2R6MA

Crystal structure of rat ck2-beta subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
186
structure length
176
Chain Sequence
b'VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title Crystal structures of catalytic and regulatory subunits of rat protein kinase CK2
doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 44
structure length 176
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 2r6mA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r6mA02
2M48A 2RT9A 4MD8A 4MD9A 2JMOA 4NH1C 2R6MA 4DGLA 3EEDA 1RQFA 1JWHC 4MD7A 1QF8A 2M6NA
chains in the Genus database with same CATH superfamily
2M48A 3NH4A 1YJWZ 3HOVI 1X3WA 4NBHA 3CC71 4E32A 1M901 4NBDA 2GU2A 5A2Qf 2OTL1 4BBRI 5FLXf 1M902 3S1MI 3IR7A 5C3EI 1VQN1 2VPWA 2JS4A 2AKLA 1YJW1 1Q821 1Q822 3VTNA 3CCSZ 3CCVZ 2I3CA 2E9HA 1RNIA 4MD7A 5C4JI 2GTIA 5T67A 2NAPA 2EGTA 2VPXA 4EWCA 1W2BY 3BG0B 4HGZA 3HOWI 3CCS1 3CCV1 5A2Qb 3D6WA 5FLXb 2OOXB 1YIJZ 4Y52I 5IT9f 3NH8A 1TWGI 4A3FI 4RVFA 3GTKI 1K83I 3P5JB 4E30A 3M4OI 3S17I 1YIJ1 4A3KI 2W03A 4A3EI 3CCUZ 4E2ZA 3TE5B 2WB1A 4E2WA 3I56Z 3HOXI 2YU9I 5CM2M 2R93I 2E2JI 5IT9b 3J80f 1WZNA 3VMHA 4E2XA 1VQLZ 3GKQA 3I561 1YI2Z 1ML8A 1QYPA 2QLVB 1VQK1 1TWHI 1QVFY 1R9TI 1Y8CA 3HOZI 3FKII 4NB8A 3I55Z 1RO4A 2NVQI 3S1RI 1VQ71 2QRCB 2E2II 1Y1VI 1YI21 1JJ2Z 1I6HI 2G2KA 3QWUA 2VUMI 3PO2I 3RZDI 4CL1A 2HF1A 5T64A 3J80b 3I551 2IZ3A 3VB9A 2LFUA 2RHBA 1ZB9A 2NVTI 2IV2X 1VQMZ 1VQPZ 4A3CI 3J7A4 2JIMA 3PO3I 1ZB8A 1VQ9Z 3MZLB 5T6BA 2RT9A 5C44I 4AYBA 1YITZ 1P9NA 1VQM1 3G71Z 1VQP1 2M6NA 3CC21 2RPRA 1S72Z 1SIWA 3NH5A 2JMOA 2V8JA 1VQ91 2OOYB 3IFUA 4DK1A 3HOYI 1YIT1 3CC41 4A3DI 1WCMI 3G711 4MD9A 1S721 1L1OC 1QVGY 2VF1A 1LQLA 4MH4A 4NBFA 2VUGA 4RV9A 5D1PA 4A3MI 3RZOI 1TWAI 1Q861 2PMZA 2QR1B 2K3RA 1Q862 3MZKB 1KQSZ 1K9M1 2JNYA 1QF8A 1K9M2 2BJOA 3S15I 4S1TA 5AN9F 3CCLZ 4MXUA 2O4HA 3S1NI 2V45A 1FDIA 3FQQA 2OZKA 4TNUA 3M3YI 4A3II 1DL6A 3CMEZ 3CCL1 1YUKA 3T4NB 2J6AA 3F3PC 1RLYA 4DGLA 3OW2Y 3BG1B 3GCFA 3F3FC 1VQKZ 1PFTA 3KIHA 3CME1 3GTQI 2P3YA 3GTJI 4RVHA 3Q87A 5LL6f 1VQ7Z 4QTTA 4BY1I 2QRDB 2HU9A 2JIOA 2O53A 4RS4A 2RIQA 4BXXI 4A93I 2VPYA 1TWCI 2R92I 2NVYI 4E2YA 3LUSA 1N2FA 3HKZA 4MONA 3CPWZ 3CCEZ 3JAMf 4XX2A 2JA8I 3KIFA 2IZ4A 2P28A 1Y1WI 4MD8A 3CCJ1 4NB9A 1WW9A 2K5RA 4E31A 3U50C 3CC2Z 2PM9A 3CCRZ 3CCE1 3PO3S 4A3GI 3H3VJ 1RO2A 3CXCY 2F4OA 3J81f 3S14I 1JJ2Y 4NFRA 1VQOZ 3NDIA 3CC4Z 3GTMS 2QA4Z 1RO0A 3CCM1 3CCR1 3JAMb 1K8A1 3VMIA 5IP7I 3H0GI 1K8A2 4A3BI 2JIRA 1Q7Y1 2B63I 1VQO1 3S2DI 1Q7Y2 2DE6A 3MONA 4MRIA 1Z03A 1VQ8Z 1AA6A 2JA6I 1FDOA 2QA41 2NVXI 3G6E1 1Q811 3S16I 3J81b 2OTJZ 4HGYA 1YHQZ 1Q812 3G4SZ 4NBCA 1M1K1 4NH1C 2JUBA 1M1K2 1TWFI 1VQ81 1Q16A 2KI7B 4RVDA 2QKDA 1VQ6Z 3CD6Z 4X6AI 2JR6A 1VQ5Z 2OTJ1 3S1QI 2VPZA 1YHQ1 3G4S1 2QREB 4A3LI 2V8IA 1VLAA 5FLMI 3GTOI 4BBSI 3CMA1 2Q51A 1W2BZ 4NOZA 1VQ61 3CD61 1K731 1SFOI 5C4XI 1VQ51 1K732 2YADA 2JA7I 3GTPI 4NBBA 3EERA 1I3QI 3D9XA 2V8KA 2F4MA 3I4MI 2GTHA 4NBEA 1KQSY 2JIPA 3VMGA 1USPB 3ESWA 3OW2Z 1YJNZ 2DE5A 4Y7NI 1YJ9Z 1Z01A 1VQ4Z 2E7ZA 4HH4A 1USPA 1S7MA 1JWHC 3IF8A 5D1OB 1YJN1 1YUAA 1KRLA 3FQMA 2R6MA 2RBLA 1YJ91 1X3ZA 1QVFZ 1ZH1A 1TFIA 5D1OA 1VQ41 1I50I 2JA5I 1X0TA 1NUIA 1RQFA 1QXFA 1Y1VS 4RVGA 3CCJZ 4QTUA 4BY7I 3CCU1 3CQZI 5IP9I 2KPIA 2AYDA 3HOUI 3TDHB 2DE7A 2LEXA 2E2HI 3IX0A 2ZAEB 3S2HI 2QEXZ 3I07A 3CCMZ 1VQL1 3D2LA 3CXCZ 1KD11 1KD12 2H85A 2Q4ZA 3NDJA 1WIIA 3K7AI 1WJ2A 1Z02A 3GTGI 4DQYB 2LIYA 2QEX1 3CPWY 2WAQA 3G6EZ 4NBAA 3CCQZ 1N8R1 3I4NI 1N8R2 4NBGA 2JIQA 3EEDA 4A3JI 2Y0SA 2W04A 3CCQ1 1KC81 4E33A 2R7ZI 1QVGZ 1NP6A 1KC82 1NJI1 2PK7A 3GTMI 3CC7Z 1NJI2 2V3VA 3NFZA 3CMAZ 2OTLZ 3GTLI 1VQNZ
chains in the Genus database with same CATH topology
2M48A 3NH4A 1YJWZ 3HOVI 1X3WA 4NBHA 3CC71 4E32A 1M901 4NBDA 2GU2A 5A2Qf 2OTL1 4BBRI 5FLXf 1M902 3S1MI 5C3EI 1VQN1 2JS4A 2AKLA 1YJW1 1Q821 1Q822 3VTNA 3CCSZ 3CCVZ 2I3CA 2E9HA 1RNIA 4MD7A 5C4JI 2GTIA 5T67A 2EGTA 4EWCA 1W2BY 3BG0B 4HGZA 3HOWI 3CCS1 3CCV1 5A2Qb 3D6WA 5FLXb 2OOXB 1YIJZ 4Y52I 5IT9f 3NH8A 1TWGI 4A3FI 4RVFA 3GTKI 1K83I 3P5JB 4E30A 3M4OI 3S17I 1YIJ1 4A3KI 2W03A 4A3EI 3CCUZ 4E2ZA 3TE5B 2WB1A 4E2WA 3I56Z 3HOXI 2YU9I 5CM2M 2R93I 2E2JI 5IT9b 3J80f 3VMHA 4E2XA 1VQLZ 3GKQA 3I561 1YI2Z 1ML8A 1QYPA 2QLVB 1VQK1 1TWHI 1QVFY 1R9TI 3HOZI 3FKII 4NB8A 3I55Z 1RO4A 2NVQI 3S1RI 1VQ71 2QRCB 2E2II 1Y1VI 1YI21 1JJ2Z 1I6HI 2G2KA 3QWUA 2VUMI 3PO2I 3RZDI 4CL1A 2HF1A 5T64A 3J80b 3I551 2IZ3A 3VB9A 2LFUA 2RHBA 1ZB9A 2NVTI 1VQMZ 1VQPZ 4A3CI 3J7A4 3PO3I 1ZB8A 1VQ9Z 3MZLB 5T6BA 2RT9A 5C44I 4AYBA 1YITZ 1P9NA 1VQM1 3G71Z 1VQP1 2M6NA 3CC21 2RPRA 1S72Z 3NH5A 2JMOA 2V8JA 1VQ91 2OOYB 3IFUA 4DK1A 3HOYI 1YIT1 3CC41 4A3DI 1WCMI 3G711 4MD9A 1S721 1L1OC 1QVGY 2VF1A 1LQLA 4MH4A 4NBFA 2VUGA 4RV9A 5D1PA 4A3MI 3RZOI 1TWAI 1Q861 2PMZA 2QR1B 2K3RA 1Q862 3MZKB 1KQSZ 1K9M1 2JNYA 1QF8A 1K9M2 2BJOA 3S15I 4S1TA 5AN9F 3CCLZ 4MXUA 2O4HA 3S1NI 3FQQA 2OZKA 4TNUA 3M3YI 4A3II 1DL6A 3CMEZ 3CCL1 1YUKA 3T4NB 2J6AA 3F3PC 1RLYA 4DGLA 3OW2Y 3BG1B 3GCFA 3F3FC 1VQKZ 1PFTA 3KIHA 3CME1 3GTQI 2P3YA 3GTJI 4RVHA 3Q87A 5LL6f 1VQ7Z 4QTTA 4BY1I 2QRDB 2HU9A 2O53A 4RS4A 2RIQA 4BXXI 4A93I 1TWCI 2R92I 2NVYI 4E2YA 3LUSA 1N2FA 3HKZA 4MONA 3CPWZ 3CCEZ 3JAMf 4XX2A 2JA8I 3KIFA 2IZ4A 2P28A 1Y1WI 4MD8A 3CCJ1 4NB9A 1WW9A 2K5RA 4E31A 3U50C 3CC2Z 2PM9A 3CCRZ 3CCE1 3PO3S 4A3GI 3H3VJ 1RO2A 3CXCY 2F4OA 3J81f 3S14I 1JJ2Y 4NFRA 1VQOZ 3NDIA 3CC4Z 3GTMS 2QA4Z 1RO0A 3CCM1 3CCR1 3JAMb 1K8A1 3VMIA 5IP7I 3H0GI 1K8A2 4A3BI 1Q7Y1 2B63I 1VQO1 3S2DI 1Q7Y2 2DE6A 3MONA 4MRIA 1Z03A 1VQ8Z 2JA6I 2NVXI 2QA41 3G6E1 1Q811 3S16I 3J81b 2OTJZ 4HGYA 1YHQZ 1Q812 3G4SZ 4NBCA 1M1K1 4NH1C 2JUBA 1M1K2 1TWFI 1VQ81 2KI7B 4RVDA 2QKDA 1VQ6Z 3CD6Z 4X6AI 2JR6A 1VQ5Z 2OTJ1 3S1QI 1YHQ1 3G4S1 2QREB 4A3LI 2V8IA 1VLAA 5FLMI 3GTOI 4BBSI 3CMA1 2Q51A 1W2BZ 4NOZA 1VQ61 3CD61 1K731 1SFOI 5C4XI 1VQ51 1K732 2YADA 2JA7I 3GTPI 4NBBA 3EERA 1I3QI 3D9XA 2V8KA 2F4MA 3I4MI 2GTHA 4NBEA 1KQSY 3VMGA 1USPB 3ESWA 3OW2Z 1YJNZ 2DE5A 4Y7NI 1YJ9Z 1Z01A 1VQ4Z 4HH4A 1USPA 1S7MA 1JWHC 3IF8A 5D1OB 1YJN1 1YUAA 1KRLA 3FQMA 2R6MA 2RBLA 1YJ91 1X3ZA 1QVFZ 1ZH1A 1TFIA 5D1OA 1VQ41 1I50I 2JA5I 1X0TA 1NUIA 1RQFA 1Y1VS 4RVGA 3CCJZ 4QTUA 4BY7I 3CCU1 3CQZI 5IP9I 2KPIA 3HOUI 3TDHB 2DE7A 2E2HI 3IX0A 2ZAEB 3S2HI 2QEXZ 3I07A 3CCMZ 1VQL1 3CXCZ 1KD11 1KD12 2H85A 2Q4ZA 3NDJA 1WIIA 3K7AI 1Z02A 3GTGI 4DQYB 2LIYA 2QEX1 3CPWY 2WAQA 3G6EZ 4NBAA 3CCQZ 1N8R1 3I4NI 1N8R2 4NBGA 3EEDA 4A3JI 2Y0SA 2W04A 3CCQ1 1KC81 4E33A 2R7ZI 1QVGZ 1NP6A 1KC82 1NJI1 2PK7A 3GTMI 3CC7Z 1NJI2 3NFZA 3CMAZ 2OTLZ 3GTLI 1VQNZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M48 A;  2RT9 A;  4MD8 A;  4MD9 A;  2JMO A;  4NH1 C;  2R6M A;  4DGL A;  3EED A;  1RQF A;  1JWH C;  4MD7 A;  1QF8 A;  2M6N A; 
#chains in the Genus database with same CATH topology
 2M48 A;  3NH4 A;  1YJW Z;  3HOV I;  1X3W A;  4NBH A;  3CC7 1;  4E32 A;  1M90 1;  4NBD A;  2GU2 A;  5A2Q f;  2OTL 1;  4BBR I;  5FLX f;  1M90 2;  3S1M I;  3IR7 A;  5C3E I;  1VQN 1;  2VPW A;  2JS4 A;  2AKL A;  1YJW 1;  1Q82 1;  1Q82 2;  3VTN A;  3CCS Z;  3CCV Z;  2I3C A;  2E9H A;  1RNI A;  4MD7 A;  5C4J I;  2GTI A;  5T67 A;  2NAP A;  2EGT A;  2VPX A;  4EWC A;  1W2B Y;  3BG0 B;  4HGZ A;  3HOW I;  3CCS 1;  3CCV 1;  5A2Q b;  3D6W A;  5FLX b;  2OOX B;  1YIJ Z;  4Y52 I;  5IT9 f;  3NH8 A;  1TWG I;  4A3F I;  4RVF A;  3GTK I;  1K83 I;  3P5J B;  4E30 A;  3M4O I;  3S17 I;  1YIJ 1;  4A3K I;  2W03 A;  4A3E I;  3CCU Z;  4E2Z A;  3TE5 B;  2WB1 A;  4E2W A;  3I56 Z;  3HOX I;  2YU9 I;  5CM2 M;  2R93 I;  2E2J I;  5IT9 b;  3J80 f;  1WZN A;  3VMH A;  4E2X A;  1VQL Z;  3GKQ A;  3I56 1;  1YI2 Z;  1ML8 A;  1QYP A;  2QLV B;  1VQK 1;  1TWH I;  1QVF Y;  1R9T I;  1Y8C A;  3HOZ I;  3FKI I;  4NB8 A;  3I55 Z;  1RO4 A;  2NVQ I;  3S1R I;  1VQ7 1;  2QRC B;  2E2I I;  1Y1V I;  1YI2 1;  1JJ2 Z;  1I6H I;  2G2K A;  3QWU A;  2VUM I;  3PO2 I;  3RZD I;  4CL1 A;  2HF1 A;  5T64 A;  3J80 b;  3I55 1;  2IZ3 A;  3VB9 A;  2LFU A;  2RHB A;  1ZB9 A;  2NVT I;  2IV2 X;  1VQM Z;  1VQP Z;  4A3C I;  3J7A 4;  2JIM A;  3PO3 I;  1ZB8 A;  1VQ9 Z;  3MZL B;  5T6B A;  2RT9 A;  5C44 I;  4AYB A;  1YIT Z;  1P9N A;  1VQM 1;  3G71 Z;  1VQP 1;  2M6N A;  3CC2 1;  2RPR A;  1S72 Z;  1SIW A;  3NH5 A;  2JMO A;  2V8J A;  1VQ9 1;  2OOY B;  3IFU A;  4DK1 A;  3HOY I;  1YIT 1;  3CC4 1;  4A3D I;  1WCM I;  3G71 1;  4MD9 A;  1S72 1;  1L1O C;  1QVG Y;  2VF1 A;  1LQL A;  4MH4 A;  4NBF A;  2VUG A;  4RV9 A;  5D1P A;  4A3M I;  3RZO I;  1TWA I;  1Q86 1;  2PMZ A;  2QR1 B;  2K3R A;  1Q86 2;  3MZK B;  1KQS Z;  1K9M 1;  2JNY A;  1QF8 A;  1K9M 2;  2BJO A;  3S15 I;  4S1T A;  5AN9 F;  3CCL Z;  4MXU A;  2O4H A;  3S1N I;  2V45 A;  1FDI A;  3FQQ A;  2OZK A;  4TNU A;  3M3Y I;  4A3I I;  1DL6 A;  3CME Z;  3CCL 1;  1YUK A;  3T4N B;  2J6A A;  3F3P C;  1RLY A;  4DGL A;  3OW2 Y;  3BG1 B;  3GCF A;  3F3F C;  1VQK Z;  1PFT A;  3KIH A;  3CME 1;  3GTQ I;  2P3Y A;  3GTJ I;  4RVH A;  3Q87 A;  5LL6 f;  1VQ7 Z;  4QTT A;  4BY1 I;  2QRD B;  2HU9 A;  2JIO A;  2O53 A;  4RS4 A;  2RIQ A;  4BXX I;  4A93 I;  2VPY A;  1TWC I;  2R92 I;  2NVY I;  4E2Y A;  3LUS A;  1N2F A;  3HKZ A;  4MON A;  3CPW Z;  3CCE Z;  3JAM f;  4XX2 A;  2JA8 I;  3KIF A;  2IZ4 A;  2P28 A;  1Y1W I;  4MD8 A;  3CCJ 1;  4NB9 A;  1WW9 A;  2K5R A;  4E31 A;  3U50 C;  3CC2 Z;  2PM9 A;  3CCR Z;  3CCE 1;  3PO3 S;  4A3G I;  3H3V J;  1RO2 A;  3CXC Y;  2F4O A;  3J81 f;  3S14 I;  1JJ2 Y;  4NFR A;  1VQO Z;  3NDI A;  3CC4 Z;  3GTM S;  2QA4 Z;  1RO0 A;  3CCM 1;  3CCR 1;  3JAM b;  1K8A 1;  3VMI A;  5IP7 I;  3H0G I;  1K8A 2;  4A3B I;  2JIR A;  1Q7Y 1;  2B63 I;  1VQO 1;  3S2D I;  1Q7Y 2;  2DE6 A;  3MON A;  4MRI A;  1Z03 A;  1VQ8 Z;  1AA6 A;  2JA6 I;  1FDO A;  2QA4 1;  2NVX I;  3G6E 1;  1Q81 1;  3S16 I;  3J81 b;  2OTJ Z;  4HGY A;  1YHQ Z;  1Q81 2;  3G4S Z;  4NBC A;  1M1K 1;  4NH1 C;  2JUB A;  1M1K 2;  1TWF I;  1VQ8 1;  1Q16 A;  2KI7 B;  4RVD A;  2QKD A;  1VQ6 Z;  3CD6 Z;  4X6A I;  2JR6 A;  1VQ5 Z;  2OTJ 1;  3S1Q I;  2VPZ A;  1YHQ 1;  3G4S 1;  2QRE B;  4A3L I;  2V8I A;  1VLA A;  5FLM I;  3GTO I;  4BBS I;  3CMA 1;  2Q51 A;  1W2B Z;  4NOZ A;  1VQ6 1;  3CD6 1;  1K73 1;  1SFO I;  5C4X I;  1VQ5 1;  1K73 2;  2YAD A;  2JA7 I;  3GTP I;  4NBB A;  3EER A;  1I3Q I;  3D9X A;  2V8K A;  2F4M A;  3I4M I;  2GTH A;  4NBE A;  1KQS Y;  2JIP A;  3VMG A;  1USP B;  3ESW A;  3OW2 Z;  1YJN Z;  2DE5 A;  4Y7N I;  1YJ9 Z;  1Z01 A;  1VQ4 Z;  2E7Z A;  4HH4 A;  1USP A;  1S7M A;  1JWH C;  3IF8 A;  5D1O B;  1YJN 1;  1YUA A;  1KRL A;  3FQM A;  2R6M A;  2RBL A;  1YJ9 1;  1X3Z A;  1QVF Z;  1ZH1 A;  1TFI A;  5D1O A;  1VQ4 1;  1I50 I;  2JA5 I;  1X0T A;  1NUI A;  1RQF A;  1QXF A;  1Y1V S;  4RVG A;  3CCJ Z;  4QTU A;  4BY7 I;  3CCU 1;  3CQZ I;  5IP9 I;  2KPI A;  2AYD A;  3HOU I;  3TDH B;  2DE7 A;  2LEX A;  2E2H I;  3IX0 A;  2ZAE B;  3S2H I;  2QEX Z;  3I07 A;  3CCM Z;  1VQL 1;  3D2L A;  3CXC Z;  1KD1 1;  1KD1 2;  2H85 A;  2Q4Z A;  3NDJ A;  1WII A;  3K7A I;  1WJ2 A;  1Z02 A;  3GTG I;  4DQY B;  2LIY A;  2QEX 1;  3CPW Y;  2WAQ A;  3G6E Z;  4NBA A;  3CCQ Z;  1N8R 1;  3I4N I;  1N8R 2;  4NBG A;  2JIQ A;  3EED A;  4A3J I;  2Y0S A;  2W04 A;  3CCQ 1;  1KC8 1;  4E33 A;  2R7Z I;  1QVG Z;  1NP6 A;  1KC8 2;  1NJI 1;  2PK7 A;  3GTM I;  3CC7 Z;  1NJI 2;  2V3V A;  3NFZ A;  3CMA Z;  2OTL Z;  3GTL I;  1VQN Z; 
#chains in the Genus database with same CATH homology
 2M48 A;  3NH4 A;  1YJW Z;  3HOV I;  1X3W A;  4NBH A;  3CC7 1;  4E32 A;  1M90 1;  4NBD A;  2GU2 A;  5A2Q f;  2OTL 1;  4BBR I;  5FLX f;  1M90 2;  3S1M I;  5C3E I;  1VQN 1;  2JS4 A;  2AKL A;  1YJW 1;  1Q82 1;  1Q82 2;  3VTN A;  3CCS Z;  3CCV Z;  2I3C A;  2E9H A;  1RNI A;  4MD7 A;  5C4J I;  2GTI A;  5T67 A;  2EGT A;  4EWC A;  1W2B Y;  3BG0 B;  4HGZ A;  3HOW I;  3CCS 1;  3CCV 1;  5A2Q b;  3D6W A;  5FLX b;  2OOX B;  1YIJ Z;  4Y52 I;  5IT9 f;  3NH8 A;  1TWG I;  4A3F I;  4RVF A;  3GTK I;  1K83 I;  3P5J B;  4E30 A;  3M4O I;  3S17 I;  1YIJ 1;  4A3K I;  2W03 A;  4A3E I;  3CCU Z;  4E2Z A;  3TE5 B;  2WB1 A;  4E2W A;  3I56 Z;  3HOX I;  2YU9 I;  5CM2 M;  2R93 I;  2E2J I;  5IT9 b;  3J80 f;  3VMH A;  4E2X A;  1VQL Z;  3GKQ A;  3I56 1;  1YI2 Z;  1ML8 A;  1QYP A;  2QLV B;  1VQK 1;  1TWH I;  1QVF Y;  1R9T I;  3HOZ I;  3FKI I;  4NB8 A;  3I55 Z;  1RO4 A;  2NVQ I;  3S1R I;  1VQ7 1;  2QRC B;  2E2I I;  1Y1V I;  1YI2 1;  1JJ2 Z;  1I6H I;  2G2K A;  3QWU A;  2VUM I;  3PO2 I;  3RZD I;  4CL1 A;  2HF1 A;  5T64 A;  3J80 b;  3I55 1;  2IZ3 A;  3VB9 A;  2LFU A;  2RHB A;  1ZB9 A;  2NVT I;  1VQM Z;  1VQP Z;  4A3C I;  3J7A 4;  3PO3 I;  1ZB8 A;  1VQ9 Z;  3MZL B;  5T6B A;  2RT9 A;  5C44 I;  4AYB A;  1YIT Z;  1P9N A;  1VQM 1;  3G71 Z;  1VQP 1;  2M6N A;  3CC2 1;  2RPR A;  1S72 Z;  3NH5 A;  2JMO A;  2V8J A;  1VQ9 1;  2OOY B;  3IFU A;  4DK1 A;  3HOY I;  1YIT 1;  3CC4 1;  4A3D I;  1WCM I;  3G71 1;  4MD9 A;  1S72 1;  1L1O C;  1QVG Y;  2VF1 A;  1LQL A;  4MH4 A;  4NBF A;  2VUG A;  4RV9 A;  5D1P A;  4A3M I;  3RZO I;  1TWA I;  1Q86 1;  2PMZ A;  2QR1 B;  2K3R A;  1Q86 2;  3MZK B;  1KQS Z;  1K9M 1;  2JNY A;  1QF8 A;  1K9M 2;  2BJO A;  3S15 I;  4S1T A;  5AN9 F;  3CCL Z;  4MXU A;  2O4H A;  3S1N I;  3FQQ A;  2OZK A;  4TNU A;  3M3Y I;  4A3I I;  1DL6 A;  3CME Z;  3CCL 1;  1YUK A;  3T4N B;  2J6A A;  3F3P C;  1RLY A;  4DGL A;  3OW2 Y;  3BG1 B;  3GCF A;  3F3F C;  1VQK Z;  1PFT A;  3KIH A;  3CME 1;  3GTQ I;  2P3Y A;  3GTJ I;  4RVH A;  3Q87 A;  5LL6 f;  1VQ7 Z;  4QTT A;  4BY1 I;  2QRD B;  2HU9 A;  2O53 A;  4RS4 A;  2RIQ A;  4BXX I;  4A93 I;  1TWC I;  2R92 I;  2NVY I;  4E2Y A;  3LUS A;  1N2F A;  3HKZ A;  4MON A;  3CPW Z;  3CCE Z;  3JAM f;  4XX2 A;  2JA8 I;  3KIF A;  2IZ4 A;  2P28 A;  1Y1W I;  4MD8 A;  3CCJ 1;  4NB9 A;  1WW9 A;  2K5R A;  4E31 A;  3U50 C;  3CC2 Z;  2PM9 A;  3CCR Z;  3CCE 1;  3PO3 S;  4A3G I;  3H3V J;  1RO2 A;  3CXC Y;  2F4O A;  3J81 f;  3S14 I;  1JJ2 Y;  4NFR A;  1VQO Z;  3NDI A;  3CC4 Z;  3GTM S;  2QA4 Z;  1RO0 A;  3CCM 1;  3CCR 1;  3JAM b;  1K8A 1;  3VMI A;  5IP7 I;  3H0G I;  1K8A 2;  4A3B I;  1Q7Y 1;  2B63 I;  1VQO 1;  3S2D I;  1Q7Y 2;  2DE6 A;  3MON A;  4MRI A;  1Z03 A;  1VQ8 Z;  2JA6 I;  2NVX I;  2QA4 1;  3G6E 1;  1Q81 1;  3S16 I;  3J81 b;  2OTJ Z;  4HGY A;  1YHQ Z;  1Q81 2;  3G4S Z;  4NBC A;  1M1K 1;  4NH1 C;  2JUB A;  1M1K 2;  1TWF I;  1VQ8 1;  2KI7 B;  4RVD A;  2QKD A;  1VQ6 Z;  3CD6 Z;  4X6A I;  2JR6 A;  1VQ5 Z;  2OTJ 1;  3S1Q I;  1YHQ 1;  3G4S 1;  2QRE B;  4A3L I;  2V8I A;  1VLA A;  5FLM I;  3GTO I;  4BBS I;  3CMA 1;  2Q51 A;  1W2B Z;  4NOZ A;  1VQ6 1;  3CD6 1;  1K73 1;  1SFO I;  5C4X I;  1VQ5 1;  1K73 2;  2YAD A;  2JA7 I;  3GTP I;  4NBB A;  3EER A;  1I3Q I;  3D9X A;  2V8K A;  2F4M A;  3I4M I;  2GTH A;  4NBE A;  1KQS Y;  3VMG A;  1USP B;  3ESW A;  3OW2 Z;  1YJN Z;  2DE5 A;  4Y7N I;  1YJ9 Z;  1Z01 A;  1VQ4 Z;  4HH4 A;  1USP A;  1S7M A;  1JWH C;  3IF8 A;  5D1O B;  1YJN 1;  1YUA A;  1KRL A;  3FQM A;  2R6M A;  2RBL A;  1YJ9 1;  1X3Z A;  1QVF Z;  1ZH1 A;  1TFI A;  5D1O A;  1VQ4 1;  1I50 I;  2JA5 I;  1X0T A;  1NUI A;  1RQF A;  1Y1V S;  4RVG A;  3CCJ Z;  4QTU A;  4BY7 I;  3CCU 1;  3CQZ I;  5IP9 I;  2KPI A;  3HOU I;  3TDH B;  2DE7 A;  2E2H I;  3IX0 A;  2ZAE B;  3S2H I;  2QEX Z;  3I07 A;  3CCM Z;  1VQL 1;  3CXC Z;  1KD1 1;  1KD1 2;  2H85 A;  2Q4Z A;  3NDJ A;  1WII A;  3K7A I;  1Z02 A;  3GTG I;  4DQY B;  2LIY A;  2QEX 1;  3CPW Y;  2WAQ A;  3G6E Z;  4NBA A;  3CCQ Z;  1N8R 1;  3I4N I;  1N8R 2;  4NBG A;  3EED A;  4A3J I;  2Y0S A;  2W04 A;  3CCQ 1;  1KC8 1;  4E33 A;  2R7Z I;  1QVG Z;  1NP6 A;  1KC8 2;  1NJI 1;  2PK7 A;  3GTM I;  3CC7 Z;  1NJI 2;  3NFZ A;  3CMA Z;  2OTL Z;  3GTL I;  1VQN Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...