2R6MA

Crystal structure of rat ck2-beta subunit
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
186
structure length
176
Chain Sequence
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Casein kinase II subunit beta
publication title Crystal structures of catalytic and regulatory subunits of rat protein kinase CK2
doi rcsb
source organism Rattus norvegicus
total genus 44
structure length 176
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 2r6mA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2r6mA02
1QF8A 4MD8A 1JWHC 4MD9A 4NH1C 4DGLA 2JMOA 2M48A 2M6NA 2RT9A 4MD7A 3EEDA 1RQFA 2R6MA
chains in the Genus database with same CATH superfamily
4NBCA 3TDHB 4TNUA 2HU9A 3OW2Y 4A3II 1SIWA 3CMEZ 2JA5I 2WB1A 4E2ZA 3G6E1 3J81b 1X3ZA 1Q861 1VQN1 4A3GI 1YJNZ 3CCQ1 4HH4A 3S14I 3CPWY 2O4HA 2BJOA 3TE5B 3CCR1 1YUAA 1S72Z 1VQKZ 3VMIA 3HKZA 3NDJA 1VQ91 1M902 3FQQA 3G71Z 3JAMf 3I561 3G4S1 5FLXf 3CXCY 1Q811 3K7AI 3S1RI 2OTJZ 4AYBA 3D6WA 1VQ5Z 1USPA 3J80b 2QA4Z 3GTPI 1K83I 3GKQA 3CCJZ 3VB9A 3EERA 1Y1VS 3RZDI 2JR6A 5AN9F 1KC81 2PM9A 1Y1WI 1KRLA 3CCU1 2QEX1 3OW2Z 3HOUI 1Z02A 4CL1A 2P3YA 1VQ7Z 1TWCI 3J7A4 4E30A 4A3KI 2AKLA 2H85A 1Q16A 1RQFA 3H0GI 3GTOI 5LL6f 2VPXA 1USPB 1PFTA 4NOZA 2R93I 3CPWZ 1TFIA 2P28A 1KD11 1YIJZ 2JUBA 1K731 4MH4A 3GTLI 2OZKA 3ESWA 3CD6Z 1YHQZ 3GTQI 1YIT1 2JS4A 2EGTA 3GTMS 4Y7NI 2AYDA 3CMAZ 5C4JI 1VQ8Z 4A3CI 2LIYA 1N2FA 2VPZA 3KIHA 1K9M2 3CCL1 1L1OC 5IT9b 4MD9A 1I50I 2RHBA 3CCSZ 1YI21 2V8IA 2PMZA 1VQ41 1VQLZ 5D1PA 4S1TA 2V3VA 2JIRA 4E2WA 1VQOZ 1QF8A 4MD8A 1Q862 4HGZA 3I55Z 2RBLA 2KI7B 1NJI1 1VQ6Z 3BG0B 4A3MI 3FQMA 4NBBA 1Q7Y1 2V45A 3D2LA 3CME1 1X0TA 3GCFA 1JWHC 1YJWZ 3IF8A 5T67A 3CC4Z 1JJ2Y 3I4NI 5FLMI 3HOYI 4NBFA 2R7ZI 3P5JB 4NBHA 2VF1A 1Q812 4QTTA 3MZLB 2F4MA 1LQLA 4A3LI 1YJN1 3GTKI 3NH4A 3RZOI 1VQM1 4RS4A 3CCMZ 3GTJI 1VQK1 2E2II 1NP6A 4NBGA 5A2Qb 1VQPZ 1FDIA 4BY7I 3I07A 1ZB8A 4E2XA 2DE7A 2HF1A 4EWCA 3CCE1 2GTIA 1VQNZ 2QRCB 3CCQZ 2OTJ1 2JMOA 1VQ51 3CC7Z 2OOXB 2Q4ZA 2LEXA 3NFZA 3S2HI 1TWFI 2QA41 5T6BA 3HOVI 3VMGA 1FDOA 5T64A 2R6MA 3CCV1 1K732 2QRDB 3NH5A 1VQ9Z 1RO0A 4QTUA 2KPIA 3QWUA 1VQ71 1RO4A 3I56Z 3G4SZ 2E9HA 1JJ2Z 3LUSA 3JAMb 2VPYA 1K8A2 1WW9A 4DGLA 2M6NA 5C4XI 2IZ3A 3HOWI 3Q87A 1TWHI 3F3PC 3PO3S 1M1K2 1RNIA 2R92I 2YU9I 1YIJ1 2DE6A 1P9NA 1YHQ1 1M901 4MXUA 2IZ4A 5IT9f 4DQYB 3CMA1 4NFRA 3PO2I 3IFUA 1NJI2 1DL6A 1WIIA 2JA6I 2W03A 2YADA 3S15I 4NH1C 2VUGA 2PK7A 4MD7A 5C44I 1Y1VI 1W2BY 3M3YI 2OTLZ 3CC21 2JIMA 2VPWA 2V8KA 2E7ZA 1VLAA 1VQL1 1NUIA 3U50C 2F4OA 3IR7A 5CM2M 2E2JI 3I551 2Y0SA 1Q821 2B63I 3FKII 1QVGY 1VQ61 4A3FI 1N8R1 4NBAA 4NBEA 3MONA 2NAPA 1YI2Z 4Y52I 1VQ4Z 4E32A 2NVXI 2JNYA 1Z01A 3GTMI 1YJW1 3J81f 3NH8A 3CC41 2IV2X 1R9TI 2LFUA 4A3EI 1YJ9Z 3NDIA 1K9M1 2QREB 1WCMI 3S1MI 2QLVB 3CCM1 2RIQA 3VMHA 1S721 1TWAI 1VQP1 4RVGA 3S2DI 1W2BZ 1QVFY 5C3EI 1KC82 2E2HI 3BG1B 3G6EZ 4NB8A 3G711 2ZAEB 3CQZI 2JIPA 1TWGI 3J80f 2NVTI 3GTGI 1X3WA 1VQMZ 2Q51A 3CC71 1I3QI 2O53A 1QVGZ 5IP9I 3F3FC 3CCRZ 2JIOA 1KQSY 2GTHA 2OOYB 3CCJ1 1KD12 2VUMI 4E33A 1QYPA 1WZNA 2WAQA 2K3RA 2DE5A 3HOZI 3CCEZ 3MZKB 2K5RA 3H3VJ 1Z03A 4NB9A 1RO2A 1ZB9A 5FLXb 1RLYA 4BBRI 1WJ2A 3T4NB 1I6HI 4RVHA 2V8JA 4NBDA 5D1OA 1ZH1A 4HGYA 4A3DI 3CCVZ 3D9XA 3CD61 3CCUZ 2QEXZ 4A3BI 4E31A 3HOXI 1Q822 1QVFZ 1YUKA 1VQ81 4XX2A 2W04A 3M4OI 1N8R2 3EEDA 1Y8CA 2J6AA 3CCS1 4A93I 2OTL1 1Q7Y2 5IP7I 3S1NI 2G2KA 2QR1B 4DK1A 3I4MI 4X6AI 3VTNA 1S7MA 2I3CA 4E2YA 2JA8I 5D1OB 3IX0A 1KQSZ 3S17I 4A3JI 2JIQA 2NVYI 1SFOI 1YITZ 3KIFA 1VQO1 2NVQI 4RVFA 1QXFA 4BBSI 3CCLZ 3S16I 1K8A1 3CXCZ 4BXXI 3PO3I 4RV9A 4MONA 3CC2Z 1ML8A 2RPRA 1M1K1 2JA7I 1AA6A 4MRIA 1YJ91 2M48A 2RT9A 3S1QI 4BY1I 2GU2A 4RVDA 5A2Qf 2QKDA
chains in the Genus database with same CATH topology
4NBCA 3TDHB 4TNUA 2HU9A 3OW2Y 4A3II 3CMEZ 2JA5I 2WB1A 4E2ZA 3G6E1 3J81b 1X3ZA 1Q861 1VQN1 4A3GI 1YJNZ 3CCQ1 4HH4A 3S14I 3CPWY 2O4HA 2BJOA 3TE5B 3CCR1 1YUAA 1S72Z 1VQKZ 3VMIA 3HKZA 3NDJA 1VQ91 1M902 3FQQA 3G71Z 3JAMf 3I561 3G4S1 5FLXf 3CXCY 1Q811 3K7AI 3S1RI 2OTJZ 4AYBA 3D6WA 1VQ5Z 1USPA 3J80b 2QA4Z 3GTPI 1K83I 3GKQA 3CCJZ 3VB9A 3EERA 1Y1VS 3RZDI 2JR6A 5AN9F 1KC81 2PM9A 1Y1WI 1KRLA 3CCU1 2QEX1 3OW2Z 3HOUI 1Z02A 4CL1A 2P3YA 1VQ7Z 1TWCI 3J7A4 4E30A 4A3KI 2AKLA 2H85A 1RQFA 3H0GI 3GTOI 5LL6f 1USPB 1PFTA 4NOZA 2R93I 3CPWZ 1TFIA 2P28A 1KD11 1YIJZ 2JUBA 1K731 4MH4A 3GTLI 2OZKA 3ESWA 3CD6Z 1YHQZ 3GTQI 1YIT1 2JS4A 2EGTA 3GTMS 4Y7NI 3CMAZ 5C4JI 1VQ8Z 4A3CI 2LIYA 1N2FA 3KIHA 1K9M2 3CCL1 1L1OC 5IT9b 4MD9A 1I50I 2RHBA 3CCSZ 1YI21 2V8IA 2PMZA 1VQ41 1VQLZ 5D1PA 4S1TA 4E2WA 1VQOZ 1QF8A 4MD8A 1Q862 4HGZA 3I55Z 2RBLA 2KI7B 1NJI1 1VQ6Z 3BG0B 4A3MI 3FQMA 4NBBA 1Q7Y1 3CME1 1X0TA 3GCFA 1JWHC 1YJWZ 3IF8A 5T67A 3CC4Z 1JJ2Y 3I4NI 5FLMI 3HOYI 4NBFA 2R7ZI 3P5JB 4NBHA 2VF1A 1Q812 4QTTA 3MZLB 2F4MA 1LQLA 4A3LI 1YJN1 3GTKI 3NH4A 3RZOI 1VQM1 4RS4A 3CCMZ 3GTJI 1VQK1 2E2II 1NP6A 4NBGA 5A2Qb 1VQPZ 4BY7I 3I07A 1ZB8A 4E2XA 2DE7A 2HF1A 4EWCA 3CCE1 2GTIA 1VQNZ 2QRCB 3CCQZ 2OTJ1 2JMOA 1VQ51 3CC7Z 2OOXB 2Q4ZA 3NFZA 3S2HI 1TWFI 2QA41 5T6BA 3HOVI 3VMGA 5T64A 2R6MA 3CCV1 1K732 2QRDB 3NH5A 1VQ9Z 1RO0A 4QTUA 2KPIA 3QWUA 1VQ71 1RO4A 3I56Z 3G4SZ 2E9HA 1JJ2Z 3LUSA 3JAMb 1K8A2 1WW9A 4DGLA 2M6NA 5C4XI 2IZ3A 3HOWI 3Q87A 1TWHI 3F3PC 3PO3S 1M1K2 1RNIA 2R92I 2YU9I 1YIJ1 2DE6A 1P9NA 1YHQ1 1M901 4MXUA 2IZ4A 5IT9f 4DQYB 3CMA1 4NFRA 3PO2I 3IFUA 1NJI2 1DL6A 1WIIA 2JA6I 2W03A 2YADA 3S15I 4NH1C 2VUGA 2PK7A 4MD7A 5C44I 1Y1VI 1W2BY 3M3YI 2OTLZ 3CC21 2V8KA 1VLAA 1VQL1 1NUIA 3U50C 2F4OA 5CM2M 2E2JI 3I551 2Y0SA 1Q821 2B63I 3FKII 1QVGY 1VQ61 4A3FI 1N8R1 4NBAA 4NBEA 3MONA 1YI2Z 4Y52I 1VQ4Z 4E32A 2NVXI 2JNYA 1Z01A 3GTMI 1YJW1 3J81f 3NH8A 3CC41 1R9TI 2LFUA 4A3EI 1YJ9Z 3NDIA 1K9M1 2QREB 1WCMI 3S1MI 2QLVB 3CCM1 2RIQA 3VMHA 1S721 1TWAI 1VQP1 4RVGA 3S2DI 1W2BZ 1QVFY 5C3EI 1KC82 2E2HI 3BG1B 3G6EZ 4NB8A 3G711 2ZAEB 3CQZI 1TWGI 3J80f 2NVTI 3GTGI 1X3WA 1VQMZ 2Q51A 3CC71 1I3QI 2O53A 1QVGZ 5IP9I 3F3FC 3CCRZ 1KQSY 2GTHA 2OOYB 3CCJ1 1KD12 2VUMI 4E33A 1QYPA 2WAQA 2K3RA 2DE5A 3HOZI 3CCEZ 3MZKB 2K5RA 3H3VJ 1Z03A 4NB9A 1RO2A 1ZB9A 5FLXb 1RLYA 4BBRI 3T4NB 1I6HI 4RVHA 2V8JA 4NBDA 5D1OA 1ZH1A 4HGYA 4A3DI 3CCVZ 3D9XA 3CD61 3CCUZ 2QEXZ 4A3BI 4E31A 3HOXI 1Q822 1QVFZ 1YUKA 1VQ81 4XX2A 2W04A 3M4OI 1N8R2 3EEDA 2J6AA 3CCS1 4A93I 2OTL1 1Q7Y2 5IP7I 3S1NI 2G2KA 2QR1B 4DK1A 3I4MI 4X6AI 3VTNA 1S7MA 2I3CA 4E2YA 2JA8I 5D1OB 3IX0A 1KQSZ 3S17I 4A3JI 2NVYI 1SFOI 1YITZ 3KIFA 1VQO1 2NVQI 4RVFA 4BBSI 3CCLZ 3S16I 1K8A1 3CXCZ 4BXXI 3PO3I 4RV9A 4MONA 3CC2Z 1ML8A 2RPRA 1M1K1 2JA7I 4MRIA 1YJ91 2M48A 2RT9A 3S1QI 4BY1I 2GU2A 4RVDA 5A2Qf 2QKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QF8 A;  4MD8 A;  1JWH C;  4MD9 A;  4NH1 C;  4DGL A;  2JMO A;  2M48 A;  2M6N A;  2RT9 A;  4MD7 A;  3EED A;  1RQF A;  2R6M A; 
#chains in the Genus database with same CATH topology
 4NBC A;  3TDH B;  4TNU A;  2HU9 A;  3OW2 Y;  4A3I I;  1SIW A;  3CME Z;  2JA5 I;  2WB1 A;  4E2Z A;  3G6E 1;  3J81 b;  1X3Z A;  1Q86 1;  1VQN 1;  4A3G I;  1YJN Z;  3CCQ 1;  4HH4 A;  3S14 I;  3CPW Y;  2O4H A;  2BJO A;  3TE5 B;  3CCR 1;  1YUA A;  1S72 Z;  1VQK Z;  3VMI A;  3HKZ A;  3NDJ A;  1VQ9 1;  1M90 2;  3FQQ A;  3G71 Z;  3JAM f;  3I56 1;  3G4S 1;  5FLX f;  3CXC Y;  1Q81 1;  3K7A I;  3S1R I;  2OTJ Z;  4AYB A;  3D6W A;  1VQ5 Z;  1USP A;  3J80 b;  2QA4 Z;  3GTP I;  1K83 I;  3GKQ A;  3CCJ Z;  3VB9 A;  3EER A;  1Y1V S;  3RZD I;  2JR6 A;  5AN9 F;  1KC8 1;  2PM9 A;  1Y1W I;  1KRL A;  3CCU 1;  2QEX 1;  3OW2 Z;  3HOU I;  1Z02 A;  4CL1 A;  2P3Y A;  1VQ7 Z;  1TWC I;  3J7A 4;  4E30 A;  4A3K I;  2AKL A;  2H85 A;  1Q16 A;  1RQF A;  3H0G I;  3GTO I;  5LL6 f;  2VPX A;  1USP B;  1PFT A;  4NOZ A;  2R93 I;  3CPW Z;  1TFI A;  2P28 A;  1KD1 1;  1YIJ Z;  2JUB A;  1K73 1;  4MH4 A;  3GTL I;  2OZK A;  3ESW A;  3CD6 Z;  1YHQ Z;  3GTQ I;  1YIT 1;  2JS4 A;  2EGT A;  3GTM S;  4Y7N I;  2AYD A;  3CMA Z;  5C4J I;  1VQ8 Z;  4A3C I;  2LIY A;  1N2F A;  2VPZ A;  3KIH A;  1K9M 2;  3CCL 1;  1L1O C;  5IT9 b;  4MD9 A;  1I50 I;  2RHB A;  3CCS Z;  1YI2 1;  2V8I A;  2PMZ A;  1VQ4 1;  1VQL Z;  5D1P A;  4S1T A;  2V3V A;  2JIR A;  4E2W A;  1VQO Z;  1QF8 A;  4MD8 A;  1Q86 2;  4HGZ A;  3I55 Z;  2RBL A;  2KI7 B;  1NJI 1;  1VQ6 Z;  3BG0 B;  4A3M I;  3FQM A;  4NBB A;  1Q7Y 1;  2V45 A;  3D2L A;  3CME 1;  1X0T A;  3GCF A;  1JWH C;  1YJW Z;  3IF8 A;  5T67 A;  3CC4 Z;  1JJ2 Y;  3I4N I;  5FLM I;  3HOY I;  4NBF A;  2R7Z I;  3P5J B;  4NBH A;  2VF1 A;  1Q81 2;  4QTT A;  3MZL B;  2F4M A;  1LQL A;  4A3L I;  1YJN 1;  3GTK I;  3NH4 A;  3RZO I;  1VQM 1;  4RS4 A;  3CCM Z;  3GTJ I;  1VQK 1;  2E2I I;  1NP6 A;  4NBG A;  5A2Q b;  1VQP Z;  1FDI A;  4BY7 I;  3I07 A;  1ZB8 A;  4E2X A;  2DE7 A;  2HF1 A;  4EWC A;  3CCE 1;  2GTI A;  1VQN Z;  2QRC B;  3CCQ Z;  2OTJ 1;  2JMO A;  1VQ5 1;  3CC7 Z;  2OOX B;  2Q4Z A;  2LEX A;  3NFZ A;  3S2H I;  1TWF I;  2QA4 1;  5T6B A;  3HOV I;  3VMG A;  1FDO A;  5T64 A;  2R6M A;  3CCV 1;  1K73 2;  2QRD B;  3NH5 A;  1VQ9 Z;  1RO0 A;  4QTU A;  2KPI A;  3QWU A;  1VQ7 1;  1RO4 A;  3I56 Z;  3G4S Z;  2E9H A;  1JJ2 Z;  3LUS A;  3JAM b;  2VPY A;  1K8A 2;  1WW9 A;  4DGL A;  2M6N A;  5C4X I;  2IZ3 A;  3HOW I;  3Q87 A;  1TWH I;  3F3P C;  3PO3 S;  1M1K 2;  1RNI A;  2R92 I;  2YU9 I;  1YIJ 1;  2DE6 A;  1P9N A;  1YHQ 1;  1M90 1;  4MXU A;  2IZ4 A;  5IT9 f;  4DQY B;  3CMA 1;  4NFR A;  3PO2 I;  3IFU A;  1NJI 2;  1DL6 A;  1WII A;  2JA6 I;  2W03 A;  2YAD A;  3S15 I;  4NH1 C;  2VUG A;  2PK7 A;  4MD7 A;  5C44 I;  1Y1V I;  1W2B Y;  3M3Y I;  2OTL Z;  3CC2 1;  2JIM A;  2VPW A;  2V8K A;  2E7Z A;  1VLA A;  1VQL 1;  1NUI A;  3U50 C;  2F4O A;  3IR7 A;  5CM2 M;  2E2J I;  3I55 1;  2Y0S A;  1Q82 1;  2B63 I;  3FKI I;  1QVG Y;  1VQ6 1;  4A3F I;  1N8R 1;  4NBA A;  4NBE A;  3MON A;  2NAP A;  1YI2 Z;  4Y52 I;  1VQ4 Z;  4E32 A;  2NVX I;  2JNY A;  1Z01 A;  3GTM I;  1YJW 1;  3J81 f;  3NH8 A;  3CC4 1;  2IV2 X;  1R9T I;  2LFU A;  4A3E I;  1YJ9 Z;  3NDI A;  1K9M 1;  2QRE B;  1WCM I;  3S1M I;  2QLV B;  3CCM 1;  2RIQ A;  3VMH A;  1S72 1;  1TWA I;  1VQP 1;  4RVG A;  3S2D I;  1W2B Z;  1QVF Y;  5C3E I;  1KC8 2;  2E2H I;  3BG1 B;  3G6E Z;  4NB8 A;  3G71 1;  2ZAE B;  3CQZ I;  2JIP A;  1TWG I;  3J80 f;  2NVT I;  3GTG I;  1X3W A;  1VQM Z;  2Q51 A;  3CC7 1;  1I3Q I;  2O53 A;  1QVG Z;  5IP9 I;  3F3F C;  3CCR Z;  2JIO A;  1KQS Y;  2GTH A;  2OOY B;  3CCJ 1;  1KD1 2;  2VUM I;  4E33 A;  1QYP A;  1WZN A;  2WAQ A;  2K3R A;  2DE5 A;  3HOZ I;  3CCE Z;  3MZK B;  2K5R A;  3H3V J;  1Z03 A;  4NB9 A;  1RO2 A;  1ZB9 A;  5FLX b;  1RLY A;  4BBR I;  1WJ2 A;  3T4N B;  1I6H I;  4RVH A;  2V8J A;  4NBD A;  5D1O A;  1ZH1 A;  4HGY A;  4A3D I;  3CCV Z;  3D9X A;  3CD6 1;  3CCU Z;  2QEX Z;  4A3B I;  4E31 A;  3HOX I;  1Q82 2;  1QVF Z;  1YUK A;  1VQ8 1;  4XX2 A;  2W04 A;  3M4O I;  1N8R 2;  3EED A;  1Y8C A;  2J6A A;  3CCS 1;  4A93 I;  2OTL 1;  1Q7Y 2;  5IP7 I;  3S1N I;  2G2K A;  2QR1 B;  4DK1 A;  3I4M I;  4X6A I;  3VTN A;  1S7M A;  2I3C A;  4E2Y A;  2JA8 I;  5D1O B;  3IX0 A;  1KQS Z;  3S17 I;  4A3J I;  2JIQ A;  2NVY I;  1SFO I;  1YIT Z;  3KIF A;  1VQO 1;  2NVQ I;  4RVF A;  1QXF A;  4BBS I;  3CCL Z;  3S16 I;  1K8A 1;  3CXC Z;  4BXX I;  3PO3 I;  4RV9 A;  4MON A;  3CC2 Z;  1ML8 A;  2RPR A;  1M1K 1;  2JA7 I;  1AA6 A;  4MRI A;  1YJ9 1;  2M48 A;  2RT9 A;  3S1Q I;  4BY1 I;  2GU2 A;  4RVD A;  5A2Q f;  2QKD A; 
#chains in the Genus database with same CATH homology
 4NBC A;  3TDH B;  4TNU A;  2HU9 A;  3OW2 Y;  4A3I I;  3CME Z;  2JA5 I;  2WB1 A;  4E2Z A;  3G6E 1;  3J81 b;  1X3Z A;  1Q86 1;  1VQN 1;  4A3G I;  1YJN Z;  3CCQ 1;  4HH4 A;  3S14 I;  3CPW Y;  2O4H A;  2BJO A;  3TE5 B;  3CCR 1;  1YUA A;  1S72 Z;  1VQK Z;  3VMI A;  3HKZ A;  3NDJ A;  1VQ9 1;  1M90 2;  3FQQ A;  3G71 Z;  3JAM f;  3I56 1;  3G4S 1;  5FLX f;  3CXC Y;  1Q81 1;  3K7A I;  3S1R I;  2OTJ Z;  4AYB A;  3D6W A;  1VQ5 Z;  1USP A;  3J80 b;  2QA4 Z;  3GTP I;  1K83 I;  3GKQ A;  3CCJ Z;  3VB9 A;  3EER A;  1Y1V S;  3RZD I;  2JR6 A;  5AN9 F;  1KC8 1;  2PM9 A;  1Y1W I;  1KRL A;  3CCU 1;  2QEX 1;  3OW2 Z;  3HOU I;  1Z02 A;  4CL1 A;  2P3Y A;  1VQ7 Z;  1TWC I;  3J7A 4;  4E30 A;  4A3K I;  2AKL A;  2H85 A;  1RQF A;  3H0G I;  3GTO I;  5LL6 f;  1USP B;  1PFT A;  4NOZ A;  2R93 I;  3CPW Z;  1TFI A;  2P28 A;  1KD1 1;  1YIJ Z;  2JUB A;  1K73 1;  4MH4 A;  3GTL I;  2OZK A;  3ESW A;  3CD6 Z;  1YHQ Z;  3GTQ I;  1YIT 1;  2JS4 A;  2EGT A;  3GTM S;  4Y7N I;  3CMA Z;  5C4J I;  1VQ8 Z;  4A3C I;  2LIY A;  1N2F A;  3KIH A;  1K9M 2;  3CCL 1;  1L1O C;  5IT9 b;  4MD9 A;  1I50 I;  2RHB A;  3CCS Z;  1YI2 1;  2V8I A;  2PMZ A;  1VQ4 1;  1VQL Z;  5D1P A;  4S1T A;  4E2W A;  1VQO Z;  1QF8 A;  4MD8 A;  1Q86 2;  4HGZ A;  3I55 Z;  2RBL A;  2KI7 B;  1NJI 1;  1VQ6 Z;  3BG0 B;  4A3M I;  3FQM A;  4NBB A;  1Q7Y 1;  3CME 1;  1X0T A;  3GCF A;  1JWH C;  1YJW Z;  3IF8 A;  5T67 A;  3CC4 Z;  1JJ2 Y;  3I4N I;  5FLM I;  3HOY I;  4NBF A;  2R7Z I;  3P5J B;  4NBH A;  2VF1 A;  1Q81 2;  4QTT A;  3MZL B;  2F4M A;  1LQL A;  4A3L I;  1YJN 1;  3GTK I;  3NH4 A;  3RZO I;  1VQM 1;  4RS4 A;  3CCM Z;  3GTJ I;  1VQK 1;  2E2I I;  1NP6 A;  4NBG A;  5A2Q b;  1VQP Z;  4BY7 I;  3I07 A;  1ZB8 A;  4E2X A;  2DE7 A;  2HF1 A;  4EWC A;  3CCE 1;  2GTI A;  1VQN Z;  2QRC B;  3CCQ Z;  2OTJ 1;  2JMO A;  1VQ5 1;  3CC7 Z;  2OOX B;  2Q4Z A;  3NFZ A;  3S2H I;  1TWF I;  2QA4 1;  5T6B A;  3HOV I;  3VMG A;  5T64 A;  2R6M A;  3CCV 1;  1K73 2;  2QRD B;  3NH5 A;  1VQ9 Z;  1RO0 A;  4QTU A;  2KPI A;  3QWU A;  1VQ7 1;  1RO4 A;  3I56 Z;  3G4S Z;  2E9H A;  1JJ2 Z;  3LUS A;  3JAM b;  1K8A 2;  1WW9 A;  4DGL A;  2M6N A;  5C4X I;  2IZ3 A;  3HOW I;  3Q87 A;  1TWH I;  3F3P C;  3PO3 S;  1M1K 2;  1RNI A;  2R92 I;  2YU9 I;  1YIJ 1;  2DE6 A;  1P9N A;  1YHQ 1;  1M90 1;  4MXU A;  2IZ4 A;  5IT9 f;  4DQY B;  3CMA 1;  4NFR A;  3PO2 I;  3IFU A;  1NJI 2;  1DL6 A;  1WII A;  2JA6 I;  2W03 A;  2YAD A;  3S15 I;  4NH1 C;  2VUG A;  2PK7 A;  4MD7 A;  5C44 I;  1Y1V I;  1W2B Y;  3M3Y I;  2OTL Z;  3CC2 1;  2V8K A;  1VLA A;  1VQL 1;  1NUI A;  3U50 C;  2F4O A;  5CM2 M;  2E2J I;  3I55 1;  2Y0S A;  1Q82 1;  2B63 I;  3FKI I;  1QVG Y;  1VQ6 1;  4A3F I;  1N8R 1;  4NBA A;  4NBE A;  3MON A;  1YI2 Z;  4Y52 I;  1VQ4 Z;  4E32 A;  2NVX I;  2JNY A;  1Z01 A;  3GTM I;  1YJW 1;  3J81 f;  3NH8 A;  3CC4 1;  1R9T I;  2LFU A;  4A3E I;  1YJ9 Z;  3NDI A;  1K9M 1;  2QRE B;  1WCM I;  3S1M I;  2QLV B;  3CCM 1;  2RIQ A;  3VMH A;  1S72 1;  1TWA I;  1VQP 1;  4RVG A;  3S2D I;  1W2B Z;  1QVF Y;  5C3E I;  1KC8 2;  2E2H I;  3BG1 B;  3G6E Z;  4NB8 A;  3G71 1;  2ZAE B;  3CQZ I;  1TWG I;  3J80 f;  2NVT I;  3GTG I;  1X3W A;  1VQM Z;  2Q51 A;  3CC7 1;  1I3Q I;  2O53 A;  1QVG Z;  5IP9 I;  3F3F C;  3CCR Z;  1KQS Y;  2GTH A;  2OOY B;  3CCJ 1;  1KD1 2;  2VUM I;  4E33 A;  1QYP A;  2WAQ A;  2K3R A;  2DE5 A;  3HOZ I;  3CCE Z;  3MZK B;  2K5R A;  3H3V J;  1Z03 A;  4NB9 A;  1RO2 A;  1ZB9 A;  5FLX b;  1RLY A;  4BBR I;  3T4N B;  1I6H I;  4RVH A;  2V8J A;  4NBD A;  5D1O A;  1ZH1 A;  4HGY A;  4A3D I;  3CCV Z;  3D9X A;  3CD6 1;  3CCU Z;  2QEX Z;  4A3B I;  4E31 A;  3HOX I;  1Q82 2;  1QVF Z;  1YUK A;  1VQ8 1;  4XX2 A;  2W04 A;  3M4O I;  1N8R 2;  3EED A;  2J6A A;  3CCS 1;  4A93 I;  2OTL 1;  1Q7Y 2;  5IP7 I;  3S1N I;  2G2K A;  2QR1 B;  4DK1 A;  3I4M I;  4X6A I;  3VTN A;  1S7M A;  2I3C A;  4E2Y A;  2JA8 I;  5D1O B;  3IX0 A;  1KQS Z;  3S17 I;  4A3J I;  2NVY I;  1SFO I;  1YIT Z;  3KIF A;  1VQO 1;  2NVQ I;  4RVF A;  4BBS I;  3CCL Z;  3S16 I;  1K8A 1;  3CXC Z;  4BXX I;  3PO3 I;  4RV9 A;  4MON A;  3CC2 Z;  1ML8 A;  2RPR A;  1M1K 1;  2JA7 I;  4MRI A;  1YJ9 1;  2M48 A;  2RT9 A;  3S1Q I;  4BY1 I;  2GU2 A;  4RVD A;  5A2Q f;  2QKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...