2BY 4EWCA 3CXCZ 1L1OC 4NBGA 3I56Z 2H85A 3Q87A 1Y1WI 4MONA 1JJ2Z 5FLMI 5C4JI 4NBAA 1YHQZ 3CCJZ 3S1RI 1K8A1 1KC82 5T67A 3S1QI 3FQQA 4E33A 2OTL1 3HOYI 3EERA 5A2Qb 3CCMZ 5IP9I 3MZKB 3CCQ1 3CCM1 4A3JI 3S2HI 1Q7Y1 3CCLZ 1S72Z 2PK7A 1VQK1 4CL1A 3H0GI 4Y7NI 2OTJZ 4MXUA 1TWGI 1KD12 4NBFA 5CM2M 1Q812 2YADA 2E2HI 3GTGI 1Q811 3BG1B 1QVGZ 1KQSY 1WW9A 4RVFA 3J7A4 2RBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V I;  4Y52 I;  2R92 I;  3CQZ I;  3HOX I;  1TWC I;  3I4M I;  5IP7 I;  4NBD A;  3HOU I;  2JNY A;  4A3I I;  3RZD I;  2B63 I;  2JA6 I;  2JA8 I;  4NB8 A;  1USP B;  3VMG A;  3S15 I;  2DE5 A;  3GCF A;  2HF1 A;  3VMH A;  2NVY I;  3GTM S;  2YU9 I;  4A3C I;  4A3G I;  2DE7 A;  2E2J I;  4A3E I;  3GTP I;  1I3Q I;  1ZB8 A;  4NBE A;  3I4N I;  4A3D I;  3HOW I;  3I07 A;  2JR6 A;  4NBH A;  2P3Y A;  3GTK I;  3K7A I;  1USP A;  3S16 I;  2BJO A;  4A93 I;  2JA5 I;  3U50 C;  4MH4 A;  3H3V J;  3GKQ A;  1N2F A;  2R93 I;  2NVX I;  3HOV I;  2DE6 A;  2J6A A;  4A3B I;  4BBS I;  1TWF I;  3GTL I;  3GTM I;  2JA7 I;  3PO3 S;  3PO3 I;  3S17 I;  1RLY A;  1I50 I;  3GTO I;  3FKI I;  1TWH I;  2NVT I;  1I6H I;  1WCM I;  1NUI A;  4BY7 I;  1DL6 A;  1YUA A;  2E2I I;  1X3Z A;  1L1O C;  3S1M I;  1ML8 A;  4NBG A;  1SFO I;  1LQL A;  3Q87 A;  1Y1W I;  1QYP A;  3S1N I;  5FLM I;  5C4J I;  4A3K I;  2NVQ I;  4NBA A;  3S2D I;  1TWA I;  4QTU A;  4BXX I;  3S1R I;  3M4O I;  2F4O A;  4NB9 A;  1X3W A;  4A3F I;  4A3M I;  4X6A I;  3S1Q I;  1RO4 A;  2VUM I;  5C4X I;  3VB9 A;  3HOY I;  3EER A;  1R9T I;  3RZO I;  2KPI A;  5IP9 I;  3S14 I;  2AKL A;  4BY1 I;  3HOZ I;  4A3J I;  3S2H I;  5C3E I;  4BBR I;  2PK7 A;  3D6W A;  1Y1V S;  1PFT A;  3ESW A;  3H0G I;  4A3L I;  4Y7N I;  3LUS A;  4NBC A;  1TFI A;  1TWG I;  2F4M A;  4NBB A;  4QTT A;  1K83 I;  1ZB9 A;  4NBF A;  5CM2 M;  2E2H I;  3GTG I;  3GTQ I;  3M3Y I;  4NOZ A;  4XX2 A;  2R7Z I;  2JS4 A;  5C44 I;  1WW9 A;  3PO2 I;  1VLA A;  2K5R A;  3GTJ I;  2RBL A;  3VMI A; 
#chains in the Genus database with same CATH topology
 4E2Z A;  3TDH B;  1YIT Z;  3CPW Z;  5IP7 I;  1YJN 1;  1YJ9 1;  3IX0 A;  1VQL Z;  4E32 A;  2JA8 I;  4NB8 A;  3VMG A;  3GCF A;  3CMA Z;  4NH1 C;  2VPZ A;  3GTM S;  4A3C I;  4A3G I;  3NDI A;  4A3E I;  4HGZ A;  2KI7 B;  1I3Q I;  2GU2 A;  4MD9 A;  5T6B A;  2JIP A;  2BJO A;  5D1P A;  4A93 I;  1VQL 1;  2IV2 X;  1YJN Z;  1VQ4 1;  3J80 b;  3CCS Z;  1YIJ Z;  2IZ3 A;  3PO3 S;  2Q51 A;  1RLY A;  1I50 I;  3GTO I;  2GTH A;  3I55 1;  1YJW 1;  1KRL A;  1YUA A;  3CCR 1;  1QVF Y;  1ML8 A;  1Q7Y 2;  4RS4 A;  3J80 f;  1SFO I;  3P5J B;  1YJW Z;  2G2K A;  2IZ4 A;  4BXX I;  2EGT A;  2F4O A;  2JIR A;  1AA6 A;  4NB9 A;  1KD1 1;  3CC4 Z;  3CCE 1;  3RZO I;  4BY1 I;  3QWU A;  1VQP 1;  3CCU Z;  4E30 A;  1RO2 A;  3NH4 A;  1YHQ 1;  3OW2 Y;  1Y1V S;  1Q86 1;  2E7Z A;  1PFT A;  3F3F C;  3I56 1;  4E2W A;  2RIQ A;  1JWH C;  2JIO A;  3GTQ I;  4NOZ A;  1VQ6 1;  2R7Z I;  1YUK A;  5C44 I;  1K73 1;  2JIQ A;  1K73 2;  3PO2 I;  1YJ9 Z;  2K5R A;  3CD6 1;  1YIT 1;  3JAM b;  3VMI A;  1M90 2;  2RT9 A;  1M90 1;  1VQ6 Z;  1Y1V I;  5D1O B;  1Z03 A;  2R92 I;  2I3C A;  1TWC I;  3HOU I;  4E31 A;  2QRD B;  3NFZ A;  4A3I I;  2K3R A;  2JA6 I;  3S15 I;  1WJ2 A;  3T4N B;  3VTN A;  2NVY I;  1WZN A;  2RHB A;  2YU9 I;  3JAM f;  2OTJ 1;  1Z02 A;  2PMZ A;  2VPW A;  3CCE Z;  3HOW I;  1X0T A;  3CCL 1;  2JR6 A;  2P28 A;  3S16 I;  3TE5 B;  2JA5 I;  3U50 C;  2QA4 1;  4DQY B;  2OTL Z;  1Z01 A;  3NDJ A;  1VQ5 1;  2J6A A;  4BBS I;  3J81 b;  4RVD A;  1VQM Z;  1TWF I;  3GTM I;  2JA7 I;  3CCJ 1;  1WII A;  2QRC B;  1SIW A;  1DL6 A;  2JMO A;  3CCV 1;  2E2I I;  3I55 Z;  5T64 A;  5A2Q f;  1RNI A;  2V3V A;  3KIF A;  2V8I A;  2VF1 A;  1M1K 2;  1ZH1 A;  1LQL A;  3CCS 1;  2OZK A;  2LFU A;  2NVQ I;  1NP6 A;  1VQ4 Z;  1Q86 2;  2HU9 A;  2O4H A;  4QTU A;  3M4O I;  2Y0S A;  4A3F I;  3G4S 1;  4MD7 A;  2VUM I;  2ZAE B;  2OOY B;  1R9T I;  2KPI A;  1VQ8 Z;  3HOZ I;  1VQ8 1;  2QEX 1;  3D6W A;  3CMA 1;  4E2X A;  3G71 1;  3ESW A;  5FLX f;  1KC8 1;  1N8R 2;  4NBB A;  4QTT A;  1ZB9 A;  3CC2 Z;  2QR1 B;  3OW2 Z;  3M3Y I;  3EED A;  2R6M A;  1QXF A;  2VUG A;  2JUB A;  1VLA A;  2E9H A;  2WAQ A;  1Q82 1;  3G6E Z;  1VQN 1;  3KIH A;  3CCV Z;  2W04 A;  4E2Y A;  4NBD A;  3CME 1;  2JNY A;  3RZD I;  1USP B;  1VQ5 Z;  4S1T A;  1VQK Z;  2HF1 A;  2Q4Z A;  1S72 1;  2LIY A;  3HKZ A;  4TNU A;  2O53 A;  4MD8 A;  2QA4 Z;  4HGY A;  3CCQ Z;  1QVF Z;  2M48 A;  3J81 f;  2DE7 A;  1Q16 A;  2E2J I;  3GTP I;  1VQ7 1;  3D9X A;  4HH4 A;  3NH8 A;  3IR7 A;  2P3Y A;  4DGL A;  1USP A;  2RPR A;  3GKQ A;  4RV9 A;  3CME Z;  2R93 I;  1NJI 2;  2QKD A;  4NFR A;  3NH5 A;  2NVX I;  3HOV I;  2DE6 A;  3G6E 1;  3S17 I;  3FKI I;  2NVT I;  4DK1 A;  4BY7 I;  2V45 A;  2QRE B;  1X3Z A;  1K9M 1;  3CC2 1;  3S1M I;  3CC7 Z;  5IT9 f;  1Y8C A;  3F3P C;  3IF8 A;  2PM9 A;  1QYP A;  3G71 Z;  3S1N I;  1NJI 1;  4A3K I;  2QEX Z;  5FLX b;  3S2D I;  1TWA I;  3MZL B;  3IFU A;  1X3W A;  3CPW Y;  4A3M I;  2QLV B;  4X6A I;  1RO4 A;  5C4X I;  2V8K A;  3VB9 A;  5IT9 b;  3S14 I;  3CCU 1;  2AKL A;  1VQP Z;  1K9M 2;  2V8J A;  1KQS Z;  5C3E I;  1QVG Y;  2NAP A;  4BBR I;  1VQ7 Z;  1YI2 Z;  3CC4 1;  1VQO 1;  4A3L I;  3LUS A;  4NBC A;  1TFI A;  2F4M A;  2M6N A;  1N8R 1;  1K83 I;  4XX2 A;  2JS4 A;  1VQ9 Z;  5D1O A;  1VQ9 1;  1VQM 1;  5AN9 F;  3GTJ I;  3CCR Z;  4Y52 I;  3CQZ I;  5LL6 f;  3HOX I;  1VQN Z;  3FQM A;  3I4M I;  4RVG A;  1FDO A;  2VPY A;  1YIJ 1;  2B63 I;  1VQO Z;  1M1K 1;  1JJ2 Y;  2DE5 A;  1YI2 1;  3VMH A;  2WB1 A;  2W03 A;  1RO0 A;  3CXC Y;  1S7M A;  1ZB8 A;  4NBE A;  2GTI A;  3I4N I;  4A3D I;  1W2B Z;  3I07 A;  4NBH A;  3GTK I;  3MON A;  3K7A I;  1P9N A;  2LEX A;  4MH4 A;  3H3V J;  4RVH A;  1N2F A;  2OOX B;  1RQF A;  4AYB A;  3G4S Z;  2VPX A;  3BG0 B;  1K8A 2;  4A3B I;  3CD6 Z;  3GTL I;  4MRI A;  3CC7 1;  3PO3 I;  1Q82 2;  1FDI A;  1TWH I;  1QF8 A;  1I6H I;  1WCM I;  1NUI A;  1W2B Y;  4EWC A;  2AYD A;  3CXC Z;  1L1O C;  4NBG A;  3I56 Z;  2H85 A;  3Q87 A;  1Y1W I;  4MON A;  1JJ2 Z;  5FLM I;  5C4J I;  4NBA A;  1YHQ Z;  3CCJ Z;  3S1R I;  1K8A 1;  1KC8 2;  5T67 A;  3S1Q I;  3FQQ A;  4E33 A;  2OTL 1;  3HOY I;  3EER A;  5A2Q b;  3CCM Z;  5IP9 I;  3MZK B;  3CCQ 1;  3CCM 1;  4A3J I;  3S2H I;  1Q7Y 1;  3CCL Z;  1S72 Z;  2PK7 A;  1VQK 1;  4CL1 A;  3H0G I;  4Y7N I;  2OTJ Z;  4MXU A;  1TWG I;  1KD1 2;  3D2L A;  4NBF A;  5CM2 M;  1Q81 2;  2YAD A;  2E2H I;  3GTG I;  1Q81 1;  3BG1 B;  1QVG Z;  1KQS Y;  1WW9 A;  4RVF A;  2JIM A;  3J7A 4;  2RBL A; 
#chains in the Genus database with same CATH homology
 4E2Z A;  3TDH B;  1YIT Z;  3CPW Z;  5IP7 I;  1YJN 1;  1YJ9 1;  3IX0 A;  1VQL Z;  4E32 A;  2JA8 I;  4NB8 A;  3VMG A;  3GCF A;  3CMA Z;  4NH1 C;  3GTM S;  4A3C I;  4A3G I;  3NDI A;  4A3E I;  4HGZ A;  2KI7 B;  1I3Q I;  2GU2 A;  4MD9 A;  5T6B A;  2BJO A;  5D1P A;  4A93 I;  1VQL 1;  1YJN Z;  1VQ4 1;  3J80 b;  3CCS Z;  1YIJ Z;  2IZ3 A;  3PO3 S;  2Q51 A;  1RLY A;  1I50 I;  3GTO I;  2GTH A;  3I55 1;  1YJW 1;  1KRL A;  1YUA A;  3CCR 1;  1QVF Y;  1ML8 A;  1Q7Y 2;  4RS4 A;  3J80 f;  1SFO I;  3P5J B;  1YJW Z;  2G2K A;  2IZ4 A;  4BXX I;  2EGT A;  2F4O A;  4NB9 A;  1KD1 1;  3CC4 Z;  3CCE 1;  3RZO I;  4BY1 I;  3QWU A;  1VQP 1;  3CCU Z;  4E30 A;  1RO2 A;  3NH4 A;  1YHQ 1;  3OW2 Y;  1Y1V S;  1Q86 1;  1PFT A;  3F3F C;  3I56 1;  4E2W A;  2RIQ A;  1JWH C;  3GTQ I;  4NOZ A;  1VQ6 1;  2R7Z I;  1YUK A;  5C44 I;  1K73 1;  1K73 2;  3PO2 I;  1YJ9 Z;  2K5R A;  3CD6 1;  1YIT 1;  3JAM b;  3VMI A;  1M90 2;  2RT9 A;  1M90 1;  1VQ6 Z;  1Y1V I;  5D1O B;  1Z03 A;  2R92 I;  2I3C A;  1TWC I;  3HOU I;  4E31 A;  2QRD B;  3NFZ A;  4A3I I;  2K3R A;  2JA6 I;  3S15 I;  3T4N B;  3VTN A;  2NVY I;  2RHB A;  2YU9 I;  3JAM f;  2OTJ 1;  1Z02 A;  2PMZ A;  3CCE Z;  3HOW I;  1X0T A;  3CCL 1;  2JR6 A;  2P28 A;  3S16 I;  3TE5 B;  2JA5 I;  3U50 C;  2QA4 1;  4DQY B;  2OTL Z;  1Z01 A;  3NDJ A;  1VQ5 1;  2J6A A;  4BBS I;  3J81 b;  4RVD A;  1VQM Z;  1TWF I;  3GTM I;  2JA7 I;  3CCJ 1;  1WII A;  2QRC B;  1DL6 A;  2JMO A;  3CCV 1;  2E2I I;  3I55 Z;  5T64 A;  5A2Q f;  1RNI A;  3KIF A;  2V8I A;  2VF1 A;  1M1K 2;  1ZH1 A;  1LQL A;  3CCS 1;  2OZK A;  2LFU A;  2NVQ I;  1NP6 A;  1VQ4 Z;  1Q86 2;  2HU9 A;  2O4H A;  4QTU A;  3M4O I;  2Y0S A;  4A3F I;  3G4S 1;  4MD7 A;  2VUM I;  2ZAE B;  2OOY B;  1R9T I;  2KPI A;  1VQ8 Z;  3HOZ I;  1VQ8 1;  2QEX 1;  3D6W A;  3CMA 1;  4E2X A;  3G71 1;  3ESW A;  5FLX f;  1KC8 1;  1N8R 2;  4NBB A;  4QTT A;  1ZB9 A;  3CC2 Z;  2QR1 B;  3OW2 Z;  3M3Y I;  3EED A;  2R6M A;  2VUG A;  2JUB A;  1VLA A;  2E9H A;  2WAQ A;  1Q82 1;  3G6E Z;  1VQN 1;  3KIH A;  3CCV Z;  2W04 A;  4E2Y A;  4NBD A;  3CME 1;  2JNY A;  3RZD I;  1USP B;  1VQ5 Z;  4S1T A;  1VQK Z;  2HF1 A;  2Q4Z A;  1S72 1;  2LIY A;  3HKZ A;  4TNU A;  2O53 A;  4MD8 A;  2QA4 Z;  4HGY A;  3CCQ Z;  1QVF Z;  2M48 A;  3J81 f;  2DE7 A;  2E2J I;  3GTP I;  1VQ7 1;  3D9X A;  3NH8 A;  4HH4 A;  2P3Y A;  4DGL A;  1USP A;  2RPR A;  3GKQ A;  4RV9 A;  3CME Z;  2R93 I;  1NJI 2;  2QKD A;  4NFR A;  3NH5 A;  2NVX I;  3HOV I;  2DE6 A;  3G6E 1;  3S17 I;  3FKI I;  2NVT I;  4DK1 A;  4BY7 I;  2QRE B;  1X3Z A;  1K9M 1;  3CC2 1;  3S1M I;  3CC7 Z;  5IT9 f;  3IF8 A;  3F3P C;  2PM9 A;  1QYP A;  3G71 Z;  3S1N I;  1NJI 1;  4A3K I;  2QEX Z;  5FLX b;  3S2D I;  1TWA I;  3MZL B;  3IFU A;  1X3W A;  3CPW Y;  4A3M I;  2QLV B;  4X6A I;  1RO4 A;  5C4X I;  2V8K A;  3VB9 A;  5IT9 b;  3S14 I;  3CCU 1;  2AKL A;  1VQP Z;  1K9M 2;  2V8J A;  1KQS Z;  5C3E I;  1QVG Y;  4BBR I;  1VQ7 Z;  1YI2 Z;  3CC4 1;  1VQO 1;  4A3L I;  3LUS A;  4NBC A;  1TFI A;  2F4M A;  2M6N A;  1N8R 1;  1K83 I;  4XX2 A;  2JS4 A;  1VQ9 Z;  5D1O A;  1VQ9 1;  1VQM 1;  5AN9 F;  3GTJ I;  3CCR Z;  4Y52 I;  3CQZ I;  5LL6 f;  3HOX I;  1VQN Z;  3FQM A;  3I4M I;  4RVG A;  1YIJ 1;  2B63 I;  1VQO Z;  1M1K 1;  1JJ2 Y;  2DE5 A;  1YI2 1;  3VMH A;  2WB1 A;  2W03 A;  1RO0 A;  3CXC Y;  1S7M A;  1ZB8 A;  4NBE A;  2GTI A;  3I4N I;  4A3D I;  1W2B Z;  3I07 A;  4NBH A;  3GTK I;  3MON A;  3K7A I;  1P9N A;  4MH4 A;  3H3V J;  4RVH A;  1N2F A;  2OOX B;  1RQF A;  4AYB A;  3G4S Z;  3BG0 B;  1K8A 2;  4A3B I;  3CD6 Z;  3GTL I;  4MRI A;  3CC7 1;  3PO3 I;  1Q82 2;  1TWH I;  1QF8 A;  1I6H I;  1WCM I;  1NUI A;  1W2B Y;  4EWC A;  3CXC Z;  1L1O C;  4NBG A;  3I56 Z;  2H85 A;  3Q87 A;  1Y1W I;  4MON A;  1JJ2 Z;  5FLM I;  5C4J I;  4NBA A;  1YHQ Z;  3CCJ Z;  3S1R I;  1K8A 1;  1KC8 2;  5T67 A;  3S1Q I;  3FQQ A;  4E33 A;  2OTL 1;  3HOY I;  3EER A;  5A2Q b;  3CCM Z;  5IP9 I;  3MZK B;  3CCQ 1;  3CCM 1;  4A3J I;  3S2H I;  1Q7Y 1;  3CCL Z;  1S72 Z;  2PK7 A;  1VQK 1;  4CL1 A;  3H0G I;  4Y7N I;  2OTJ Z;  4MXU A;  1TWG I;  1KD1 2;  4NBF A;  5CM2 M;  1Q81 2;  2YAD A;  2E2H I;  3GTG I;  1Q81 1;  3BG1 B;  1QVG Z;  1KQS Y;  1WW9 A;  4RVF A;  3J7A 4;  2RBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...