1Y1VS

Refined rna polymerase ii-tfiis complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
174
structure length
174
Chain Sequence
NDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 8
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vS01
2J6AA 1RO4A 3S15I 1TFIA 4A3II 4NB9A 2R93I 4NBDA 4QTUA 4NBGA 3HOZI 4BY7I 1Y1VI 4NBBA 4NB8A 1K83I 2KPIA 3S1RI 4A3LI 3HOUI 4QTTA 4BBRI 3VMGA 2DE7A 3VB9A 4BY1I 1I6HI 2VUMI 2F4OA 3HOXI 3GTKI 1Y1VS 4A3GI 4X6AI 3I4NI 4A3DI 4NBEA 1TWGI 1L1OC 2E2II 3Q87A 2P3YA 1NUIA 2JS4A 5C4JI 3M4OI 4A3MI 3U50C 2R7ZI 3EERA 4NOZA 4Y52I 4A3JI 2DE5A 3H0GI 4NBHA 1WW9A 3S1NI 3GTLI 3S14I 4NBCA 1DL6A 3HOVI 2JA6I 3S2DI 3FKII 5C4XI 2AKLA 1X3ZA 1X3WA 4BXXI 2E2JI 3LUSA 5IP9I 3CQZI 2RBLA 4NBAA 2NVTI 3I4MI 3K7AI 1ZB8A 2NVYI 2JA8I 3GTPI 2B63I 3PO3S 3GTMS 1ZB9A 3RZOI 3GKQA 4A3EI 2R92I 4A3BI 4A93I 2BJOA 2JR6A 2DE6A 2JNYA 1I3QI 3GTMI 3H3VJ 1Y1WI 1YUAA 2NVQI 2K5RA 1ML8A 3HOYI 1PFTA 2HF1A 3RZDI 4BBSI 1WCMI 3VMHA 3S2HI 3I07A 1TWHI 5FLMI 3PO2I 5C44I 3ESWA 1TWAI 5C3EI 2JA7I 1N2FA 1RLYA 4MH4A 1I50I 2NVXI 1USPA 2PK7A 3S16I 1TWFI 1QYPA 1SFOI 4NBFA 3S17I 4A3CI 1USPB 4Y7NI 1LQLA 3GCFA 4A3FI 2JA5I 3D6WA 2F4MA 1VLAA 3M3YI 3GTGI 3GTJI 3S1MI 5IP7I 3S1QI 5CM2M 3VMIA 3PO3I 3GTQI 2E2HI 3HOWI 3GTOI 4XX2A 1R9TI 1TWCI 2YU9I 4A3KI
chains in the Genus database with same CATH superfamily
3BG0B 2K3RA 1W2BZ 3S15I 1WZNA 2RHBA 2R93I 4NBGA 1VQ61 3JAMb 3KIFA 3IR7A 1YI21 3T4NB 2V45A 3S1RI 2LEXA 1VQN1 3VMGA 1S72Z 2VUMI 2RPRA 3JAMf 3HOXI 1Q16A 4HGYA 2O4HA 1K9M1 2WAQA 4NBEA 4RVGA 2E2II 3Q87A 3CC41 3CCSZ 3U50C 3CCJZ 1VQK1 4Y52I 2GTIA 4NBHA 1KC81 2H85A 1DL6A 3EEDA 3CCR1 2VPYA 2JA6I 1N8R1 2AKLA 4E30A 1X3WA 2E2JI 3LUSA 5IP9I 5FLXb 3I4MI 1JJ2Y 2NVYI 2JA8I 1YITZ 2AYDA 1VQ4Z 1S7MA 1YJNZ 2RIQA 4A93I 2JIMA 2JR6A 2DE6A 2JNYA 3CC7Z 1FDIA 3CCM1 3GTMI 3H3VJ 2NVQI 5LL6f 5T64A 2Q4ZA 1PFTA 1WCMI 3VMHA 1JWHC 3S2HI 2V8IA 2QLVB 1WJ2A 2V8JA 1TWAI 1Q821 2QEXZ 3CME1 1VQ6Z 5A2Qf 1RLYA 4MH4A 2JIOA 1QVFY 1K8A1 1TWFI 2VUGA 1USPB 1Y8CA 2QA4Z 4E2XA 3GCFA 2LIYA 3CCVZ 4E33A 2GTHA 3M3YI 1VQ41 2OTJ1 2OTJZ 4E32A 4NH1C 5IP7I 3HOWI 3I551 3QWUA 3CD61 1R9TI 2ZAEB 2YU9I 1RO4A 2VPXA 1YJW1 3G71Z 1K8A2 1VQM1 2QEX1 3J81f 4BY7I 1Y1VI 2OTL1 2R6MA 2OTLZ 3MZLB 4NBBA 4NB8A 1VQ9Z 1K83I 2KPIA 2QRCB 3HKZA 4A3LI 3NH8A 4BBRI 1I6HI 2DE7A 3VB9A 1RO2A 4HH4A 5D1OA 3GTKI 3I4NI 4A3DI 1TWGI 3I56Z 5C4JI 4E2ZA 1VQKZ 1VQOZ 2QKDA 4NOZA 5IT9f 2V8KA 2DE5A 3H0GI 3KIHA 1WW9A 1YJ9Z 3GTLI 3S1NI 3CCRZ 2PMZA 3HOVI 3G711 2LFUA 3NDIA 3CC2Z 3S2DI 3FKII 5C4XI 5IT9b 2NVTI 4MXUA 3K7AI 4RVDA 4S1TA 1YIJZ 1YIJ1 4E2YA 3MONA 3J7A4 4A3BI 2BJOA 3CCLZ 2OOXB 5FLXf 1NP6A 2K5RA 3HOYI 1YJWZ 2KI7B 5FLMI 1TWHI 4NFRA 3ESWA 3CCE1 2M6NA 3CCUZ 1YIT1 1VQL1 3CCU1 1VQLZ 3CCQZ 1USPA 3D9XA 1SIWA 3CC71 3NFZA 1VQ81 1RO0A 1QF8A 5A2Qb 1Z03A 1QXFA 1VQ5Z 1VLAA 3I561 5T6BA 2IV2X 3GTGI 1VQ7Z 4RVFA 3CMEZ 1NJI2 3FQMA 1M901 3PO3I 2E2HI 1YJ91 3CD6Z 4E31A 2JA5I 1NJI1 1Q811 3G6E1 3CC21 1X0TA 2QREB 2P28A 4DQYB 3CCV1 3NH4A 1YJN1 3TDHB 2OZKA 2E9HA 1VQPZ 4MRIA 2JIQA 1KD12 3CCL1 3HOUI 4QTTA 3I55Z 4BY1I 3CXCZ 3VTNA 2OOYB 1AA6A 1Y1VS 2VF1A 1L1OC 2Q51A 2P3YA 3D2LA 2HU9A 1Z01A 3CCEZ 2V3VA 3M4OI 1VQO1 3EERA 3OW2Z 1ZH1A 1KC82 4CL1A 4NBCA 3F3FC 3MZKB 4MD9A 4DGLA 1X3ZA 4BXXI 3CQZI 2RBLA 4NBAA 1ZB8A 1KRLA 2B63I 3PO3S 1WIIA 2Y0SA 3RZOI 2PM9A 1YI2Z 3CXCY 3GKQA 1QVGZ 2YADA 2R92I 2M48A 3J80b 3CPWY 1ML8A 1KQSZ 2NAPA 4BBSI 1VQMZ 3IFUA 4MONA 3CCS1 1Q862 2JA7I 4AYBA 1N2FA 1Q861 3CCQ1 2WB1A 1VQP1 4DK1A 4EWCA 1P9NA 1SFOI 2W04A 4A3CI 2JIRA 3P5JB 1LQLA 3IF8A 3D6WA 2QR1B 2I3CA 5T67A 1K731 2JUBA 3GTJI 2IZ4A 3CPWZ 1RQFA 3S1QI 5CM2M 3VMIA 1VQNZ 3G4SZ 3GTQI 5AN9F 3G4S1 5D1PA 1Z02A 4XX2A 1M1K1 4TNUA 2J6AA 2W03A 3NH5A 1TFIA 1VQ8Z 5D1OB 4MD8A 4A3II 1QVFZ 4NB9A 3CCJ1 4NBDA 4QTUA 3HOZI 1VQ51 2O53A 2G2KA 1YUKA 2JIPA 3FQQA 3NDJA 2QA41 4RV9A 1S721 2F4OA 4A3GI 4X6AI 1Q822 1NUIA 2JS4A 4A3MI 1QVGY 1K9M2 2R7ZI 4A3JI 2E7ZA 3TE5B 2GU2A 3CCMZ 1JJ2Z 3S14I 3CMAZ 1FDOA 2IZ3A 1Q812 2RT9A 1YHQ1 4HGZA 1YHQZ 2VPZA 3GTPI 3OW2Y 3GTMS 1ZB9A 1N8R2 1VQ71 4A3EI 1VQ91 2JMOA 1I3QI 1Y1WI 1YUAA 3CMA1 3G6EZ 2HF1A 1KD11 3RZDI 3I07A 3BG1B 3PO2I 2EGTA 5C44I 3J80f 1M1K2 3CC4Z 5C3EI 4RS4A 1I50I 2NVXI 2PK7A 3S16I 1QYPA 4NBFA 3S17I 1K732 1W2BY 4Y7NI 4RVHA 1M902 4A3FI 2VPWA 2F4MA 3S1MI 1RNIA 3IX0A 1Q7Y2 2QRDB 4E2WA 3F3PC 4MD7A 3J81b 3GTOI 1TWCI 4A3KI 1Q7Y1 1KQSY
chains in the Genus database with same CATH topology
3BG0B 2K3RA 1W2BZ 3S15I 2RHBA 2R93I 4NBGA 1VQ61 3JAMb 3KIFA 1YI21 3T4NB 3S1RI 1VQN1 3VMGA 1S72Z 2VUMI 2RPRA 3JAMf 3HOXI 4HGYA 2O4HA 1K9M1 2WAQA 4NBEA 4RVGA 2E2II 3Q87A 3CC41 3CCSZ 3U50C 3CCJZ 1VQK1 4Y52I 2GTIA 4NBHA 1KC81 2H85A 1DL6A 3EEDA 3CCR1 2JA6I 1N8R1 2AKLA 4E30A 1X3WA 2E2JI 3LUSA 5IP9I 5FLXb 3I4MI 1JJ2Y 2NVYI 2JA8I 1YITZ 1VQ4Z 1S7MA 1YJNZ 2RIQA 4A93I 2JR6A 2DE6A 2JNYA 3CC7Z 3CCM1 3GTMI 3H3VJ 2NVQI 5LL6f 5T64A 2Q4ZA 1PFTA 1WCMI 3VMHA 1JWHC 3S2HI 2V8IA 2QLVB 2V8JA 1TWAI 1Q821 2QEXZ 3CME1 1VQ6Z 5A2Qf 1RLYA 4MH4A 1QVFY 1K8A1 1TWFI 2VUGA 1USPB 2QA4Z 4E2XA 3GCFA 2LIYA 3CCVZ 4E33A 2GTHA 3M3YI 1VQ41 2OTJ1 2OTJZ 4E32A 4NH1C 5IP7I 3HOWI 3I551 3QWUA 3CD61 1R9TI 2ZAEB 2YU9I 1RO4A 1YJW1 3G71Z 1K8A2 1VQM1 2QEX1 3J81f 4BY7I 1Y1VI 2OTL1 2R6MA 2OTLZ 3MZLB 4NBBA 4NB8A 1VQ9Z 1K83I 2KPIA 2QRCB 3HKZA 4A3LI 3NH8A 4BBRI 1I6HI 2DE7A 3VB9A 1RO2A 4HH4A 5D1OA 3GTKI 3I4NI 4A3DI 1TWGI 3I56Z 5C4JI 4E2ZA 1VQKZ 1VQOZ 2QKDA 4NOZA 5IT9f 2V8KA 2DE5A 3H0GI 3KIHA 1WW9A 1YJ9Z 3GTLI 3S1NI 3CCRZ 2PMZA 3HOVI 3G711 2LFUA 3NDIA 3CC2Z 3S2DI 3FKII 5C4XI 5IT9b 2NVTI 4MXUA 3K7AI 4RVDA 4S1TA 1YIJZ 1YIJ1 4E2YA 3MONA 3J7A4 4A3BI 2BJOA 3CCLZ 2OOXB 5FLXf 1NP6A 2K5RA 3HOYI 1YJWZ 2KI7B 5FLMI 1TWHI 4NFRA 3ESWA 3CCE1 2M6NA 3CCUZ 1YIT1 1VQL1 1VQLZ 3CCU1 3CCQZ 1USPA 3D9XA 3CC71 3NFZA 1VQ81 1RO0A 1QF8A 5A2Qb 1Z03A 1VQ5Z 1VLAA 3I561 5T6BA 3GTGI 1VQ7Z 4RVFA 3CMEZ 1NJI2 3FQMA 1M901 3PO3I 2E2HI 1YJ91 3CD6Z 4E31A 2JA5I 1NJI1 1Q811 3G6E1 3CC21 1X0TA 2QREB 2P28A 4DQYB 3CCV1 3NH4A 1YJN1 3TDHB 2OZKA 2E9HA 1VQPZ 4MRIA 1KD12 3CCL1 3HOUI 4QTTA 3I55Z 4BY1I 3CXCZ 3VTNA 2OOYB 1Y1VS 2VF1A 1L1OC 2Q51A 2P3YA 2HU9A 1Z01A 3CCEZ 3M4OI 1VQO1 3EERA 3OW2Z 1ZH1A 1KC82 4CL1A 4NBCA 3F3FC 3MZKB 4MD9A 4DGLA 1X3ZA 4BXXI 3CQZI 2RBLA 4NBAA 1ZB8A 1KRLA 2B63I 3PO3S 1WIIA 2Y0SA 3RZOI 2PM9A 1YI2Z 3CXCY 3GKQA 1QVGZ 2YADA 2R92I 2M48A 3J80b 3CPWY 1ML8A 1KQSZ 4BBSI 3IFUA 1VQMZ 4MONA 3CCS1 1Q862 2JA7I 4AYBA 1N2FA 1Q861 3CCQ1 2WB1A 1VQP1 4DK1A 4EWCA 1P9NA 1SFOI 2W04A 4A3CI 3P5JB 1LQLA 3IF8A 3D6WA 2QR1B 2I3CA 5T67A 1K731 2JUBA 3GTJI 2IZ4A 3CPWZ 1RQFA 3S1QI 5CM2M 3VMIA 1VQNZ 3G4SZ 3GTQI 5AN9F 3G4S1 5D1PA 1Z02A 4XX2A 1M1K1 4TNUA 2J6AA 2W03A 3NH5A 1TFIA 1VQ8Z 5D1OB 4MD8A 4A3II 1QVFZ 4NB9A 3CCJ1 4NBDA 4QTUA 3HOZI 1VQ51 2O53A 2G2KA 1YUKA 3FQQA 3NDJA 2QA41 4RV9A 1S721 2F4OA 4A3GI 4X6AI 1Q822 1NUIA 2JS4A 4A3MI 1QVGY 1K9M2 2R7ZI 4A3JI 3TE5B 2GU2A 3CCMZ 1JJ2Z 3S14I 3CMAZ 2IZ3A 1Q812 2RT9A 1YHQ1 4HGZA 1YHQZ 3GTPI 3OW2Y 3GTMS 1ZB9A 1N8R2 1VQ71 4A3EI 1VQ91 2JMOA 1I3QI 1Y1WI 1YUAA 3CMA1 3G6EZ 2HF1A 1KD11 3RZDI 3I07A 3BG1B 3PO2I 2EGTA 5C44I 3J80f 1M1K2 3CC4Z 5C3EI 4RS4A 1I50I 2NVXI 2PK7A 3S16I 1QYPA 4NBFA 3S17I 1K732 1W2BY 4Y7NI 4RVHA 1M902 4A3FI 2F4MA 3S1MI 1RNIA 3IX0A 1Q7Y2 2QRDB 4E2WA 3F3PC 4MD7A 3J81b 3GTOI 1TWCI 4A3KI 1Q7Y1 1KQSY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6A A;  1RO4 A;  3S15 I;  1TFI A;  4A3I I;  4NB9 A;  2R93 I;  4NBD A;  4QTU A;  4NBG A;  3HOZ I;  4BY7 I;  1Y1V I;  4NBB A;  4NB8 A;  1K83 I;  2KPI A;  3S1R I;  4A3L I;  3HOU I;  4QTT A;  4BBR I;  3VMG A;  2DE7 A;  3VB9 A;  4BY1 I;  1I6H I;  2VUM I;  2F4O A;  3HOX I;  3GTK I;  1Y1V S;  4A3G I;  4X6A I;  3I4N I;  4A3D I;  4NBE A;  1TWG I;  1L1O C;  2E2I I;  3Q87 A;  2P3Y A;  1NUI A;  2JS4 A;  5C4J I;  3M4O I;  4A3M I;  3U50 C;  2R7Z I;  3EER A;  4NOZ A;  4Y52 I;  4A3J I;  2DE5 A;  3H0G I;  4NBH A;  1WW9 A;  3S1N I;  3GTL I;  3S14 I;  4NBC A;  1DL6 A;  3HOV I;  2JA6 I;  3S2D I;  3FKI I;  5C4X I;  2AKL A;  1X3Z A;  1X3W A;  4BXX I;  2E2J I;  3LUS A;  5IP9 I;  3CQZ I;  2RBL A;  4NBA A;  2NVT I;  3I4M I;  3K7A I;  1ZB8 A;  2NVY I;  2JA8 I;  3GTP I;  2B63 I;  3PO3 S;  3GTM S;  1ZB9 A;  3RZO I;  3GKQ A;  4A3E I;  2R92 I;  4A3B I;  4A93 I;  2BJO A;  2JR6 A;  2DE6 A;  2JNY A;  1I3Q I;  3GTM I;  3H3V J;  1Y1W I;  1YUA A;  2NVQ I;  2K5R A;  1ML8 A;  3HOY I;  1PFT A;  2HF1 A;  3RZD I;  4BBS I;  1WCM I;  3VMH A;  3S2H I;  3I07 A;  1TWH I;  5FLM I;  3PO2 I;  5C44 I;  3ESW A;  1TWA I;  5C3E I;  2JA7 I;  1N2F A;  1RLY A;  4MH4 A;  1I50 I;  2NVX I;  1USP A;  2PK7 A;  3S16 I;  1TWF I;  1QYP A;  1SFO I;  4NBF A;  3S17 I;  4A3C I;  1USP B;  4Y7N I;  1LQL A;  3GCF A;  4A3F I;  2JA5 I;  3D6W A;  2F4M A;  1VLA A;  3M3Y I;  3GTG I;  3GTJ I;  3S1M I;  5IP7 I;  3S1Q I;  5CM2 M;  3VMI A;  3PO3 I;  3GTQ I;  2E2H I;  3HOW I;  3GTO I;  4XX2 A;  1R9T I;  1TWC I;  2YU9 I;  4A3K I; 
#chains in the Genus database with same CATH topology
 3BG0 B;  2K3R A;  1W2B Z;  3S15 I;  1WZN A;  2RHB A;  2R93 I;  4NBG A;  1VQ6 1;  3JAM b;  3KIF A;  3IR7 A;  1YI2 1;  3T4N B;  2V45 A;  3S1R I;  2LEX A;  1VQN 1;  3VMG A;  1S72 Z;  2VUM I;  2RPR A;  3JAM f;  3HOX I;  1Q16 A;  4HGY A;  2O4H A;  1K9M 1;  2WAQ A;  4NBE A;  4RVG A;  2E2I I;  3Q87 A;  3CC4 1;  3CCS Z;  3U50 C;  3CCJ Z;  1VQK 1;  4Y52 I;  2GTI A;  4NBH A;  1KC8 1;  2H85 A;  1DL6 A;  3EED A;  3CCR 1;  2VPY A;  2JA6 I;  1N8R 1;  2AKL A;  4E30 A;  1X3W A;  2E2J I;  3LUS A;  5IP9 I;  5FLX b;  3I4M I;  1JJ2 Y;  2NVY I;  2JA8 I;  1YIT Z;  2AYD A;  1VQ4 Z;  1S7M A;  1YJN Z;  2RIQ A;  4A93 I;  2JIM A;  2JR6 A;  2DE6 A;  2JNY A;  3CC7 Z;  1FDI A;  3CCM 1;  3GTM I;  3H3V J;  2NVQ I;  5LL6 f;  5T64 A;  2Q4Z A;  1PFT A;  1WCM I;  3VMH A;  1JWH C;  3S2H I;  2V8I A;  2QLV B;  1WJ2 A;  2V8J A;  1TWA I;  1Q82 1;  2QEX Z;  3CME 1;  1VQ6 Z;  5A2Q f;  1RLY A;  4MH4 A;  2JIO A;  1QVF Y;  1K8A 1;  1TWF I;  2VUG A;  1USP B;  1Y8C A;  2QA4 Z;  4E2X A;  3GCF A;  2LIY A;  3CCV Z;  4E33 A;  2GTH A;  3M3Y I;  1VQ4 1;  2OTJ 1;  2OTJ Z;  4E32 A;  4NH1 C;  5IP7 I;  3HOW I;  3I55 1;  3QWU A;  3CD6 1;  1R9T I;  2ZAE B;  2YU9 I;  1RO4 A;  2VPX A;  1YJW 1;  3G71 Z;  1K8A 2;  1VQM 1;  2QEX 1;  3J81 f;  4BY7 I;  1Y1V I;  2OTL 1;  2R6M A;  2OTL Z;  3MZL B;  4NBB A;  4NB8 A;  1VQ9 Z;  1K83 I;  2KPI A;  2QRC B;  3HKZ A;  4A3L I;  3NH8 A;  4BBR I;  1I6H I;  2DE7 A;  3VB9 A;  1RO2 A;  4HH4 A;  5D1O A;  3GTK I;  3I4N I;  4A3D I;  1TWG I;  3I56 Z;  5C4J I;  4E2Z A;  1VQK Z;  1VQO Z;  2QKD A;  4NOZ A;  5IT9 f;  2V8K A;  2DE5 A;  3H0G I;  3KIH A;  1WW9 A;  1YJ9 Z;  3GTL I;  3S1N I;  3CCR Z;  2PMZ A;  3HOV I;  3G71 1;  2LFU A;  3NDI A;  3CC2 Z;  3S2D I;  3FKI I;  5C4X I;  5IT9 b;  2NVT I;  4MXU A;  3K7A I;  4RVD A;  4S1T A;  1YIJ Z;  1YIJ 1;  4E2Y A;  3MON A;  3J7A 4;  4A3B I;  2BJO A;  3CCL Z;  2OOX B;  5FLX f;  1NP6 A;  2K5R A;  3HOY I;  1YJW Z;  2KI7 B;  5FLM I;  1TWH I;  4NFR A;  3ESW A;  3CCE 1;  2M6N A;  3CCU Z;  1YIT 1;  1VQL 1;  3CCU 1;  1VQL Z;  3CCQ Z;  1USP A;  3D9X A;  1SIW A;  3CC7 1;  3NFZ A;  1VQ8 1;  1RO0 A;  1QF8 A;  5A2Q b;  1Z03 A;  1QXF A;  1VQ5 Z;  1VLA A;  3I56 1;  5T6B A;  2IV2 X;  3GTG I;  1VQ7 Z;  4RVF A;  3CME Z;  1NJI 2;  3FQM A;  1M90 1;  3PO3 I;  2E2H I;  1YJ9 1;  3CD6 Z;  4E31 A;  2JA5 I;  1NJI 1;  1Q81 1;  3G6E 1;  3CC2 1;  1X0T A;  2QRE B;  2P28 A;  4DQY B;  3CCV 1;  3NH4 A;  1YJN 1;  3TDH B;  2OZK A;  2E9H A;  1VQP Z;  4MRI A;  2JIQ A;  1KD1 2;  3CCL 1;  3HOU I;  4QTT A;  3I55 Z;  4BY1 I;  3CXC Z;  3VTN A;  2OOY B;  1AA6 A;  1Y1V S;  2VF1 A;  1L1O C;  2Q51 A;  2P3Y A;  3D2L A;  2HU9 A;  1Z01 A;  3CCE Z;  2V3V A;  3M4O I;  1VQO 1;  3EER A;  3OW2 Z;  1ZH1 A;  1KC8 2;  4CL1 A;  4NBC A;  3F3F C;  3MZK B;  4MD9 A;  4DGL A;  1X3Z A;  4BXX I;  3CQZ I;  2RBL A;  4NBA A;  1ZB8 A;  1KRL A;  2B63 I;  3PO3 S;  1WII A;  2Y0S A;  3RZO I;  2PM9 A;  1YI2 Z;  3CXC Y;  3GKQ A;  1QVG Z;  2YAD A;  2R92 I;  2M48 A;  3J80 b;  3CPW Y;  1ML8 A;  1KQS Z;  2NAP A;  4BBS I;  1VQM Z;  3IFU A;  4MON A;  3CCS 1;  1Q86 2;  2JA7 I;  4AYB A;  1N2F A;  1Q86 1;  3CCQ 1;  2WB1 A;  1VQP 1;  4DK1 A;  4EWC A;  1P9N A;  1SFO I;  2W04 A;  4A3C I;  2JIR A;  3P5J B;  1LQL A;  3IF8 A;  3D6W A;  2QR1 B;  2I3C A;  5T67 A;  1K73 1;  2JUB A;  3GTJ I;  2IZ4 A;  3CPW Z;  1RQF A;  3S1Q I;  5CM2 M;  3VMI A;  1VQN Z;  3G4S Z;  3GTQ I;  5AN9 F;  3G4S 1;  5D1P A;  1Z02 A;  4XX2 A;  1M1K 1;  4TNU A;  2J6A A;  2W03 A;  3NH5 A;  1TFI A;  1VQ8 Z;  5D1O B;  4MD8 A;  4A3I I;  1QVF Z;  4NB9 A;  3CCJ 1;  4NBD A;  4QTU A;  3HOZ I;  1VQ5 1;  2O53 A;  2G2K A;  1YUK A;  2JIP A;  3FQQ A;  3NDJ A;  2QA4 1;  4RV9 A;  1S72 1;  2F4O A;  4A3G I;  4X6A I;  1Q82 2;  1NUI A;  2JS4 A;  4A3M I;  1QVG Y;  1K9M 2;  2R7Z I;  4A3J I;  2E7Z A;  3TE5 B;  2GU2 A;  3CCM Z;  1JJ2 Z;  3S14 I;  3CMA Z;  1FDO A;  2IZ3 A;  1Q81 2;  2RT9 A;  1YHQ 1;  4HGZ A;  1YHQ Z;  2VPZ A;  3GTP I;  3OW2 Y;  3GTM S;  1ZB9 A;  1N8R 2;  1VQ7 1;  4A3E I;  1VQ9 1;  2JMO A;  1I3Q I;  1Y1W I;  1YUA A;  3CMA 1;  3G6E Z;  2HF1 A;  1KD1 1;  3RZD I;  3I07 A;  3BG1 B;  3PO2 I;  2EGT A;  5C44 I;  3J80 f;  1M1K 2;  3CC4 Z;  5C3E I;  4RS4 A;  1I50 I;  2NVX I;  2PK7 A;  3S16 I;  1QYP A;  4NBF A;  3S17 I;  1K73 2;  1W2B Y;  4Y7N I;  4RVH A;  1M90 2;  4A3F I;  2VPW A;  2F4M A;  3S1M I;  1RNI A;  3IX0 A;  1Q7Y 2;  2QRD B;  4E2W A;  3F3P C;  4MD7 A;  3J81 b;  3GTO I;  1TWC I;  4A3K I;  1Q7Y 1;  1KQS Y; 
#chains in the Genus database with same CATH homology
 3BG0 B;  2K3R A;  1W2B Z;  3S15 I;  2RHB A;  2R93 I;  4NBG A;  1VQ6 1;  3JAM b;  3KIF A;  1YI2 1;  3T4N B;  3S1R I;  1VQN 1;  3VMG A;  1S72 Z;  2VUM I;  2RPR A;  3JAM f;  3HOX I;  4HGY A;  2O4H A;  1K9M 1;  2WAQ A;  4NBE A;  4RVG A;  2E2I I;  3Q87 A;  3CC4 1;  3CCS Z;  3U50 C;  3CCJ Z;  1VQK 1;  4Y52 I;  2GTI A;  4NBH A;  1KC8 1;  2H85 A;  1DL6 A;  3EED A;  3CCR 1;  2JA6 I;  1N8R 1;  2AKL A;  4E30 A;  1X3W A;  2E2J I;  3LUS A;  5IP9 I;  5FLX b;  3I4M I;  1JJ2 Y;  2NVY I;  2JA8 I;  1YIT Z;  1VQ4 Z;  1S7M A;  1YJN Z;  2RIQ A;  4A93 I;  2JR6 A;  2DE6 A;  2JNY A;  3CC7 Z;  3CCM 1;  3GTM I;  3H3V J;  2NVQ I;  5LL6 f;  5T64 A;  2Q4Z A;  1PFT A;  1WCM I;  3VMH A;  1JWH C;  3S2H I;  2V8I A;  2QLV B;  2V8J A;  1TWA I;  1Q82 1;  2QEX Z;  3CME 1;  1VQ6 Z;  5A2Q f;  1RLY A;  4MH4 A;  1QVF Y;  1K8A 1;  1TWF I;  2VUG A;  1USP B;  2QA4 Z;  4E2X A;  3GCF A;  2LIY A;  3CCV Z;  4E33 A;  2GTH A;  3M3Y I;  1VQ4 1;  2OTJ 1;  2OTJ Z;  4E32 A;  4NH1 C;  5IP7 I;  3HOW I;  3I55 1;  3QWU A;  3CD6 1;  1R9T I;  2ZAE B;  2YU9 I;  1RO4 A;  1YJW 1;  3G71 Z;  1K8A 2;  1VQM 1;  2QEX 1;  3J81 f;  4BY7 I;  1Y1V I;  2OTL 1;  2R6M A;  2OTL Z;  3MZL B;  4NBB A;  4NB8 A;  1VQ9 Z;  1K83 I;  2KPI A;  2QRC B;  3HKZ A;  4A3L I;  3NH8 A;  4BBR I;  1I6H I;  2DE7 A;  3VB9 A;  1RO2 A;  4HH4 A;  5D1O A;  3GTK I;  3I4N I;  4A3D I;  1TWG I;  3I56 Z;  5C4J I;  4E2Z A;  1VQK Z;  1VQO Z;  2QKD A;  4NOZ A;  5IT9 f;  2V8K A;  2DE5 A;  3H0G I;  3KIH A;  1WW9 A;  1YJ9 Z;  3GTL I;  3S1N I;  3CCR Z;  2PMZ A;  3HOV I;  3G71 1;  2LFU A;  3NDI A;  3CC2 Z;  3S2D I;  3FKI I;  5C4X I;  5IT9 b;  2NVT I;  4MXU A;  3K7A I;  4RVD A;  4S1T A;  1YIJ Z;  1YIJ 1;  4E2Y A;  3MON A;  3J7A 4;  4A3B I;  2BJO A;  3CCL Z;  2OOX B;  5FLX f;  1NP6 A;  2K5R A;  3HOY I;  1YJW Z;  2KI7 B;  5FLM I;  1TWH I;  4NFR A;  3ESW A;  3CCE 1;  2M6N A;  3CCU Z;  1YIT 1;  1VQL 1;  1VQL Z;  3CCU 1;  3CCQ Z;  1USP A;  3D9X A;  3CC7 1;  3NFZ A;  1VQ8 1;  1RO0 A;  1QF8 A;  5A2Q b;  1Z03 A;  1VQ5 Z;  1VLA A;  3I56 1;  5T6B A;  3GTG I;  1VQ7 Z;  4RVF A;  3CME Z;  1NJI 2;  3FQM A;  1M90 1;  3PO3 I;  2E2H I;  1YJ9 1;  3CD6 Z;  4E31 A;  2JA5 I;  1NJI 1;  1Q81 1;  3G6E 1;  3CC2 1;  1X0T A;  2QRE B;  2P28 A;  4DQY B;  3CCV 1;  3NH4 A;  1YJN 1;  3TDH B;  2OZK A;  2E9H A;  1VQP Z;  4MRI A;  1KD1 2;  3CCL 1;  3HOU I;  4QTT A;  3I55 Z;  4BY1 I;  3CXC Z;  3VTN A;  2OOY B;  1Y1V S;  2VF1 A;  1L1O C;  2Q51 A;  2P3Y A;  2HU9 A;  1Z01 A;  3CCE Z;  3M4O I;  1VQO 1;  3EER A;  3OW2 Z;  1ZH1 A;  1KC8 2;  4CL1 A;  4NBC A;  3F3F C;  3MZK B;  4MD9 A;  4DGL A;  1X3Z A;  4BXX I;  3CQZ I;  2RBL A;  4NBA A;  1ZB8 A;  1KRL A;  2B63 I;  3PO3 S;  1WII A;  2Y0S A;  3RZO I;  2PM9 A;  1YI2 Z;  3CXC Y;  3GKQ A;  1QVG Z;  2YAD A;  2R92 I;  2M48 A;  3J80 b;  3CPW Y;  1ML8 A;  1KQS Z;  4BBS I;  3IFU A;  1VQM Z;  4MON A;  3CCS 1;  1Q86 2;  2JA7 I;  4AYB A;  1N2F A;  1Q86 1;  3CCQ 1;  2WB1 A;  1VQP 1;  4DK1 A;  4EWC A;  1P9N A;  1SFO I;  2W04 A;  4A3C I;  3P5J B;  1LQL A;  3IF8 A;  3D6W A;  2QR1 B;  2I3C A;  5T67 A;  1K73 1;  2JUB A;  3GTJ I;  2IZ4 A;  3CPW Z;  1RQF A;  3S1Q I;  5CM2 M;  3VMI A;  1VQN Z;  3G4S Z;  3GTQ I;  5AN9 F;  3G4S 1;  5D1P A;  1Z02 A;  4XX2 A;  1M1K 1;  4TNU A;  2J6A A;  2W03 A;  3NH5 A;  1TFI A;  1VQ8 Z;  5D1O B;  4MD8 A;  4A3I I;  1QVF Z;  4NB9 A;  3CCJ 1;  4NBD A;  4QTU A;  3HOZ I;  1VQ5 1;  2O53 A;  2G2K A;  1YUK A;  3FQQ A;  3NDJ A;  2QA4 1;  4RV9 A;  1S72 1;  2F4O A;  4A3G I;  4X6A I;  1Q82 2;  1NUI A;  2JS4 A;  4A3M I;  1QVG Y;  1K9M 2;  2R7Z I;  4A3J I;  3TE5 B;  2GU2 A;  3CCM Z;  1JJ2 Z;  3S14 I;  3CMA Z;  2IZ3 A;  1Q81 2;  2RT9 A;  1YHQ 1;  4HGZ A;  1YHQ Z;  3GTP I;  3OW2 Y;  3GTM S;  1ZB9 A;  1N8R 2;  1VQ7 1;  4A3E I;  1VQ9 1;  2JMO A;  1I3Q I;  1Y1W I;  1YUA A;  3CMA 1;  3G6E Z;  2HF1 A;  1KD1 1;  3RZD I;  3I07 A;  3BG1 B;  3PO2 I;  2EGT A;  5C44 I;  3J80 f;  1M1K 2;  3CC4 Z;  5C3E I;  4RS4 A;  1I50 I;  2NVX I;  2PK7 A;  3S16 I;  1QYP A;  4NBF A;  3S17 I;  1K73 2;  1W2B Y;  4Y7N I;  4RVH A;  1M90 2;  4A3F I;  2F4M A;  3S1M I;  1RNI A;  3IX0 A;  1Q7Y 2;  2QRD B;  4E2W A;  3F3P C;  4MD7 A;  3J81 b;  3GTO I;  1TWC I;  4A3K I;  1Q7Y 1;  1KQS Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...