1Y1VS

Refined rna polymerase ii-tfiis complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
174
structure length
174
Chain Sequence
NDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 8
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1y1vS01
2RBLA 5C4XI 4NB8A 1Y1WI 1L1OC 1WCMI 3S1MI 4Y7NI 1I6HI 4Y52I 3HOXI 3S15I 3I4NI 3S2HI 3GTJI 4BY1I 3PO3S 3HOVI 4A3CI 1DL6A 4BY7I 1ML8A 3Q87A 3S1RI 4NBAA 3HOWI 1X3ZA 3M4OI 4A3MI 3VB9A 1TWFI 1QYPA 3U50C 3HOYI 1PFTA 2F4OA 3HOUI 5IP7I 1Y1VS 2JS4A 2E2JI 3GTPI 5C3EI 2R7ZI 4A3GI 2VUMI 1Y1VI 4A3II 2YU9I 1RO4A 2NVXI 1K83I 4XX2A 5C4JI 3S17I 3PO3I 2K5RA 4A3EI 4BBRI 2JA7I 1ZB9A 3S2DI 2NVYI 1VLAA 4NBCA 2PK7A 4A93I 4NBHA 3GTQI 3RZDI 4NBDA 2JA5I 2F4MA 3S1NI 3GTOI 4BBSI 4NOZA 2P3YA 3VMHA 4A3LI 2DE7A 1X3WA 1R9TI 2J6AA 2HF1A 1YUAA 3H3VJ 3H0GI 1TWGI 2BJOA 4QTUA 5CM2M 1I3QI 1USPA 5FLMI 4NBFA 1NUIA 2JR6A 3GTGI 2R92I 2KPIA 3FKII 2NVTI 1ZB8A 2NVQI 1TWAI 1SFOI 3GTMI 1RLYA 5C44I 3I07A 3EERA 3GTMS 3PO2I 4NBBA 1TWCI 4NB9A 4X6AI 1TWHI 1I50I 3ESWA 3RZOI 3CQZI 2DE5A 4NBGA 4NBEA 3GTLI 4A3JI 2DE6A 2R93I 3GKQA 4A3DI 3VMGA 2JA6I 1WW9A 3D6WA 3S1QI 1USPB 2JNYA 3I4MI 4A3FI 3M3YI 4QTTA 4A3KI 3GTKI 1TFIA 3VMIA 2B63I 5IP9I 1N2FA 3S16I 3GCFA 2JA8I 3S14I 3HOZI 2E2HI 3LUSA 4BXXI 2E2II 4A3BI 4MH4A 3K7AI 1LQLA 2AKLA
chains in the Genus database with same CATH superfamily
3S1MI 1Y1WI 1WCMI 1ZH1A 1VQ7Z 1VQ9Z 4Y52I 3HOXI 4EWCA 4MRIA 1NP6A 3I4NI 3HOVI 3VTNA 1ML8A 3CCJ1 1RO0A 1M902 1QYPA 3G4SZ 2O53A 2F4OA 4E2XA 3T4NB 3HOUI 3G71Z 1YJWZ 3GTPI 4NH1C 2RPRA 5T6BA 1WZNA 5A2Qf 2K3RA 4A3EI 2KI7B 1K732 4BBRI 2NVYI 4NBCA 3IR7A 3RZDI 1VQ5Z 3JAMf 2JA5I 3CCEZ 3CCL1 3S1NI 4BBSI 1YIJZ 5A2Qb 3VMHA 1K8A2 2O4HA 1KQSZ 3CCS1 3KIFA 2QA41 1KD11 1VQ4Z 5FLMI 2R92I 1ZB8A 3BG0B 1VQ6Z 1SFOI 1Z03A 3CCU1 3GTMI 2OTJ1 1RQFA 4RS4A 1RLYA 3CPWZ 3I07A 1YI2Z 3GTMS 1Y8CA 1I50I 3ESWA 2I3CA 3J81b 2V8IA 2JIPA 3TDHB 4E30A 1YJW1 1QVFZ 3GTLI 2R93I 1Q861 1Q7Y2 3D6WA 1JJ2Y 2JNYA 2RHBA 1P9NA 4A3KI 1Q822 1FDIA 4MD7A 3J80f 1QVGY 3CCLZ 3TE5B 4AYBA 2QEXZ 1VQK1 3K7AI 1VQ91 1LQLA 1VQ71 2QR1B 2RBLA 4NB8A 1QVFY 2V3VA 5IT9b 1I6HI 2YADA 3CCQZ 5D1OA 3S15I 2M6NA 3J81f 3GTJI 4BY7I 1JWHC 2JIRA 3S1RI 4NBAA 1X3ZA 1QF8A 3VB9A 3IX0A 2E2JI 5C3EI 1FDOA 4A3II 1RO4A 2NVXI 2Y0SA 1VQLZ 1K83I 2EGTA 4XX2A 3PO3I 2K5RA 5T64A 4E2WA 3IF8A 3CC7Z 1VQ81 1K8A1 3GTQI 4NBDA 1YJ9Z 1SIWA 3GTOI 1NJI2 3G6E1 4TNUA 2OTLZ 3CCMZ 4DGLA 1R9TI 3H0GI 1TWGI 1I3QI 1VQMZ 2IZ4A 1USPA 1RO2A 2JMOA 3CC4Z 2NVTI 3J7A4 1TWAI 4RVGA 1QVGZ 1VQ8Z 2OOYB 3EERA 4RV9A 3CCV1 5IT9f 1VQPZ 4NBBA 2IZ3A 4NB9A 1K9M1 3PO2I 1Q7Y1 3RZOI 3I56Z 2DE5A 2GTHA 3GKQA 1YJN1 4A3DI 1WW9A 2VPYA 3NH4A 3S1QI 1N8R1 3FQQA 2HU9A 3NDJA 4A3FI 4QTTA 1YHQZ 3GTKI 3VMIA 2VUGA 2B63I 2JIQA 1N2FA 2H85A 3CCR1 3GCFA 1YI21 2VPWA 3LUSA 4BXXI 3G711 1Q811 1RNIA 2E7ZA 2E2II 4MH4A 2VPZA 3I55Z 2AKLA 1L1OC 1VQM1 1VQO1 2GTIA 3CXCY 1JJ2Z 3S2HI 5T67A 2LIYA 4E2ZA 3PO3S 4A3CI 3Q87A 3EEDA 1VQP1 1YIJ1 4A3MI 1TWFI 4E31A 1VQN1 3CD6Z 3U50C 3HOYI 5LL6f 1PFTA 3CC21 2OOXB 1Q16A 1Y1VS 1YJNZ 3CXCZ 1VQ41 2JS4A 4RVDA 4A3GI 2VUMI 1Y1VI 2E9HA 3NH5A 2G2KA 1M1K1 3CC41 1VQOZ 3IFUA 3CC71 1ZB9A 1NJI1 2PK7A 3D9XA 4MXUA 4NBHA 3CCRZ 1Q821 3HKZA 1VQNZ 2OZKA 2QEX1 3CCM1 2P28A 4RVFA 2P3YA 2JIMA 3F3PC 3F3FC 4A3LI 4S1TA 2W03A 1Z01A 2QKDA 2HF1A 3H3VJ 3QWUA 3D2LA 2BJOA 4QTUA 5CM2M 5D1OB 3CCQ1 3JAMb 2IV2X 4NBFA 2JR6A 3NFZA 4MD8A 1VQL1 3GTGI 3FKII 3CCUZ 1K9M2 2LFUA 3BG1B 2WB1A 1M901 4E32A 1KC81 2M48A 5C44I 3CCJZ 4HGYA 1KQSY 1VQ51 2QRDB 2JIOA 5AN9F 4NBGA 4NBEA 4A3JI 2VPXA 5FLXb 2JA6I 3CMAZ 2QREB 4HGZA 2V8KA 3M3YI 4E2YA 1QXFA 1TFIA 2WAQA 5IP9I 3G4S1 4HH4A 3S14I 1YITZ 2Q51A 4A3BI 3CME1 3CPWY 3MONA 5C4XI 1VQKZ 4Y7NI 3P5JB 4BY1I 1YUKA 1DL6A 2JUBA 5D1PA 1AA6A 3HOWI 2R6MA 3M4OI 1KRLA 4E33A 1W2BY 3OW2Z 2QRCB 3CMEZ 1Q862 1M1K2 5IP7I 2R7ZI 4MD9A 2QLVB 2ZAEB 3CMA1 2YU9I 4MONA 1WJ2A 5C4JI 3S17I 1N8R2 3NDIA 2JA7I 3S2DI 1VLAA 4A93I 1S721 3MZKB 1WIIA 2RIQA 3KIHA 4NFRA 2F4MA 1K731 4NOZA 2NAPA 2RT9A 3NH8A 1Q812 2DE7A 1X3WA 1W2BZ 2J6AA 2V45A 1YUAA 3G6EZ 2LEXA 3OW2Y 1KC82 2QA4Z 1NUIA 2KPIA 1KD12 2NVQI 3CCVZ 2Q4ZA 1S72Z 2OTJZ 1TWCI 3CCE1 1YIT1 4X6AI 1TWHI 1YJ91 3CC2Z 3MZLB 3CQZI 3FQMA 2AYDA 2DE6A 3J80b 3VMGA 3CCSZ 3I4MI 4RVHA 1YHQ1 1S7MA 2VF1A 2PM9A 4CL1A 1VQ61 2V8JA 3CD61 3S16I 5FLXf 1X0TA 2JA8I 3HOZI 3I551 2PMZA 4DK1A 1Z02A 4DQYB 2OTL1 1USPB 3I561 2E2HI 2GU2A 2W04A
chains in the Genus database with same CATH topology
3S1MI 1Y1WI 1WCMI 1ZH1A 1VQ7Z 1VQ9Z 4Y52I 3HOXI 4EWCA 4MRIA 1NP6A 3I4NI 3HOVI 3VTNA 1ML8A 3CCJ1 1RO0A 1M902 1QYPA 3G4SZ 2O53A 2F4OA 4E2XA 3T4NB 3HOUI 3G71Z 1YJWZ 3GTPI 4NH1C 2RPRA 5T6BA 5A2Qf 2K3RA 4A3EI 2KI7B 1K732 4BBRI 2NVYI 4NBCA 3RZDI 1VQ5Z 3JAMf 2JA5I 3CCEZ 3CCL1 3S1NI 4BBSI 1YIJZ 5A2Qb 3VMHA 1K8A2 2O4HA 1KQSZ 3CCS1 3KIFA 2QA41 1KD11 1VQ4Z 5FLMI 2R92I 1ZB8A 3BG0B 1VQ6Z 1SFOI 1Z03A 3CCU1 3GTMI 2OTJ1 1RQFA 4RS4A 1RLYA 3CPWZ 3I07A 1YI2Z 3GTMS 1I50I 3ESWA 2I3CA 3J81b 2V8IA 3TDHB 4E30A 1YJW1 1QVFZ 3GTLI 2R93I 1Q861 1Q7Y2 3D6WA 1JJ2Y 2JNYA 2RHBA 1P9NA 4A3KI 1Q822 4MD7A 3J80f 1QVGY 3CCLZ 3TE5B 4AYBA 2QEXZ 1VQK1 3K7AI 1VQ91 1LQLA 1VQ71 2QR1B 2RBLA 4NB8A 1QVFY 5IT9b 1I6HI 2YADA 3CCQZ 5D1OA 3S15I 2M6NA 3J81f 3GTJI 4BY7I 1JWHC 3S1RI 4NBAA 1X3ZA 1QF8A 3VB9A 3IX0A 2E2JI 5C3EI 4A3II 1RO4A 2NVXI 2Y0SA 1VQLZ 1K83I 2EGTA 4XX2A 3PO3I 2K5RA 5T64A 4E2WA 3IF8A 3CC7Z 1VQ81 1K8A1 3GTQI 4NBDA 1YJ9Z 3GTOI 1NJI2 3G6E1 4TNUA 2OTLZ 3CCMZ 4DGLA 1R9TI 3H0GI 1TWGI 1I3QI 1VQMZ 2IZ4A 1USPA 1RO2A 2JMOA 3CC4Z 2NVTI 3J7A4 1TWAI 4RVGA 1QVGZ 1VQ8Z 2OOYB 3EERA 4RV9A 3CCV1 5IT9f 1VQPZ 4NBBA 2IZ3A 4NB9A 1K9M1 3PO2I 1Q7Y1 3RZOI 3I56Z 2DE5A 2GTHA 3GKQA 1YJN1 4A3DI 1WW9A 3NH4A 3S1QI 1N8R1 3FQQA 2HU9A 3NDJA 4A3FI 4QTTA 1YHQZ 3GTKI 3VMIA 2VUGA 2B63I 1N2FA 2H85A 3CCR1 3GCFA 1YI21 3LUSA 4BXXI 3G711 1Q811 1RNIA 2E2II 4MH4A 3I55Z 2AKLA 1L1OC 1VQM1 1VQO1 2GTIA 3CXCY 1JJ2Z 3S2HI 5T67A 2LIYA 4E2ZA 3PO3S 4A3CI 3Q87A 3EEDA 1VQP1 1YIJ1 4A3MI 1TWFI 4E31A 1VQN1 3CD6Z 3U50C 3HOYI 5LL6f 1PFTA 3CC21 2OOXB 1Y1VS 1YJNZ 3CXCZ 1VQ41 2JS4A 4RVDA 4A3GI 2VUMI 1Y1VI 2E9HA 3NH5A 2G2KA 1M1K1 3CC41 1VQOZ 3IFUA 3CC71 1ZB9A 1NJI1 2PK7A 3D9XA 4MXUA 4NBHA 1Q821 3CCRZ 3HKZA 1VQNZ 2OZKA 2QEX1 3CCM1 2P28A 4RVFA 2P3YA 3F3PC 3F3FC 4A3LI 4S1TA 2W03A 1Z01A 2QKDA 2HF1A 3H3VJ 3QWUA 2BJOA 4QTUA 5CM2M 5D1OB 3CCQ1 3JAMb 4NBFA 2JR6A 3NFZA 4MD8A 1VQL1 3GTGI 3FKII 3CCUZ 1K9M2 2LFUA 3BG1B 2WB1A 1M901 4E32A 1KC81 2M48A 5C44I 3CCJZ 4HGYA 1KQSY 1VQ51 2QRDB 5AN9F 4NBGA 4NBEA 4A3JI 5FLXb 2JA6I 3CMAZ 2QREB 4HGZA 2V8KA 3M3YI 4E2YA 1TFIA 2WAQA 5IP9I 3G4S1 4HH4A 3S14I 1YITZ 2Q51A 4A3BI 3CME1 3CPWY 3MONA 5C4XI 1VQKZ 4Y7NI 3P5JB 4BY1I 1YUKA 1DL6A 2JUBA 5D1PA 3HOWI 2R6MA 3M4OI 1KRLA 4E33A 1W2BY 3OW2Z 2QRCB 3CMEZ 1Q862 1M1K2 5IP7I 2R7ZI 4MD9A 2QLVB 2ZAEB 3CMA1 2YU9I 4MONA 5C4JI 3S17I 1N8R2 3NDIA 2JA7I 3S2DI 1VLAA 4A93I 1S721 3MZKB 1WIIA 2RIQA 3KIHA 4NFRA 2F4MA 1K731 4NOZA 2RT9A 3NH8A 1Q812 2DE7A 1X3WA 1W2BZ 2J6AA 3G6EZ 1YUAA 3OW2Y 1KC82 2QA4Z 1NUIA 2KPIA 1KD12 2NVQI 3CCVZ 2Q4ZA 1S72Z 2OTJZ 1TWCI 3CCE1 1YIT1 4X6AI 1TWHI 1YJ91 3CC2Z 3MZLB 3CQZI 3FQMA 2DE6A 3J80b 3VMGA 3CCSZ 3I4MI 4RVHA 1YHQ1 1S7MA 2VF1A 2PM9A 4CL1A 1VQ61 2V8JA 3CD61 3S16I 5FLXf 1X0TA 2JA8I 3HOZI 3I551 2PMZA 4DK1A 1Z02A 4DQYB 2OTL1 1USPB 3I561 2E2HI 2GU2A 2W04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RBL A;  5C4X I;  4NB8 A;  1Y1W I;  1L1O C;  1WCM I;  3S1M I;  4Y7N I;  1I6H I;  4Y52 I;  3HOX I;  3S15 I;  3I4N I;  3S2H I;  3GTJ I;  4BY1 I;  3PO3 S;  3HOV I;  4A3C I;  1DL6 A;  4BY7 I;  1ML8 A;  3Q87 A;  3S1R I;  4NBA A;  3HOW I;  1X3Z A;  3M4O I;  4A3M I;  3VB9 A;  1TWF I;  1QYP A;  3U50 C;  3HOY I;  1PFT A;  2F4O A;  3HOU I;  5IP7 I;  1Y1V S;  2JS4 A;  2E2J I;  3GTP I;  5C3E I;  2R7Z I;  4A3G I;  2VUM I;  1Y1V I;  4A3I I;  2YU9 I;  1RO4 A;  2NVX I;  1K83 I;  4XX2 A;  5C4J I;  3S17 I;  3PO3 I;  2K5R A;  4A3E I;  4BBR I;  2JA7 I;  1ZB9 A;  3S2D I;  2NVY I;  1VLA A;  4NBC A;  2PK7 A;  4A93 I;  4NBH A;  3GTQ I;  3RZD I;  4NBD A;  2JA5 I;  2F4M A;  3S1N I;  3GTO I;  4BBS I;  4NOZ A;  2P3Y A;  3VMH A;  4A3L I;  2DE7 A;  1X3W A;  1R9T I;  2J6A A;  2HF1 A;  1YUA A;  3H3V J;  3H0G I;  1TWG I;  2BJO A;  4QTU A;  5CM2 M;  1I3Q I;  1USP A;  5FLM I;  4NBF A;  1NUI A;  2JR6 A;  3GTG I;  2R92 I;  2KPI A;  3FKI I;  2NVT I;  1ZB8 A;  2NVQ I;  1TWA I;  1SFO I;  3GTM I;  1RLY A;  5C44 I;  3I07 A;  3EER A;  3GTM S;  3PO2 I;  4NBB A;  1TWC I;  4NB9 A;  4X6A I;  1TWH I;  1I50 I;  3ESW A;  3RZO I;  3CQZ I;  2DE5 A;  4NBG A;  4NBE A;  3GTL I;  4A3J I;  2DE6 A;  2R93 I;  3GKQ A;  4A3D I;  3VMG A;  2JA6 I;  1WW9 A;  3D6W A;  3S1Q I;  1USP B;  2JNY A;  3I4M I;  4A3F I;  3M3Y I;  4QTT A;  4A3K I;  3GTK I;  1TFI A;  3VMI A;  2B63 I;  5IP9 I;  1N2F A;  3S16 I;  3GCF A;  2JA8 I;  3S14 I;  3HOZ I;  2E2H I;  3LUS A;  4BXX I;  2E2I I;  4A3B I;  4MH4 A;  3K7A I;  1LQL A;  2AKL A; 
#chains in the Genus database with same CATH topology
 3S1M I;  1Y1W I;  1WCM I;  1ZH1 A;  1VQ7 Z;  1VQ9 Z;  4Y52 I;  3HOX I;  4EWC A;  4MRI A;  1NP6 A;  3I4N I;  3HOV I;  3VTN A;  1ML8 A;  3CCJ 1;  1RO0 A;  1M90 2;  1QYP A;  3G4S Z;  2O53 A;  2F4O A;  4E2X A;  3T4N B;  3HOU I;  3G71 Z;  1YJW Z;  3GTP I;  4NH1 C;  2RPR A;  5T6B A;  1WZN A;  5A2Q f;  2K3R A;  4A3E I;  2KI7 B;  1K73 2;  4BBR I;  2NVY I;  4NBC A;  3IR7 A;  3RZD I;  1VQ5 Z;  3JAM f;  2JA5 I;  3CCE Z;  3CCL 1;  3S1N I;  4BBS I;  1YIJ Z;  5A2Q b;  3VMH A;  1K8A 2;  2O4H A;  1KQS Z;  3CCS 1;  3KIF A;  2QA4 1;  1KD1 1;  1VQ4 Z;  5FLM I;  2R92 I;  1ZB8 A;  3BG0 B;  1VQ6 Z;  1SFO I;  1Z03 A;  3CCU 1;  3GTM I;  2OTJ 1;  1RQF A;  4RS4 A;  1RLY A;  3CPW Z;  3I07 A;  1YI2 Z;  3GTM S;  1Y8C A;  1I50 I;  3ESW A;  2I3C A;  3J81 b;  2V8I A;  2JIP A;  3TDH B;  4E30 A;  1YJW 1;  1QVF Z;  3GTL I;  2R93 I;  1Q86 1;  1Q7Y 2;  3D6W A;  1JJ2 Y;  2JNY A;  2RHB A;  1P9N A;  4A3K I;  1Q82 2;  1FDI A;  4MD7 A;  3J80 f;  1QVG Y;  3CCL Z;  3TE5 B;  4AYB A;  2QEX Z;  1VQK 1;  3K7A I;  1VQ9 1;  1LQL A;  1VQ7 1;  2QR1 B;  2RBL A;  4NB8 A;  1QVF Y;  2V3V A;  5IT9 b;  1I6H I;  2YAD A;  3CCQ Z;  5D1O A;  3S15 I;  2M6N A;  3J81 f;  3GTJ I;  4BY7 I;  1JWH C;  2JIR A;  3S1R I;  4NBA A;  1X3Z A;  1QF8 A;  3VB9 A;  3IX0 A;  2E2J I;  5C3E I;  1FDO A;  4A3I I;  1RO4 A;  2NVX I;  2Y0S A;  1VQL Z;  1K83 I;  2EGT A;  4XX2 A;  3PO3 I;  2K5R A;  5T64 A;  4E2W A;  3IF8 A;  3CC7 Z;  1VQ8 1;  1K8A 1;  3GTQ I;  4NBD A;  1YJ9 Z;  1SIW A;  3GTO I;  1NJI 2;  3G6E 1;  4TNU A;  2OTL Z;  3CCM Z;  4DGL A;  1R9T I;  3H0G I;  1TWG I;  1I3Q I;  1VQM Z;  2IZ4 A;  1USP A;  1RO2 A;  2JMO A;  3CC4 Z;  2NVT I;  3J7A 4;  1TWA I;  4RVG A;  1QVG Z;  1VQ8 Z;  2OOY B;  3EER A;  4RV9 A;  3CCV 1;  5IT9 f;  1VQP Z;  4NBB A;  2IZ3 A;  4NB9 A;  1K9M 1;  3PO2 I;  1Q7Y 1;  3RZO I;  3I56 Z;  2DE5 A;  2GTH A;  3GKQ A;  1YJN 1;  4A3D I;  1WW9 A;  2VPY A;  3NH4 A;  3S1Q I;  1N8R 1;  3FQQ A;  2HU9 A;  3NDJ A;  4A3F I;  4QTT A;  1YHQ Z;  3GTK I;  3VMI A;  2VUG A;  2B63 I;  2JIQ A;  1N2F A;  2H85 A;  3CCR 1;  3GCF A;  1YI2 1;  2VPW A;  3LUS A;  4BXX I;  3G71 1;  1Q81 1;  1RNI A;  2E7Z A;  2E2I I;  4MH4 A;  2VPZ A;  3I55 Z;  2AKL A;  1L1O C;  1VQM 1;  1VQO 1;  2GTI A;  3CXC Y;  1JJ2 Z;  3S2H I;  5T67 A;  2LIY A;  4E2Z A;  3PO3 S;  4A3C I;  3Q87 A;  3EED A;  1VQP 1;  1YIJ 1;  4A3M I;  1TWF I;  4E31 A;  1VQN 1;  3CD6 Z;  3U50 C;  3HOY I;  5LL6 f;  1PFT A;  3CC2 1;  2OOX B;  1Q16 A;  1Y1V S;  1YJN Z;  3CXC Z;  1VQ4 1;  2JS4 A;  4RVD A;  4A3G I;  2VUM I;  1Y1V I;  2E9H A;  3NH5 A;  2G2K A;  1M1K 1;  3CC4 1;  1VQO Z;  3IFU A;  3CC7 1;  1ZB9 A;  1NJI 1;  2PK7 A;  3D9X A;  4MXU A;  4NBH A;  3CCR Z;  1Q82 1;  3HKZ A;  1VQN Z;  2OZK A;  2QEX 1;  3CCM 1;  2P28 A;  4RVF A;  2P3Y A;  2JIM A;  3F3P C;  3F3F C;  4A3L I;  4S1T A;  2W03 A;  1Z01 A;  2QKD A;  2HF1 A;  3H3V J;  3QWU A;  3D2L A;  2BJO A;  4QTU A;  5CM2 M;  5D1O B;  3CCQ 1;  3JAM b;  2IV2 X;  4NBF A;  2JR6 A;  3NFZ A;  4MD8 A;  1VQL 1;  3GTG I;  3FKI I;  3CCU Z;  1K9M 2;  2LFU A;  3BG1 B;  2WB1 A;  1M90 1;  4E32 A;  1KC8 1;  2M48 A;  5C44 I;  3CCJ Z;  4HGY A;  1KQS Y;  1VQ5 1;  2QRD B;  2JIO A;  5AN9 F;  4NBG A;  4NBE A;  4A3J I;  2VPX A;  5FLX b;  2JA6 I;  3CMA Z;  2QRE B;  4HGZ A;  2V8K A;  3M3Y I;  4E2Y A;  1QXF A;  1TFI A;  2WAQ A;  5IP9 I;  3G4S 1;  4HH4 A;  3S14 I;  1YIT Z;  2Q51 A;  4A3B I;  3CME 1;  3CPW Y;  3MON A;  5C4X I;  1VQK Z;  4Y7N I;  3P5J B;  4BY1 I;  1YUK A;  1DL6 A;  2JUB A;  5D1P A;  1AA6 A;  3HOW I;  2R6M A;  3M4O I;  1KRL A;  4E33 A;  1W2B Y;  3OW2 Z;  2QRC B;  3CME Z;  1Q86 2;  1M1K 2;  5IP7 I;  2R7Z I;  4MD9 A;  2QLV B;  2ZAE B;  3CMA 1;  2YU9 I;  4MON A;  1WJ2 A;  5C4J I;  3S17 I;  1N8R 2;  3NDI A;  2JA7 I;  3S2D I;  1VLA A;  4A93 I;  1S72 1;  3MZK B;  1WII A;  2RIQ A;  3KIH A;  4NFR A;  2F4M A;  1K73 1;  4NOZ A;  2NAP A;  2RT9 A;  3NH8 A;  1Q81 2;  2DE7 A;  1X3W A;  1W2B Z;  2J6A A;  2V45 A;  1YUA A;  3G6E Z;  2LEX A;  3OW2 Y;  1KC8 2;  2QA4 Z;  1NUI A;  2KPI A;  1KD1 2;  2NVQ I;  3CCV Z;  2Q4Z A;  1S72 Z;  2OTJ Z;  1TWC I;  3CCE 1;  1YIT 1;  4X6A I;  1TWH I;  1YJ9 1;  3CC2 Z;  3MZL B;  3CQZ I;  3FQM A;  2AYD A;  2DE6 A;  3J80 b;  3VMG A;  3CCS Z;  3I4M I;  4RVH A;  1YHQ 1;  1S7M A;  2VF1 A;  2PM9 A;  4CL1 A;  1VQ6 1;  2V8J A;  3CD6 1;  3S16 I;  5FLX f;  1X0T A;  2JA8 I;  3HOZ I;  3I55 1;  2PMZ A;  4DK1 A;  1Z02 A;  4DQY B;  2OTL 1;  1USP B;  3I56 1;  2E2H I;  2GU2 A;  2W04 A; 
#chains in the Genus database with same CATH homology
 3S1M I;  1Y1W I;  1WCM I;  1ZH1 A;  1VQ7 Z;  1VQ9 Z;  4Y52 I;  3HOX I;  4EWC A;  4MRI A;  1NP6 A;  3I4N I;  3HOV I;  3VTN A;  1ML8 A;  3CCJ 1;  1RO0 A;  1M90 2;  1QYP A;  3G4S Z;  2O53 A;  2F4O A;  4E2X A;  3T4N B;  3HOU I;  3G71 Z;  1YJW Z;  3GTP I;  4NH1 C;  2RPR A;  5T6B A;  5A2Q f;  2K3R A;  4A3E I;  2KI7 B;  1K73 2;  4BBR I;  2NVY I;  4NBC A;  3RZD I;  1VQ5 Z;  3JAM f;  2JA5 I;  3CCE Z;  3CCL 1;  3S1N I;  4BBS I;  1YIJ Z;  5A2Q b;  3VMH A;  1K8A 2;  2O4H A;  1KQS Z;  3CCS 1;  3KIF A;  2QA4 1;  1KD1 1;  1VQ4 Z;  5FLM I;  2R92 I;  1ZB8 A;  3BG0 B;  1VQ6 Z;  1SFO I;  1Z03 A;  3CCU 1;  3GTM I;  2OTJ 1;  1RQF A;  4RS4 A;  1RLY A;  3CPW Z;  3I07 A;  1YI2 Z;  3GTM S;  1I50 I;  3ESW A;  2I3C A;  3J81 b;  2V8I A;  3TDH B;  4E30 A;  1YJW 1;  1QVF Z;  3GTL I;  2R93 I;  1Q86 1;  1Q7Y 2;  3D6W A;  1JJ2 Y;  2JNY A;  2RHB A;  1P9N A;  4A3K I;  1Q82 2;  4MD7 A;  3J80 f;  1QVG Y;  3CCL Z;  3TE5 B;  4AYB A;  2QEX Z;  1VQK 1;  3K7A I;  1VQ9 1;  1LQL A;  1VQ7 1;  2QR1 B;  2RBL A;  4NB8 A;  1QVF Y;  5IT9 b;  1I6H I;  2YAD A;  3CCQ Z;  5D1O A;  3S15 I;  2M6N A;  3J81 f;  3GTJ I;  4BY7 I;  1JWH C;  3S1R I;  4NBA A;  1X3Z A;  1QF8 A;  3VB9 A;  3IX0 A;  2E2J I;  5C3E I;  4A3I I;  1RO4 A;  2NVX I;  2Y0S A;  1VQL Z;  1K83 I;  2EGT A;  4XX2 A;  3PO3 I;  2K5R A;  5T64 A;  4E2W A;  3IF8 A;  3CC7 Z;  1VQ8 1;  1K8A 1;  3GTQ I;  4NBD A;  1YJ9 Z;  3GTO I;  1NJI 2;  3G6E 1;  4TNU A;  2OTL Z;  3CCM Z;  4DGL A;  1R9T I;  3H0G I;  1TWG I;  1I3Q I;  1VQM Z;  2IZ4 A;  1USP A;  1RO2 A;  2JMO A;  3CC4 Z;  2NVT I;  3J7A 4;  1TWA I;  4RVG A;  1QVG Z;  1VQ8 Z;  2OOY B;  3EER A;  4RV9 A;  3CCV 1;  5IT9 f;  1VQP Z;  4NBB A;  2IZ3 A;  4NB9 A;  1K9M 1;  3PO2 I;  1Q7Y 1;  3RZO I;  3I56 Z;  2DE5 A;  2GTH A;  3GKQ A;  1YJN 1;  4A3D I;  1WW9 A;  3NH4 A;  3S1Q I;  1N8R 1;  3FQQ A;  2HU9 A;  3NDJ A;  4A3F I;  4QTT A;  1YHQ Z;  3GTK I;  3VMI A;  2VUG A;  2B63 I;  1N2F A;  2H85 A;  3CCR 1;  3GCF A;  1YI2 1;  3LUS A;  4BXX I;  3G71 1;  1Q81 1;  1RNI A;  2E2I I;  4MH4 A;  3I55 Z;  2AKL A;  1L1O C;  1VQM 1;  1VQO 1;  2GTI A;  3CXC Y;  1JJ2 Z;  3S2H I;  5T67 A;  2LIY A;  4E2Z A;  3PO3 S;  4A3C I;  3Q87 A;  3EED A;  1VQP 1;  1YIJ 1;  4A3M I;  1TWF I;  4E31 A;  1VQN 1;  3CD6 Z;  3U50 C;  3HOY I;  5LL6 f;  1PFT A;  3CC2 1;  2OOX B;  1Y1V S;  1YJN Z;  3CXC Z;  1VQ4 1;  2JS4 A;  4RVD A;  4A3G I;  2VUM I;  1Y1V I;  2E9H A;  3NH5 A;  2G2K A;  1M1K 1;  3CC4 1;  1VQO Z;  3IFU A;  3CC7 1;  1ZB9 A;  1NJI 1;  2PK7 A;  3D9X A;  4MXU A;  4NBH A;  1Q82 1;  3CCR Z;  3HKZ A;  1VQN Z;  2OZK A;  2QEX 1;  3CCM 1;  2P28 A;  4RVF A;  2P3Y A;  3F3P C;  3F3F C;  4A3L I;  4S1T A;  2W03 A;  1Z01 A;  2QKD A;  2HF1 A;  3H3V J;  3QWU A;  2BJO A;  4QTU A;  5CM2 M;  5D1O B;  3CCQ 1;  3JAM b;  4NBF A;  2JR6 A;  3NFZ A;  4MD8 A;  1VQL 1;  3GTG I;  3FKI I;  3CCU Z;  1K9M 2;  2LFU A;  3BG1 B;  2WB1 A;  1M90 1;  4E32 A;  1KC8 1;  2M48 A;  5C44 I;  3CCJ Z;  4HGY A;  1KQS Y;  1VQ5 1;  2QRD B;  5AN9 F;  4NBG A;  4NBE A;  4A3J I;  5FLX b;  2JA6 I;  3CMA Z;  2QRE B;  4HGZ A;  2V8K A;  3M3Y I;  4E2Y A;  1TFI A;  2WAQ A;  5IP9 I;  3G4S 1;  4HH4 A;  3S14 I;  1YIT Z;  2Q51 A;  4A3B I;  3CME 1;  3CPW Y;  3MON A;  5C4X I;  1VQK Z;  4Y7N I;  3P5J B;  4BY1 I;  1YUK A;  1DL6 A;  2JUB A;  5D1P A;  3HOW I;  2R6M A;  3M4O I;  1KRL A;  4E33 A;  1W2B Y;  3OW2 Z;  2QRC B;  3CME Z;  1Q86 2;  1M1K 2;  5IP7 I;  2R7Z I;  4MD9 A;  2QLV B;  2ZAE B;  3CMA 1;  2YU9 I;  4MON A;  5C4J I;  3S17 I;  1N8R 2;  3NDI A;  2JA7 I;  3S2D I;  1VLA A;  4A93 I;  1S72 1;  3MZK B;  1WII A;  2RIQ A;  3KIH A;  4NFR A;  2F4M A;  1K73 1;  4NOZ A;  2RT9 A;  3NH8 A;  1Q81 2;  2DE7 A;  1X3W A;  1W2B Z;  2J6A A;  3G6E Z;  1YUA A;  3OW2 Y;  1KC8 2;  2QA4 Z;  1NUI A;  2KPI A;  1KD1 2;  2NVQ I;  3CCV Z;  2Q4Z A;  1S72 Z;  2OTJ Z;  1TWC I;  3CCE 1;  1YIT 1;  4X6A I;  1TWH I;  1YJ9 1;  3CC2 Z;  3MZL B;  3CQZ I;  3FQM A;  2DE6 A;  3J80 b;  3VMG A;  3CCS Z;  3I4M I;  4RVH A;  1YHQ 1;  1S7M A;  2VF1 A;  2PM9 A;  4CL1 A;  1VQ6 1;  2V8J A;  3CD6 1;  3S16 I;  5FLX f;  1X0T A;  2JA8 I;  3HOZ I;  3I55 1;  2PMZ A;  4DK1 A;  1Z02 A;  4DQY B;  2OTL 1;  1USP B;  3I56 1;  2E2H I;  2GU2 A;  2W04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...