1Y1VS

Refined rna polymerase ii-tfiis complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
174
structure length
174
Chain Sequence
NDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 8
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vS01
3PO3S 2JA8I 2JA7I 3K7AI 4Y52I 3S1MI 5CM2M 2B63I 4NOZA 4QTUA 1NUIA 2JA5I 4A3LI 1I6HI 1L1OC 3GCFA 3S17I 3EERA 1WW9A 3GTJI 3I4MI 4A3MI 3M4OI 1I50I 2P3YA 3GTLI 3S1QI 4A3GI 1VLAA 3VMIA 4MH4A 2R7ZI 3HOYI 3S2DI 1R9TI 4NB8A 2DE7A 4NBAA 4Y7NI 4BY7I 4A3II 5C4XI 4BY1I 2RBLA 1Y1VS 4A3CI 3HOZI 3HOVI 3H0GI 2F4OA 3VMGA 3H3VJ 1ZB9A 1DL6A 2K5RA 3D6WA 3S15I 2BJOA 3CQZI 4NBFA 2KPIA 4NBHA 5FLMI 1USPA 2F4MA 1LQLA 3GTQI 3GTMI 2VUMI 2DE6A 4NBEA 2JR6A 1YUAA 3FKII 1WCMI 3HOXI 3VB9A 2E2JI 1TWAI 1K83I 5C3EI 1RLYA 3I07A 4A93I 3PO3I 2NVYI 1PFTA 3I4NI 3PO2I 1X3WA 3RZOI 1USPB 4X6AI 2HF1A 2YU9I 3GTPI 4QTTA 2DE5A 2J6AA 1TWHI 2AKLA 3GTOI 1Y1WI 3GKQA 1RO4A 4NB9A 3ESWA 1SFOI 4A3BI 1N2FA 1TWGI 4BXXI 2JS4A 1TFIA 3HOUI 2NVXI 1TWCI 4NBDA 5IP7I 3GTKI 2E2HI 3Q87A 1X3ZA 4XX2A 3S2HI 3RZDI 4A3DI 2R93I 4NBGA 5IP9I 2NVQI 3S14I 4BBSI 3S1RI 2R92I 4NBCA 1Y1VI 3HOWI 3U50C 1QYPA 3VMHA 2PK7A 3GTGI 5C4JI 4A3EI 2E2II 1ZB8A 3LUSA 2JA6I 2NVTI 4NBBA 5C44I 3GTMS 2JNYA 3S16I 3M3YI 4A3KI 1I3QI 1TWFI 1ML8A 3S1NI 4A3FI 4BBRI 4A3JI
chains in the Genus database with same CATH superfamily
1YIJZ 2JIRA 3S1MI 3I561 4TNUA 5T64A 2QA41 4E2WA 1I6HI 3I56Z 3T4NB 2QEX1 3CCU1 2H85A 2QRDB 3CC4Z 1S72Z 1WW9A 3GTJI 3GTLI 2Q4ZA 1RO0A 3CD6Z 4HGZA 3CC7Z 2QR1B 1JJ2Y 5IT9f 3TDHB 2OTLZ 4DGLA 3TE5B 1NJI2 4HH4A 2K3RA 4A3CI 1JWHC 2F4OA 3H3VJ 1M902 1X0TA 1Q812 3D6WA 2YADA 1VQNZ 4NBFA 3BG0B 3IR7A 1USPA 3CCJ1 1WZNA 1K8A1 2VUMI 2DE6A 2JUBA 3FKII 2E2JI 1VQO1 1K83I 2OTJ1 3I4NI 2LEXA 1K8A2 5LL6f 1USPB 4X6AI 1VQ5Z 2WAQA 4DQYB 2ZAEB 4QTTA 3CMAZ 2J6AA 3CMEZ 1TWHI 2V3VA 3GTOI 1YJ9Z 4RS4A 2G2KA 1RO4A 1Q822 3KIFA 1SFOI 1RQFA 1AA6A 1M1K1 3HOUI 2NVXI 5IP7I 4XX2A 3S2HI 1YJWZ 3RZDI 2VUGA 2NVQI 4BBSI 2WB1A 5D1OA 3U50C 1QYPA 4MXUA 3VMHA 3F3PC 3MONA 3GTGI 3G4SZ 5A2Qf 3EEDA 3CC2Z 2KI7B 3P5JB 3GTMS 3IF8A 1ML8A 1Z02A 4A3FI 4A3JI 3CCLZ 5AN9F 1FDOA 3VTNA 4E2YA 1K9M2 2VF1A 1VQ81 4QTUA 2HU9A 1VQ6Z 1L1OC 3I55Z 2M6NA 1VQ7Z 3I4MI 2I3CA 1VQ91 2P3YA 3MZKB 1VLAA 3F3FC 4NH1C 4E2XA 1VQPZ 3HOYI 2R7ZI 4RVFA 3CXCY 1Q7Y2 2VPYA 4E31A 2DE7A 2RHBA 1JJ2Z 1VQLZ 5C4XI 3CCQZ 5IT9b 2RBLA 2VPWA 3JAMf 3HOVI 1RO2A 3IX0A 1N8R1 1YI21 2K5RA 2QA4Z 3OW2Z 1RNIA 3GTMI 1YUKA 2QEXZ 3CCUZ 4NBEA 2RT9A 2E9HA 3HOXI 1NP6A 3VB9A 1S7MA 5C3EI 4A93I 3CCS1 1X3WA 3G711 1QVFY 3D9XA 3NDJA 2DE5A 2LFUA 3G71Z 2PM9A 3CCV1 3GKQA 4NFRA 3ESWA 3KIHA 1TWGI 1TFIA 4E33A 2JIPA 1Z01A 3CCJZ 2O53A 4NBDA 3G6E1 2M48A 1X3ZA 4A3DI 3S14I 2V8JA 1VQOZ 2R92I 4NBCA 3J7A4 2OTJZ 2PK7A 2EGTA 1YIT1 1ZB8A 3LUSA 2O4HA 2JIQA 5A2Qb 1WJ2A 5C44I 2OOXB 3CPWZ 1TWFI 2IZ3A 2PMZA 4BBRI 3PO3S 2V8IA 1KQSY 1Q16A 1QVGZ 1KD11 2JA8I 3BG1B 2B63I 4NOZA 1NUIA 1M1K2 2JA5I 1Z03A 4E30A 1KRLA 2IZ4A 1YHQ1 4RVDA 1VQK1 3VMIA 5D1OB 3S2DI 1R9TI 4Y7NI 1QF8A 3CCE1 4BY7I 2QRCB 3MZLB 1Y1VS 3HOZI 3H0GI 1YJN1 1DL6A 3JAMb 1VQ8Z 2RPRA 1Q861 2KPIA 5FLMI 2JIMA 2F4MA 1YJNZ 1LQLA 3GTQI 1KC81 1W2BY 4RVHA 2JR6A 1WCMI 1VQ9Z 1TWAI 3I07A 2OZKA 3PO3I 1PFTA 2NVYI 3NH8A 3PO2I 4RV9A 1P9NA 2HF1A 3GTPI 1QVFZ 1VQM1 2P28A 3CCR1 3CCM1 4NB9A 4EWCA 3NH4A 1YI2Z 2Q51A 4BXXI 1YIJ1 1N8R2 4MRIA 1SIWA 1TWCI 5T6BA 2E2HI 1Y8CA 4DK1A 3Q87A 2QKDA 5IP9I 3S1RI 1Y1VI 3CC41 3HOWI 1VQ41 1S721 3CCSZ 5C4JI 1VQ4Z 2E2II 3CD61 3FQQA 2LIYA 4MD9A 3FQMA 3J81f 3CC71 5FLXf 1NJI1 2JNYA 3D2LA 3M3YI 4A3KI 3CCVZ 1I3QI 2OTL1 2QLVB 2R6MA 2W03A 3S1NI 1M901 3HKZA 1Q811 2RIQA 2GU2A 1KQSZ 2JIOA 4AYBA 4CL1A 3G6EZ 3K7AI 2JA7I 4Y52I 5CM2M 1VQN1 4A3LI 2VPXA 2V45A 3OW2Y 3GCFA 3S17I 3EERA 2E7ZA 4A3MI 3J80b 3M4OI 1I50I 1YITZ 3S1QI 4A3GI 4MH4A 4HGYA 4S1TA 4MD8A 3NH5A 1VQ51 4NB8A 4NBAA 1K731 4A3II 3CME1 3CMA1 4BY1I 1Q821 1YJ91 4E32A 3VMGA 1ZB9A 2GTIA 1K732 3S15I 2VPZA 3NFZA 1KD12 2BJOA 5D1PA 2OOYB 3CQZI 3J80f 2IV2X 4NBHA 3NDIA 2GTHA 1YJW1 1YHQZ 4MD7A 1W2BZ 1YUAA 1RLYA 1VQKZ 3CXCZ 3RZOI 3G4S1 3CCEZ 3CC21 2YU9I 1ZH1A 3QWUA 4MONA 2AKLA 2AYDA 3IFUA 1FDIA 1Y1WI 3CPWY 1K9M1 4A3BI 1N2FA 3CCL1 2JS4A 2V8KA 1QVGY 3GTKI 1Q862 2R93I 2Y0SA 4NBGA 4RVGA 2JMOA 1VQ61 1KC82 5T67A 3I551 1VQ71 1Q7Y1 1WIIA 4A3EI 2QREB 1VQP1 2JA6I 2NVTI 4E2ZA 1VQMZ 4NBBA 3S16I 3J81b 3CCRZ 3CCMZ 2W04A 1VQL1 1QXFA 5FLXb 3CCQ1 2NAPA
chains in the Genus database with same CATH topology
1YIJZ 3S1MI 3I561 4TNUA 5T64A 2QA41 4E2WA 1I6HI 3I56Z 3T4NB 2QEX1 3CCU1 2H85A 2QRDB 3CC4Z 1S72Z 1WW9A 3GTJI 3GTLI 2Q4ZA 1RO0A 3CD6Z 4HGZA 3CC7Z 2QR1B 1JJ2Y 5IT9f 3TDHB 2OTLZ 4DGLA 3TE5B 1NJI2 4HH4A 2K3RA 4A3CI 1JWHC 2F4OA 3H3VJ 1M902 1X0TA 1Q812 3D6WA 2YADA 1VQNZ 4NBFA 3BG0B 1USPA 3CCJ1 1K8A1 2VUMI 2DE6A 2JUBA 3FKII 2E2JI 1VQO1 1K83I 2OTJ1 3I4NI 1K8A2 5LL6f 1USPB 4X6AI 1VQ5Z 2WAQA 4DQYB 2ZAEB 4QTTA 3CMAZ 2J6AA 3CMEZ 1TWHI 3GTOI 1YJ9Z 4RS4A 2G2KA 1RO4A 1Q822 3KIFA 1SFOI 1RQFA 1M1K1 3HOUI 2NVXI 5IP7I 4XX2A 3S2HI 1YJWZ 3RZDI 2VUGA 2NVQI 4BBSI 2WB1A 5D1OA 3U50C 1QYPA 4MXUA 3VMHA 3F3PC 3MONA 3GTGI 3G4SZ 5A2Qf 3EEDA 3CC2Z 2KI7B 3P5JB 3GTMS 3IF8A 1ML8A 1Z02A 4A3FI 4A3JI 3CCLZ 5AN9F 3VTNA 1K9M2 4E2YA 2VF1A 1VQ81 4QTUA 2HU9A 1VQ6Z 1L1OC 3I55Z 2M6NA 1VQ7Z 3I4MI 2I3CA 1VQ91 2P3YA 3MZKB 1VLAA 3F3FC 4NH1C 4E2XA 1VQPZ 3HOYI 2R7ZI 4RVFA 3CXCY 1Q7Y2 4E31A 2DE7A 2RHBA 1JJ2Z 1VQLZ 5C4XI 3CCQZ 5IT9b 2RBLA 3JAMf 3HOVI 1RO2A 3IX0A 1N8R1 1YI21 2K5RA 2QA4Z 3OW2Z 1RNIA 3GTMI 1YUKA 2QEXZ 3CCUZ 4NBEA 2RT9A 2E9HA 3HOXI 1NP6A 3VB9A 1S7MA 5C3EI 4A93I 3CCS1 1X3WA 3G711 1QVFY 3D9XA 3NDJA 2DE5A 2LFUA 3G71Z 2PM9A 3CCV1 3GKQA 4NFRA 3ESWA 3KIHA 1TWGI 1TFIA 4E33A 1Z01A 3CCJZ 2O53A 4NBDA 3G6E1 2M48A 1X3ZA 4A3DI 3S14I 2V8JA 1VQOZ 2R92I 4NBCA 3J7A4 2OTJZ 2PK7A 2EGTA 1YIT1 1ZB8A 3LUSA 2O4HA 5A2Qb 5C44I 2OOXB 3CPWZ 1TWFI 2IZ3A 2PMZA 4BBRI 3PO3S 2V8IA 1KQSY 1KD11 1QVGZ 2JA8I 3BG1B 2B63I 4NOZA 1NUIA 1M1K2 2JA5I 1Z03A 4E30A 1KRLA 2IZ4A 1YHQ1 4RVDA 1VQK1 3VMIA 5D1OB 3S2DI 1R9TI 4Y7NI 1QF8A 3CCE1 4BY7I 2QRCB 3MZLB 1Y1VS 3HOZI 3H0GI 1YJN1 1DL6A 3JAMb 1VQ8Z 2RPRA 1Q861 2KPIA 5FLMI 2F4MA 1YJNZ 1LQLA 3GTQI 1KC81 1W2BY 4RVHA 2JR6A 1VQ9Z 1WCMI 1TWAI 3I07A 2OZKA 3PO3I 1PFTA 2NVYI 3NH8A 3PO2I 4RV9A 1P9NA 2HF1A 3GTPI 1QVFZ 1VQM1 2P28A 3CCR1 3CCM1 4NB9A 4EWCA 3NH4A 1YI2Z 2Q51A 4BXXI 1YIJ1 1N8R2 4MRIA 1TWCI 5T6BA 2E2HI 4DK1A 3Q87A 2QKDA 5IP9I 3S1RI 1Y1VI 3CC41 3HOWI 1VQ41 1S721 3CCSZ 5C4JI 1VQ4Z 2E2II 3CD61 3FQQA 2LIYA 4MD9A 3FQMA 3J81f 3CC71 5FLXf 1NJI1 2JNYA 3M3YI 4A3KI 3CCVZ 1I3QI 2OTL1 2QLVB 2R6MA 2W03A 3S1NI 1M901 3HKZA 1Q811 2RIQA 2GU2A 1KQSZ 4AYBA 4CL1A 2JA7I 3G6EZ 3K7AI 4Y52I 5CM2M 1VQN1 4A3LI 3OW2Y 3GCFA 3S17I 3EERA 4A3MI 3J80b 3M4OI 1I50I 1YITZ 3S1QI 4A3GI 4MH4A 4HGYA 4S1TA 4MD8A 3NH5A 1VQ51 4NB8A 4NBAA 1K731 4A3II 3CME1 3CMA1 4BY1I 1Q821 1YJ91 4E32A 3VMGA 1ZB9A 2GTIA 1K732 3S15I 3NFZA 1KD12 2BJOA 5D1PA 2OOYB 3CQZI 3J80f 4NBHA 3NDIA 2GTHA 1YJW1 1YHQZ 4MD7A 1W2BZ 1YUAA 1RLYA 1VQKZ 3CXCZ 3RZOI 3G4S1 3CCEZ 3CC21 2YU9I 1ZH1A 3QWUA 4MONA 2AKLA 3IFUA 1Y1WI 3CPWY 1K9M1 4A3BI 1N2FA 3CCL1 2JS4A 2V8KA 1QVGY 3GTKI 1Q862 2R93I 2Y0SA 4NBGA 4RVGA 2JMOA 1VQ61 1KC82 5T67A 3I551 1VQ71 1Q7Y1 1WIIA 4A3EI 2QREB 1VQP1 2JA6I 2NVTI 4E2ZA 1VQMZ 4NBBA 3S16I 3J81b 3CCRZ 3CCMZ 2W04A 1VQL1 5FLXb 3CCQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 S;  2JA8 I;  2JA7 I;  3K7A I;  4Y52 I;  3S1M I;  5CM2 M;  2B63 I;  4NOZ A;  4QTU A;  1NUI A;  2JA5 I;  4A3L I;  1I6H I;  1L1O C;  3GCF A;  3S17 I;  3EER A;  1WW9 A;  3GTJ I;  3I4M I;  4A3M I;  3M4O I;  1I50 I;  2P3Y A;  3GTL I;  3S1Q I;  4A3G I;  1VLA A;  3VMI A;  4MH4 A;  2R7Z I;  3HOY I;  3S2D I;  1R9T I;  4NB8 A;  2DE7 A;  4NBA A;  4Y7N I;  4BY7 I;  4A3I I;  5C4X I;  4BY1 I;  2RBL A;  1Y1V S;  4A3C I;  3HOZ I;  3HOV I;  3H0G I;  2F4O A;  3VMG A;  3H3V J;  1ZB9 A;  1DL6 A;  2K5R A;  3D6W A;  3S15 I;  2BJO A;  3CQZ I;  4NBF A;  2KPI A;  4NBH A;  5FLM I;  1USP A;  2F4M A;  1LQL A;  3GTQ I;  3GTM I;  2VUM I;  2DE6 A;  4NBE A;  2JR6 A;  1YUA A;  3FKI I;  1WCM I;  3HOX I;  3VB9 A;  2E2J I;  1TWA I;  1K83 I;  5C3E I;  1RLY A;  3I07 A;  4A93 I;  3PO3 I;  2NVY I;  1PFT A;  3I4N I;  3PO2 I;  1X3W A;  3RZO I;  1USP B;  4X6A I;  2HF1 A;  2YU9 I;  3GTP I;  4QTT A;  2DE5 A;  2J6A A;  1TWH I;  2AKL A;  3GTO I;  1Y1W I;  3GKQ A;  1RO4 A;  4NB9 A;  3ESW A;  1SFO I;  4A3B I;  1N2F A;  1TWG I;  4BXX I;  2JS4 A;  1TFI A;  3HOU I;  2NVX I;  1TWC I;  4NBD A;  5IP7 I;  3GTK I;  2E2H I;  3Q87 A;  1X3Z A;  4XX2 A;  3S2H I;  3RZD I;  4A3D I;  2R93 I;  4NBG A;  5IP9 I;  2NVQ I;  3S14 I;  4BBS I;  3S1R I;  2R92 I;  4NBC A;  1Y1V I;  3HOW I;  3U50 C;  1QYP A;  3VMH A;  2PK7 A;  3GTG I;  5C4J I;  4A3E I;  2E2I I;  1ZB8 A;  3LUS A;  2JA6 I;  2NVT I;  4NBB A;  5C44 I;  3GTM S;  2JNY A;  3S16 I;  3M3Y I;  4A3K I;  1I3Q I;  1TWF I;  1ML8 A;  3S1N I;  4A3F I;  4BBR I;  4A3J I; 
#chains in the Genus database with same CATH topology
 1YIJ Z;  2JIR A;  3S1M I;  3I56 1;  4TNU A;  5T64 A;  2QA4 1;  4E2W A;  1I6H I;  3I56 Z;  3T4N B;  2QEX 1;  3CCU 1;  2H85 A;  2QRD B;  3CC4 Z;  1S72 Z;  1WW9 A;  3GTJ I;  3GTL I;  2Q4Z A;  1RO0 A;  3CD6 Z;  4HGZ A;  3CC7 Z;  2QR1 B;  1JJ2 Y;  5IT9 f;  3TDH B;  2OTL Z;  4DGL A;  3TE5 B;  1NJI 2;  4HH4 A;  2K3R A;  4A3C I;  1JWH C;  2F4O A;  3H3V J;  1M90 2;  1X0T A;  1Q81 2;  3D6W A;  2YAD A;  1VQN Z;  4NBF A;  3BG0 B;  3IR7 A;  1USP A;  3CCJ 1;  1WZN A;  1K8A 1;  2VUM I;  2DE6 A;  2JUB A;  3FKI I;  2E2J I;  1VQO 1;  1K83 I;  2OTJ 1;  3I4N I;  2LEX A;  1K8A 2;  5LL6 f;  1USP B;  4X6A I;  1VQ5 Z;  2WAQ A;  4DQY B;  2ZAE B;  4QTT A;  3CMA Z;  2J6A A;  3CME Z;  1TWH I;  2V3V A;  3GTO I;  1YJ9 Z;  4RS4 A;  2G2K A;  1RO4 A;  1Q82 2;  3KIF A;  1SFO I;  1RQF A;  1AA6 A;  1M1K 1;  3HOU I;  2NVX I;  5IP7 I;  4XX2 A;  3S2H I;  1YJW Z;  3RZD I;  2VUG A;  2NVQ I;  4BBS I;  2WB1 A;  5D1O A;  3U50 C;  1QYP A;  4MXU A;  3VMH A;  3F3P C;  3MON A;  3GTG I;  3G4S Z;  5A2Q f;  3EED A;  3CC2 Z;  2KI7 B;  3P5J B;  3GTM S;  3IF8 A;  1ML8 A;  1Z02 A;  4A3F I;  4A3J I;  3CCL Z;  5AN9 F;  1FDO A;  3VTN A;  4E2Y A;  1K9M 2;  2VF1 A;  1VQ8 1;  4QTU A;  2HU9 A;  1VQ6 Z;  1L1O C;  3I55 Z;  2M6N A;  1VQ7 Z;  3I4M I;  2I3C A;  1VQ9 1;  2P3Y A;  3MZK B;  1VLA A;  3F3F C;  4NH1 C;  4E2X A;  1VQP Z;  3HOY I;  2R7Z I;  4RVF A;  3CXC Y;  1Q7Y 2;  2VPY A;  4E31 A;  2DE7 A;  2RHB A;  1JJ2 Z;  1VQL Z;  5C4X I;  3CCQ Z;  5IT9 b;  2RBL A;  2VPW A;  3JAM f;  3HOV I;  1RO2 A;  3IX0 A;  1N8R 1;  1YI2 1;  2K5R A;  2QA4 Z;  3OW2 Z;  1RNI A;  3GTM I;  1YUK A;  2QEX Z;  3CCU Z;  4NBE A;  2RT9 A;  2E9H A;  3HOX I;  1NP6 A;  3VB9 A;  1S7M A;  5C3E I;  4A93 I;  3CCS 1;  1X3W A;  3G71 1;  1QVF Y;  3D9X A;  3NDJ A;  2DE5 A;  2LFU A;  3G71 Z;  2PM9 A;  3CCV 1;  3GKQ A;  4NFR A;  3ESW A;  3KIH A;  1TWG I;  1TFI A;  4E33 A;  2JIP A;  1Z01 A;  3CCJ Z;  2O53 A;  4NBD A;  3G6E 1;  2M48 A;  1X3Z A;  4A3D I;  3S14 I;  2V8J A;  1VQO Z;  2R92 I;  4NBC A;  3J7A 4;  2OTJ Z;  2PK7 A;  2EGT A;  1YIT 1;  1ZB8 A;  3LUS A;  2O4H A;  2JIQ A;  5A2Q b;  1WJ2 A;  5C44 I;  2OOX B;  3CPW Z;  1TWF I;  2IZ3 A;  2PMZ A;  4BBR I;  3PO3 S;  2V8I A;  1KQS Y;  1Q16 A;  1QVG Z;  1KD1 1;  2JA8 I;  3BG1 B;  2B63 I;  4NOZ A;  1NUI A;  1M1K 2;  2JA5 I;  1Z03 A;  4E30 A;  1KRL A;  2IZ4 A;  1YHQ 1;  4RVD A;  1VQK 1;  3VMI A;  5D1O B;  3S2D I;  1R9T I;  4Y7N I;  1QF8 A;  3CCE 1;  4BY7 I;  2QRC B;  3MZL B;  1Y1V S;  3HOZ I;  3H0G I;  1YJN 1;  1DL6 A;  3JAM b;  1VQ8 Z;  2RPR A;  1Q86 1;  2KPI A;  5FLM I;  2JIM A;  2F4M A;  1YJN Z;  1LQL A;  3GTQ I;  1KC8 1;  1W2B Y;  4RVH A;  2JR6 A;  1WCM I;  1VQ9 Z;  1TWA I;  3I07 A;  2OZK A;  3PO3 I;  1PFT A;  2NVY I;  3NH8 A;  3PO2 I;  4RV9 A;  1P9N A;  2HF1 A;  3GTP I;  1QVF Z;  1VQM 1;  2P28 A;  3CCR 1;  3CCM 1;  4NB9 A;  4EWC A;  3NH4 A;  1YI2 Z;  2Q51 A;  4BXX I;  1YIJ 1;  1N8R 2;  4MRI A;  1SIW A;  1TWC I;  5T6B A;  2E2H I;  1Y8C A;  4DK1 A;  3Q87 A;  2QKD A;  5IP9 I;  3S1R I;  1Y1V I;  3CC4 1;  3HOW I;  1VQ4 1;  1S72 1;  3CCS Z;  5C4J I;  1VQ4 Z;  2E2I I;  3CD6 1;  3FQQ A;  2LIY A;  4MD9 A;  3FQM A;  3J81 f;  3CC7 1;  5FLX f;  1NJI 1;  2JNY A;  3D2L A;  3M3Y I;  4A3K I;  3CCV Z;  1I3Q I;  2OTL 1;  2QLV B;  2R6M A;  2W03 A;  3S1N I;  1M90 1;  3HKZ A;  1Q81 1;  2RIQ A;  2GU2 A;  1KQS Z;  2JIO A;  4AYB A;  4CL1 A;  3G6E Z;  3K7A I;  2JA7 I;  4Y52 I;  5CM2 M;  1VQN 1;  4A3L I;  2VPX A;  2V45 A;  3OW2 Y;  3GCF A;  3S17 I;  3EER A;  2E7Z A;  4A3M I;  3J80 b;  3M4O I;  1I50 I;  1YIT Z;  3S1Q I;  4A3G I;  4MH4 A;  4HGY A;  4S1T A;  4MD8 A;  3NH5 A;  1VQ5 1;  4NB8 A;  4NBA A;  1K73 1;  4A3I I;  3CME 1;  3CMA 1;  4BY1 I;  1Q82 1;  1YJ9 1;  4E32 A;  3VMG A;  1ZB9 A;  2GTI A;  1K73 2;  3S15 I;  2VPZ A;  3NFZ A;  1KD1 2;  2BJO A;  5D1P A;  2OOY B;  3CQZ I;  3J80 f;  2IV2 X;  4NBH A;  3NDI A;  2GTH A;  1YJW 1;  1YHQ Z;  4MD7 A;  1W2B Z;  1YUA A;  1RLY A;  1VQK Z;  3CXC Z;  3RZO I;  3G4S 1;  3CCE Z;  3CC2 1;  2YU9 I;  1ZH1 A;  3QWU A;  4MON A;  2AKL A;  2AYD A;  3IFU A;  1FDI A;  1Y1W I;  3CPW Y;  1K9M 1;  4A3B I;  1N2F A;  3CCL 1;  2JS4 A;  2V8K A;  1QVG Y;  3GTK I;  1Q86 2;  2R93 I;  2Y0S A;  4NBG A;  4RVG A;  2JMO A;  1VQ6 1;  1KC8 2;  5T67 A;  3I55 1;  1VQ7 1;  1Q7Y 1;  1WII A;  4A3E I;  2QRE B;  1VQP 1;  2JA6 I;  2NVT I;  4E2Z A;  1VQM Z;  4NBB A;  3S16 I;  3J81 b;  3CCR Z;  3CCM Z;  2W04 A;  1VQL 1;  1QXF A;  5FLX b;  3CCQ 1;  2NAP A; 
#chains in the Genus database with same CATH homology
 1YIJ Z;  3S1M I;  3I56 1;  4TNU A;  5T64 A;  2QA4 1;  4E2W A;  1I6H I;  3I56 Z;  3T4N B;  2QEX 1;  3CCU 1;  2H85 A;  2QRD B;  3CC4 Z;  1S72 Z;  1WW9 A;  3GTJ I;  3GTL I;  2Q4Z A;  1RO0 A;  3CD6 Z;  4HGZ A;  3CC7 Z;  2QR1 B;  1JJ2 Y;  5IT9 f;  3TDH B;  2OTL Z;  4DGL A;  3TE5 B;  1NJI 2;  4HH4 A;  2K3R A;  4A3C I;  1JWH C;  2F4O A;  3H3V J;  1M90 2;  1X0T A;  1Q81 2;  3D6W A;  2YAD A;  1VQN Z;  4NBF A;  3BG0 B;  1USP A;  3CCJ 1;  1K8A 1;  2VUM I;  2DE6 A;  2JUB A;  3FKI I;  2E2J I;  1VQO 1;  1K83 I;  2OTJ 1;  3I4N I;  1K8A 2;  5LL6 f;  1USP B;  4X6A I;  1VQ5 Z;  2WAQ A;  4DQY B;  2ZAE B;  4QTT A;  3CMA Z;  2J6A A;  3CME Z;  1TWH I;  3GTO I;  1YJ9 Z;  4RS4 A;  2G2K A;  1RO4 A;  1Q82 2;  3KIF A;  1SFO I;  1RQF A;  1M1K 1;  3HOU I;  2NVX I;  5IP7 I;  4XX2 A;  3S2H I;  1YJW Z;  3RZD I;  2VUG A;  2NVQ I;  4BBS I;  2WB1 A;  5D1O A;  3U50 C;  1QYP A;  4MXU A;  3VMH A;  3F3P C;  3MON A;  3GTG I;  3G4S Z;  5A2Q f;  3EED A;  3CC2 Z;  2KI7 B;  3P5J B;  3GTM S;  3IF8 A;  1ML8 A;  1Z02 A;  4A3F I;  4A3J I;  3CCL Z;  5AN9 F;  3VTN A;  1K9M 2;  4E2Y A;  2VF1 A;  1VQ8 1;  4QTU A;  2HU9 A;  1VQ6 Z;  1L1O C;  3I55 Z;  2M6N A;  1VQ7 Z;  3I4M I;  2I3C A;  1VQ9 1;  2P3Y A;  3MZK B;  1VLA A;  3F3F C;  4NH1 C;  4E2X A;  1VQP Z;  3HOY I;  2R7Z I;  4RVF A;  3CXC Y;  1Q7Y 2;  4E31 A;  2DE7 A;  2RHB A;  1JJ2 Z;  1VQL Z;  5C4X I;  3CCQ Z;  5IT9 b;  2RBL A;  3JAM f;  3HOV I;  1RO2 A;  3IX0 A;  1N8R 1;  1YI2 1;  2K5R A;  2QA4 Z;  3OW2 Z;  1RNI A;  3GTM I;  1YUK A;  2QEX Z;  3CCU Z;  4NBE A;  2RT9 A;  2E9H A;  3HOX I;  1NP6 A;  3VB9 A;  1S7M A;  5C3E I;  4A93 I;  3CCS 1;  1X3W A;  3G71 1;  1QVF Y;  3D9X A;  3NDJ A;  2DE5 A;  2LFU A;  3G71 Z;  2PM9 A;  3CCV 1;  3GKQ A;  4NFR A;  3ESW A;  3KIH A;  1TWG I;  1TFI A;  4E33 A;  1Z01 A;  3CCJ Z;  2O53 A;  4NBD A;  3G6E 1;  2M48 A;  1X3Z A;  4A3D I;  3S14 I;  2V8J A;  1VQO Z;  2R92 I;  4NBC A;  3J7A 4;  2OTJ Z;  2PK7 A;  2EGT A;  1YIT 1;  1ZB8 A;  3LUS A;  2O4H A;  5A2Q b;  5C44 I;  2OOX B;  3CPW Z;  1TWF I;  2IZ3 A;  2PMZ A;  4BBR I;  3PO3 S;  2V8I A;  1KQS Y;  1KD1 1;  1QVG Z;  2JA8 I;  3BG1 B;  2B63 I;  4NOZ A;  1NUI A;  1M1K 2;  2JA5 I;  1Z03 A;  4E30 A;  1KRL A;  2IZ4 A;  1YHQ 1;  4RVD A;  1VQK 1;  3VMI A;  5D1O B;  3S2D I;  1R9T I;  4Y7N I;  1QF8 A;  3CCE 1;  4BY7 I;  2QRC B;  3MZL B;  1Y1V S;  3HOZ I;  3H0G I;  1YJN 1;  1DL6 A;  3JAM b;  1VQ8 Z;  2RPR A;  1Q86 1;  2KPI A;  5FLM I;  2F4M A;  1YJN Z;  1LQL A;  3GTQ I;  1KC8 1;  1W2B Y;  4RVH A;  2JR6 A;  1VQ9 Z;  1WCM I;  1TWA I;  3I07 A;  2OZK A;  3PO3 I;  1PFT A;  2NVY I;  3NH8 A;  3PO2 I;  4RV9 A;  1P9N A;  2HF1 A;  3GTP I;  1QVF Z;  1VQM 1;  2P28 A;  3CCR 1;  3CCM 1;  4NB9 A;  4EWC A;  3NH4 A;  1YI2 Z;  2Q51 A;  4BXX I;  1YIJ 1;  1N8R 2;  4MRI A;  1TWC I;  5T6B A;  2E2H I;  4DK1 A;  3Q87 A;  2QKD A;  5IP9 I;  3S1R I;  1Y1V I;  3CC4 1;  3HOW I;  1VQ4 1;  1S72 1;  3CCS Z;  5C4J I;  1VQ4 Z;  2E2I I;  3CD6 1;  3FQQ A;  2LIY A;  4MD9 A;  3FQM A;  3J81 f;  3CC7 1;  5FLX f;  1NJI 1;  2JNY A;  3M3Y I;  4A3K I;  3CCV Z;  1I3Q I;  2OTL 1;  2QLV B;  2R6M A;  2W03 A;  3S1N I;  1M90 1;  3HKZ A;  1Q81 1;  2RIQ A;  2GU2 A;  1KQS Z;  4AYB A;  4CL1 A;  2JA7 I;  3G6E Z;  3K7A I;  4Y52 I;  5CM2 M;  1VQN 1;  4A3L I;  3OW2 Y;  3GCF A;  3S17 I;  3EER A;  4A3M I;  3J80 b;  3M4O I;  1I50 I;  1YIT Z;  3S1Q I;  4A3G I;  4MH4 A;  4HGY A;  4S1T A;  4MD8 A;  3NH5 A;  1VQ5 1;  4NB8 A;  4NBA A;  1K73 1;  4A3I I;  3CME 1;  3CMA 1;  4BY1 I;  1Q82 1;  1YJ9 1;  4E32 A;  3VMG A;  1ZB9 A;  2GTI A;  1K73 2;  3S15 I;  3NFZ A;  1KD1 2;  2BJO A;  5D1P A;  2OOY B;  3CQZ I;  3J80 f;  4NBH A;  3NDI A;  2GTH A;  1YJW 1;  1YHQ Z;  4MD7 A;  1W2B Z;  1YUA A;  1RLY A;  1VQK Z;  3CXC Z;  3RZO I;  3G4S 1;  3CCE Z;  3CC2 1;  2YU9 I;  1ZH1 A;  3QWU A;  4MON A;  2AKL A;  3IFU A;  1Y1W I;  3CPW Y;  1K9M 1;  4A3B I;  1N2F A;  3CCL 1;  2JS4 A;  2V8K A;  1QVG Y;  3GTK I;  1Q86 2;  2R93 I;  2Y0S A;  4NBG A;  4RVG A;  2JMO A;  1VQ6 1;  1KC8 2;  5T67 A;  3I55 1;  1VQ7 1;  1Q7Y 1;  1WII A;  4A3E I;  2QRE B;  1VQP 1;  2JA6 I;  2NVT I;  4E2Z A;  1VQM Z;  4NBB A;  3S16 I;  3J81 b;  3CCR Z;  3CCM Z;  2W04 A;  1VQL 1;  5FLX b;  3CCQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...