3S1MI

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI02
4NBCA 3M3YI 2DE6A 2J6AA 1DL6A 3PO3I 4X6AI 2AKLA 2KPIA 4Y7NI 3H3VJ 1X3WA 1I6HI 2VUMI 4A3CI 4A3MI 3HOVI 1Y1WI 3U50C 5FLMI 1YUAA 3RZOI 5IP9I 2BJOA 3S2DI 2F4OA 4NBGA 4NBDA 2JA8I 3VMGA 1Y1VS 4A3LI 2E2JI 5IP7I 1TWHI 3GTMS 3S1QI 4A3DI 4NOZA 3S1RI 4NB9A 3D6WA 2JA5I 1USPA 4QTTA 4BBRI 3GTLI 1ZB9A 1SFOI 1Y1VI 3FKII 1RO4A 3GTMI 1ZB8A 1RLYA 2RBLA 3S1MI 4BBSI 5C4XI 2NVQI 3VB9A 1VLAA 2PK7A 3HOZI 3S14I 1R9TI 3HOYI 1N2FA 3GTKI 5C4JI 2E2HI 2NVXI 3HOUI 1I50I 2YU9I 1PFTA 3PO2I 2HF1A 4A3BI 3S1NI 2NVYI 3S2HI 3M4OI 1NUIA 3H0GI 1I3QI 1WCMI 3I4MI 5CM2M 3GKQA 4A3GI 4BY1I 3S17I 2JS4A 2JA6I 2JR6A 4NBEA 4NB8A 3VMHA 3RZDI 1TWAI 1USPB 1X3ZA 3ESWA 1TWGI 4A3EI 1WW9A 3S15I 2E2II 4XX2A 3Q87A 3HOXI 4NBBA 2B63I 4BXXI 1K83I 3GCFA 2DE5A 3HOWI 3S16I 4MH4A 2NVTI 3CQZI 4Y52I 3GTJI 3K7AI 3GTOI 3I07A 1QYPA 3I4NI 3GTPI 2JNYA 1TWFI 1TFIA 4QTUA 4A3II 3GTGI 4BY7I 4A93I 3GTQI 4A3KI 4NBFA 1TWCI 4NBAA 5C3EI 2DE7A 3LUSA 3VMIA 2JA7I 2P3YA 3PO3S 2R7ZI 2R92I 1L1OC 2F4MA 2R93I 4NBHA 5C44I 1LQLA 4A3FI 2K5RA 4A3JI 3EERA 1ML8A
chains in the Genus database with same CATH superfamily
2PMZA 3D9XA 4TNUA 1YHQ1 2J6AA 2KI7B 1DL6A 4NH1C 3OW2Z 4X6AI 2KPIA 4MD8A 4E2XA 3NH4A 5A2Qf 4E33A 1X3WA 3CCV1 3MONA 1K8A2 1VQ71 1VQK1 5FLXf 3JAMf 2RHBA 3U50C 2BJOA 2F4OA 2RT9A 4E2ZA 1VQ5Z 5IT9f 2VPWA 1YITZ 2G2KA 1NP6A 3S1QI 2VUGA 4E2YA 2WB1A 3CD61 4QTTA 1JJ2Y 1NJI2 1ZB9A 4E30A 3GTMI 2QA41 1ZB8A 1RLYA 2GU2A 2V45A 3S1MI 4RVHA 2PK7A 1R9TI 2JIQA 2E2HI 1I50I 3G6E1 3G4SZ 1VQ91 3BG1B 4AYBA 4E31A 1VQO1 2R6MA 3S2HI 2Q4ZA 1KC81 1KQSZ 3H0GI 3FQQA 1K731 1WCMI 3MZKB 4DK1A 2QKDA 2VPZA 1P9NA 2JR6A 3VMHA 2QEX1 1TWAI 3ESWA 4A3EI 2OTLZ 3OW2Y 1VQLZ 3CCQZ 3HOXI 3IFUA 3CC21 4NBBA 1Z02A 3IR7A 3S16I 1M1K1 2VPXA 5T6BA 3GTOI 1QYPA 3I4NI 1TFIA 4QTUA 3CMA1 1Q822 1VQNZ 1K8A1 2M48A 5C3EI 2DE7A 3LUSA 2JA7I 2P3YA 3CCE1 1JJ2Z 3CCSZ 1Z03A 1YJ9Z 2R93I 2QR1B 5A2Qb 5T64A 2DE6A 3NDIA 2O53A 1YJN1 2WAQA 2EGTA 2AKLA 1VQ4Z 3H3VJ 1WZNA 4RS4A 4S1TA 3CCL1 1QXFA 1NJI1 3CCMZ 2YADA 2OTJ1 3EEDA 5FLMI 1YUAA 4NBGA 4NBDA 1S72Z 2NAPA 2VF1A 1Q7Y2 1QF8A 2LFUA 1TWHI 5D1PA 3GTMS 4MONA 1RO0A 2RIQA 3J80b 2GTHA 1Z01A 3S1RI 4MD7A 1SFOI 1Y1VI 2JIOA 1ZH1A 3VB9A 2NVQI 1VQ8Z 1N8R2 3CCRZ 5C4JI 3HOUI 1VQ51 2JMOA 2P28A 1YIT1 2NVYI 1ML8A 3CCUZ 3CC4Z 1NUIA 3GKQA 5D1OA 2VPYA 4A3GI 4RV9A 3CMEZ 4BY1I 3S17I 2Y0SA 1Q821 1WIIA 1M902 1USPB 1X3ZA 1TWGI 1YI2Z 1SIWA 2IZ4A 3CC7Z 3J7A4 4MRIA 2LIYA 3I55Z 3G4S1 1VQMZ 2W03A 2RPRA 3Q87A 2JUBA 1K83I 2K3RA 2IV2X 2JIPA 3K7AI 3I07A 2M6NA 3GTPI 2JNYA 4BY7I 3QWUA 3FQMA 3GTQI 4A3KI 4NBFA 4CL1A 3VMIA 5LL6f 2OTL1 2R7ZI 2R92I 1VQ9Z 5C44I 4A3FI 1LQLA 3CCQ1 1VQL1 5AN9F 2K5RA 3M4OI 4NBCA 1Q7Y1 1VQ6Z 3F3FC 4HGZA 3PO3I 4MXUA 3TE5B 4Y7NI 2QRCB 1I6HI 3KIFA 4A3CI 1VQN1 2QEXZ 3NH5A 4DQYB 3G71Z 1Y1WI 2V8IA 2O4HA 1K9M2 3CCS1 1N8R1 1YJ91 3F3PC 3VMGA 2OOXB 1Y1VS 2ZAEB 2E2JI 2LEXA 2OOYB 3I56Z 4NOZA 3NH8A 4NB9A 2JA5I 5FLXb 2QREB 3JAMb 4BBRI 1VQ41 3GTLI 1YJWZ 4RVGA 3FKII 4EWCA 2RBLA 1VQPZ 4E2WA 5C4XI 3CCM1 4BBSI 5IT9b 3MZLB 1VLAA 3S14I 1AA6A 2V3VA 1N2FA 1YIJZ 1M901 2NVXI 2YU9I 2HF1A 3T4NB 2OZKA 1W2BZ 1QVFZ 2QLVB 3I4MI 2JIRA 2HU9A 2JS4A 2JA6I 3CCJZ 1QVGZ 2W04A 5D1OB 1VQ81 3CPWZ 3CCR1 3S15I 3KIHA 4MD9A 3J81f 4XX2A 1X0TA 1RO2A 3CCU1 2V8KA 3CC41 1YHQZ 3GCFA 2DE5A 3HOWI 4MH4A 1Q812 2NVTI 3CQZI 4Y52I 1Q16A 3CME1 1JWHC 3GTGI 4A3II 3CCVZ 3BG0B 4NFRA 1VQ7Z 1VQKZ 2E9HA 5T67A 2PM9A 3TDHB 2V8JA 1YI21 3PO3S 3CC71 1L1OC 1K9M1 3I551 4DGLA 1VQM1 3EERA 3M3YI 3CD6Z 2JIMA 2VUMI 1KD12 3J80f 4A3MI 2QA4Z 3HOVI 1Y8CA 1Q862 4E32A 1W2BY 3RZOI 2E7ZA 1QVFY 5IP9I 1FDIA 3S2DI 1FDOA 2JA8I 3G6EZ 2IZ3A 4A3LI 3IX0A 1VQOZ 5IP7I 1QVGY 1VQ61 4A3DI 2AYDA 3D2LA 3D6WA 1USPA 3IF8A 3CXCY 3CPWY 1RO4A 4RVDA 3VTNA 3G711 3HOZI 2QRDB 3HOYI 3GTKI 4HGYA 1PFTA 3PO2I 4A3BI 1WJ2A 3S1NI 3CC2Z 3I561 1I3QI 5CM2M 4HH4A 1Q811 3P5JB 3NDJA 3CMAZ 1YJW1 3HKZA 4NBEA 4NB8A 1VQP1 3J81b 3RZDI 3CCEZ 1YIJ1 1WW9A 2E2II 1S721 1YUKA 1KC82 1K732 4BXXI 2H85A 4RVFA 2B63I 1RNIA 1YJNZ 1KRLA 3GTJI 1RQFA 1TWFI 3CCJ1 3CCLZ 4A93I 1KD11 1TWCI 4NBAA 2Q51A 2OTJZ 1Q861 1KQSY 2I3CA 3CXCZ 2GTIA 1S7MA 2F4MA 4NBHA 1M1K2 4A3JI 3NFZA
chains in the Genus database with same CATH topology
2PMZA 3D9XA 4TNUA 1YHQ1 2J6AA 2KI7B 1DL6A 4NH1C 3OW2Z 4X6AI 2KPIA 4MD8A 4E2XA 3NH4A 5A2Qf 4E33A 1X3WA 3CCV1 3MONA 1K8A2 1VQ71 1VQK1 5FLXf 3JAMf 2RHBA 3U50C 2BJOA 2F4OA 2RT9A 4E2ZA 1VQ5Z 5IT9f 1YITZ 2G2KA 1NP6A 3S1QI 2VUGA 4E2YA 2WB1A 3CD61 4QTTA 1JJ2Y 1NJI2 1ZB9A 4E30A 3GTMI 2QA41 1ZB8A 1RLYA 2GU2A 3S1MI 4RVHA 2PK7A 1R9TI 2E2HI 1I50I 3G6E1 3G4SZ 1VQ91 3BG1B 4AYBA 4E31A 1VQO1 2R6MA 3S2HI 2Q4ZA 1KC81 1KQSZ 3H0GI 3FQQA 1K731 1WCMI 3MZKB 4DK1A 2QKDA 1P9NA 2JR6A 3VMHA 2QEX1 1TWAI 3ESWA 4A3EI 2OTLZ 3OW2Y 1VQLZ 3CCQZ 3HOXI 3IFUA 3CC21 4NBBA 1Z02A 3S16I 1M1K1 5T6BA 3GTOI 1QYPA 3I4NI 1TFIA 4QTUA 3CMA1 1Q822 1VQNZ 1K8A1 2M48A 5C3EI 2DE7A 3LUSA 2JA7I 2P3YA 3CCE1 1JJ2Z 3CCSZ 1Z03A 1YJ9Z 2R93I 2QR1B 5A2Qb 5T64A 2DE6A 3NDIA 2O53A 1YJN1 2WAQA 2EGTA 2AKLA 1VQ4Z 3H3VJ 4RS4A 4S1TA 3CCL1 1NJI1 3CCMZ 2YADA 2OTJ1 3EEDA 5FLMI 1YUAA 4NBGA 4NBDA 1S72Z 2VF1A 1Q7Y2 1QF8A 2LFUA 1TWHI 5D1PA 3GTMS 4MONA 1RO0A 2RIQA 3J80b 2GTHA 1Z01A 3S1RI 4MD7A 1SFOI 1Y1VI 1ZH1A 3VB9A 2NVQI 1VQ8Z 1N8R2 3CCRZ 5C4JI 3HOUI 1VQ51 2JMOA 2P28A 1YIT1 2NVYI 1ML8A 3CCUZ 3CC4Z 1NUIA 3GKQA 5D1OA 4A3GI 4RV9A 3CMEZ 4BY1I 3S17I 2Y0SA 1Q821 1WIIA 1M902 1USPB 1X3ZA 1TWGI 1YI2Z 2IZ4A 3CC7Z 3J7A4 4MRIA 2LIYA 3I55Z 3G4S1 1VQMZ 2W03A 2RPRA 3Q87A 2JUBA 1K83I 2K3RA 3K7AI 3I07A 2M6NA 3GTPI 2JNYA 4BY7I 3QWUA 3FQMA 3GTQI 4A3KI 4NBFA 4CL1A 3VMIA 5LL6f 2OTL1 2R7ZI 2R92I 1VQ9Z 5C44I 4A3FI 1LQLA 3CCQ1 1VQL1 5AN9F 2K5RA 3M4OI 4NBCA 1Q7Y1 1VQ6Z 3F3FC 4HGZA 3PO3I 4MXUA 3TE5B 4Y7NI 2QRCB 1I6HI 3KIFA 4A3CI 1VQN1 2QEXZ 3NH5A 4DQYB 3G71Z 1Y1WI 2V8IA 2O4HA 1K9M2 3CCS1 1N8R1 1YJ91 3F3PC 3VMGA 2OOXB 1Y1VS 2ZAEB 2E2JI 2OOYB 3I56Z 4NOZA 3NH8A 4NB9A 2JA5I 5FLXb 2QREB 3JAMb 4BBRI 1VQ41 3GTLI 1YJWZ 4RVGA 3FKII 4EWCA 2RBLA 1VQPZ 4E2WA 5C4XI 3CCM1 4BBSI 5IT9b 3MZLB 1VLAA 3S14I 1N2FA 1YIJZ 1M901 2NVXI 2YU9I 2HF1A 3T4NB 2OZKA 1W2BZ 1QVFZ 2QLVB 3I4MI 2HU9A 2JS4A 2JA6I 3CCJZ 1QVGZ 2W04A 5D1OB 1VQ81 3CPWZ 3CCR1 3S15I 3KIHA 4MD9A 3J81f 4XX2A 1X0TA 1RO2A 3CCU1 2V8KA 3CC41 1YHQZ 3GCFA 2DE5A 3HOWI 4MH4A 1Q812 2NVTI 3CQZI 4Y52I 3CME1 1JWHC 3GTGI 4A3II 3CCVZ 3BG0B 4NFRA 1VQ7Z 1VQKZ 2E9HA 5T67A 2PM9A 3TDHB 2V8JA 1YI21 3PO3S 3CC71 1L1OC 1K9M1 3I551 4DGLA 1VQM1 3EERA 3M3YI 3CD6Z 2VUMI 1KD12 3J80f 4A3MI 2QA4Z 3HOVI 1Q862 4E32A 1W2BY 3RZOI 1QVFY 5IP9I 3S2DI 2JA8I 3G6EZ 2IZ3A 4A3LI 3IX0A 1VQOZ 5IP7I 1QVGY 1VQ61 4A3DI 3D6WA 1USPA 3IF8A 3CXCY 3CPWY 1RO4A 4RVDA 3VTNA 3G711 3HOZI 2QRDB 3HOYI 3GTKI 4HGYA 1PFTA 3PO2I 4A3BI 3S1NI 3CC2Z 3I561 1I3QI 5CM2M 4HH4A 1Q811 3P5JB 3NDJA 3CMAZ 1YJW1 3HKZA 4NBEA 4NB8A 1VQP1 3J81b 3RZDI 3CCEZ 1YIJ1 1WW9A 2E2II 1S721 1YUKA 1KC82 1K732 4BXXI 2H85A 4RVFA 2B63I 1RNIA 1YJNZ 1KRLA 3GTJI 1RQFA 1TWFI 3CCJ1 3CCLZ 4A93I 1KD11 1TWCI 4NBAA 2Q51A 2OTJZ 1Q861 1KQSY 2I3CA 3CXCZ 2GTIA 1S7MA 2F4MA 4NBHA 1M1K2 4A3JI 3NFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBC A;  3M3Y I;  2DE6 A;  2J6A A;  1DL6 A;  3PO3 I;  4X6A I;  2AKL A;  2KPI A;  4Y7N I;  3H3V J;  1X3W A;  1I6H I;  2VUM I;  4A3C I;  4A3M I;  3HOV I;  1Y1W I;  3U50 C;  5FLM I;  1YUA A;  3RZO I;  5IP9 I;  2BJO A;  3S2D I;  2F4O A;  4NBG A;  4NBD A;  2JA8 I;  3VMG A;  1Y1V S;  4A3L I;  2E2J I;  5IP7 I;  1TWH I;  3GTM S;  3S1Q I;  4A3D I;  4NOZ A;  3S1R I;  4NB9 A;  3D6W A;  2JA5 I;  1USP A;  4QTT A;  4BBR I;  3GTL I;  1ZB9 A;  1SFO I;  1Y1V I;  3FKI I;  1RO4 A;  3GTM I;  1ZB8 A;  1RLY A;  2RBL A;  3S1M I;  4BBS I;  5C4X I;  2NVQ I;  3VB9 A;  1VLA A;  2PK7 A;  3HOZ I;  3S14 I;  1R9T I;  3HOY I;  1N2F A;  3GTK I;  5C4J I;  2E2H I;  2NVX I;  3HOU I;  1I50 I;  2YU9 I;  1PFT A;  3PO2 I;  2HF1 A;  4A3B I;  3S1N I;  2NVY I;  3S2H I;  3M4O I;  1NUI A;  3H0G I;  1I3Q I;  1WCM I;  3I4M I;  5CM2 M;  3GKQ A;  4A3G I;  4BY1 I;  3S17 I;  2JS4 A;  2JA6 I;  2JR6 A;  4NBE A;  4NB8 A;  3VMH A;  3RZD I;  1TWA I;  1USP B;  1X3Z A;  3ESW A;  1TWG I;  4A3E I;  1WW9 A;  3S15 I;  2E2I I;  4XX2 A;  3Q87 A;  3HOX I;  4NBB A;  2B63 I;  4BXX I;  1K83 I;  3GCF A;  2DE5 A;  3HOW I;  3S16 I;  4MH4 A;  2NVT I;  3CQZ I;  4Y52 I;  3GTJ I;  3K7A I;  3GTO I;  3I07 A;  1QYP A;  3I4N I;  3GTP I;  2JNY A;  1TWF I;  1TFI A;  4QTU A;  4A3I I;  3GTG I;  4BY7 I;  4A93 I;  3GTQ I;  4A3K I;  4NBF A;  1TWC I;  4NBA A;  5C3E I;  2DE7 A;  3LUS A;  3VMI A;  2JA7 I;  2P3Y A;  3PO3 S;  2R7Z I;  2R92 I;  1L1O C;  2F4M A;  2R93 I;  4NBH A;  5C44 I;  1LQL A;  4A3F I;  2K5R A;  4A3J I;  3EER A;  1ML8 A; 
#chains in the Genus database with same CATH topology
 2PMZ A;  3D9X A;  4TNU A;  1YHQ 1;  2J6A A;  2KI7 B;  1DL6 A;  4NH1 C;  3OW2 Z;  4X6A I;  2KPI A;  4MD8 A;  4E2X A;  3NH4 A;  5A2Q f;  4E33 A;  1X3W A;  3CCV 1;  3MON A;  1K8A 2;  1VQ7 1;  1VQK 1;  5FLX f;  3JAM f;  2RHB A;  3U50 C;  2BJO A;  2F4O A;  2RT9 A;  4E2Z A;  1VQ5 Z;  5IT9 f;  2VPW A;  1YIT Z;  2G2K A;  1NP6 A;  3S1Q I;  2VUG A;  4E2Y A;  2WB1 A;  3CD6 1;  4QTT A;  1JJ2 Y;  1NJI 2;  1ZB9 A;  4E30 A;  3GTM I;  2QA4 1;  1ZB8 A;  1RLY A;  2GU2 A;  2V45 A;  3S1M I;  4RVH A;  2PK7 A;  1R9T I;  2JIQ A;  2E2H I;  1I50 I;  3G6E 1;  3G4S Z;  1VQ9 1;  3BG1 B;  4AYB A;  4E31 A;  1VQO 1;  2R6M A;  3S2H I;  2Q4Z A;  1KC8 1;  1KQS Z;  3H0G I;  3FQQ A;  1K73 1;  1WCM I;  3MZK B;  4DK1 A;  2QKD A;  2VPZ A;  1P9N A;  2JR6 A;  3VMH A;  2QEX 1;  1TWA I;  3ESW A;  4A3E I;  2OTL Z;  3OW2 Y;  1VQL Z;  3CCQ Z;  3HOX I;  3IFU A;  3CC2 1;  4NBB A;  1Z02 A;  3IR7 A;  3S16 I;  1M1K 1;  2VPX A;  5T6B A;  3GTO I;  1QYP A;  3I4N I;  1TFI A;  4QTU A;  3CMA 1;  1Q82 2;  1VQN Z;  1K8A 1;  2M48 A;  5C3E I;  2DE7 A;  3LUS A;  2JA7 I;  2P3Y A;  3CCE 1;  1JJ2 Z;  3CCS Z;  1Z03 A;  1YJ9 Z;  2R93 I;  2QR1 B;  5A2Q b;  5T64 A;  2DE6 A;  3NDI A;  2O53 A;  1YJN 1;  2WAQ A;  2EGT A;  2AKL A;  1VQ4 Z;  3H3V J;  1WZN A;  4RS4 A;  4S1T A;  3CCL 1;  1QXF A;  1NJI 1;  3CCM Z;  2YAD A;  2OTJ 1;  3EED A;  5FLM I;  1YUA A;  4NBG A;  4NBD A;  1S72 Z;  2NAP A;  2VF1 A;  1Q7Y 2;  1QF8 A;  2LFU A;  1TWH I;  5D1P A;  3GTM S;  4MON A;  1RO0 A;  2RIQ A;  3J80 b;  2GTH A;  1Z01 A;  3S1R I;  4MD7 A;  1SFO I;  1Y1V I;  2JIO A;  1ZH1 A;  3VB9 A;  2NVQ I;  1VQ8 Z;  1N8R 2;  3CCR Z;  5C4J I;  3HOU I;  1VQ5 1;  2JMO A;  2P28 A;  1YIT 1;  2NVY I;  1ML8 A;  3CCU Z;  3CC4 Z;  1NUI A;  3GKQ A;  5D1O A;  2VPY A;  4A3G I;  4RV9 A;  3CME Z;  4BY1 I;  3S17 I;  2Y0S A;  1Q82 1;  1WII A;  1M90 2;  1USP B;  1X3Z A;  1TWG I;  1YI2 Z;  1SIW A;  2IZ4 A;  3CC7 Z;  3J7A 4;  4MRI A;  2LIY A;  3I55 Z;  3G4S 1;  1VQM Z;  2W03 A;  2RPR A;  3Q87 A;  2JUB A;  1K83 I;  2K3R A;  2IV2 X;  2JIP A;  3K7A I;  3I07 A;  2M6N A;  3GTP I;  2JNY A;  4BY7 I;  3QWU A;  3FQM A;  3GTQ I;  4A3K I;  4NBF A;  4CL1 A;  3VMI A;  5LL6 f;  2OTL 1;  2R7Z I;  2R92 I;  1VQ9 Z;  5C44 I;  4A3F I;  1LQL A;  3CCQ 1;  1VQL 1;  5AN9 F;  2K5R A;  3M4O I;  4NBC A;  1Q7Y 1;  1VQ6 Z;  3F3F C;  4HGZ A;  3PO3 I;  4MXU A;  3TE5 B;  4Y7N I;  2QRC B;  1I6H I;  3KIF A;  4A3C I;  1VQN 1;  2QEX Z;  3NH5 A;  4DQY B;  3G71 Z;  1Y1W I;  2V8I A;  2O4H A;  1K9M 2;  3CCS 1;  1N8R 1;  1YJ9 1;  3F3P C;  3VMG A;  2OOX B;  1Y1V S;  2ZAE B;  2E2J I;  2LEX A;  2OOY B;  3I56 Z;  4NOZ A;  3NH8 A;  4NB9 A;  2JA5 I;  5FLX b;  2QRE B;  3JAM b;  4BBR I;  1VQ4 1;  3GTL I;  1YJW Z;  4RVG A;  3FKI I;  4EWC A;  2RBL A;  1VQP Z;  4E2W A;  5C4X I;  3CCM 1;  4BBS I;  5IT9 b;  3MZL B;  1VLA A;  3S14 I;  1AA6 A;  2V3V A;  1N2F A;  1YIJ Z;  1M90 1;  2NVX I;  2YU9 I;  2HF1 A;  3T4N B;  2OZK A;  1W2B Z;  1QVF Z;  2QLV B;  3I4M I;  2JIR A;  2HU9 A;  2JS4 A;  2JA6 I;  3CCJ Z;  1QVG Z;  2W04 A;  5D1O B;  1VQ8 1;  3CPW Z;  3CCR 1;  3S15 I;  3KIH A;  4MD9 A;  3J81 f;  4XX2 A;  1X0T A;  1RO2 A;  3CCU 1;  2V8K A;  3CC4 1;  1YHQ Z;  3GCF A;  2DE5 A;  3HOW I;  4MH4 A;  1Q81 2;  2NVT I;  3CQZ I;  4Y52 I;  1Q16 A;  3CME 1;  1JWH C;  3GTG I;  4A3I I;  3CCV Z;  3BG0 B;  4NFR A;  1VQ7 Z;  1VQK Z;  2E9H A;  5T67 A;  2PM9 A;  3TDH B;  2V8J A;  1YI2 1;  3PO3 S;  3CC7 1;  1L1O C;  1K9M 1;  3I55 1;  4DGL A;  1VQM 1;  3EER A;  3M3Y I;  3CD6 Z;  2JIM A;  2VUM I;  1KD1 2;  3J80 f;  4A3M I;  2QA4 Z;  3HOV I;  1Y8C A;  1Q86 2;  4E32 A;  1W2B Y;  3RZO I;  2E7Z A;  1QVF Y;  5IP9 I;  1FDI A;  3S2D I;  1FDO A;  2JA8 I;  3G6E Z;  2IZ3 A;  4A3L I;  3IX0 A;  1VQO Z;  5IP7 I;  1QVG Y;  1VQ6 1;  4A3D I;  2AYD A;  3D2L A;  3D6W A;  1USP A;  3IF8 A;  3CXC Y;  3CPW Y;  1RO4 A;  4RVD A;  3VTN A;  3G71 1;  3HOZ I;  2QRD B;  3HOY I;  3GTK I;  4HGY A;  1PFT A;  3PO2 I;  4A3B I;  1WJ2 A;  3S1N I;  3CC2 Z;  3I56 1;  1I3Q I;  5CM2 M;  4HH4 A;  1Q81 1;  3P5J B;  3NDJ A;  3CMA Z;  1YJW 1;  3HKZ A;  4NBE A;  4NB8 A;  1VQP 1;  3J81 b;  3RZD I;  3CCE Z;  1YIJ 1;  1WW9 A;  2E2I I;  1S72 1;  1YUK A;  1KC8 2;  1K73 2;  4BXX I;  2H85 A;  4RVF A;  2B63 I;  1RNI A;  1YJN Z;  1KRL A;  3GTJ I;  1RQF A;  1TWF I;  3CCJ 1;  3CCL Z;  4A93 I;  1KD1 1;  1TWC I;  4NBA A;  2Q51 A;  2OTJ Z;  1Q86 1;  1KQS Y;  2I3C A;  3CXC Z;  2GTI A;  1S7M A;  2F4M A;  4NBH A;  1M1K 2;  4A3J I;  3NFZ A; 
#chains in the Genus database with same CATH homology
 2PMZ A;  3D9X A;  4TNU A;  1YHQ 1;  2J6A A;  2KI7 B;  1DL6 A;  4NH1 C;  3OW2 Z;  4X6A I;  2KPI A;  4MD8 A;  4E2X A;  3NH4 A;  5A2Q f;  4E33 A;  1X3W A;  3CCV 1;  3MON A;  1K8A 2;  1VQ7 1;  1VQK 1;  5FLX f;  3JAM f;  2RHB A;  3U50 C;  2BJO A;  2F4O A;  2RT9 A;  4E2Z A;  1VQ5 Z;  5IT9 f;  1YIT Z;  2G2K A;  1NP6 A;  3S1Q I;  2VUG A;  4E2Y A;  2WB1 A;  3CD6 1;  4QTT A;  1JJ2 Y;  1NJI 2;  1ZB9 A;  4E30 A;  3GTM I;  2QA4 1;  1ZB8 A;  1RLY A;  2GU2 A;  3S1M I;  4RVH A;  2PK7 A;  1R9T I;  2E2H I;  1I50 I;  3G6E 1;  3G4S Z;  1VQ9 1;  3BG1 B;  4AYB A;  4E31 A;  1VQO 1;  2R6M A;  3S2H I;  2Q4Z A;  1KC8 1;  1KQS Z;  3H0G I;  3FQQ A;  1K73 1;  1WCM I;  3MZK B;  4DK1 A;  2QKD A;  1P9N A;  2JR6 A;  3VMH A;  2QEX 1;  1TWA I;  3ESW A;  4A3E I;  2OTL Z;  3OW2 Y;  1VQL Z;  3CCQ Z;  3HOX I;  3IFU A;  3CC2 1;  4NBB A;  1Z02 A;  3S16 I;  1M1K 1;  5T6B A;  3GTO I;  1QYP A;  3I4N I;  1TFI A;  4QTU A;  3CMA 1;  1Q82 2;  1VQN Z;  1K8A 1;  2M48 A;  5C3E I;  2DE7 A;  3LUS A;  2JA7 I;  2P3Y A;  3CCE 1;  1JJ2 Z;  3CCS Z;  1Z03 A;  1YJ9 Z;  2R93 I;  2QR1 B;  5A2Q b;  5T64 A;  2DE6 A;  3NDI A;  2O53 A;  1YJN 1;  2WAQ A;  2EGT A;  2AKL A;  1VQ4 Z;  3H3V J;  4RS4 A;  4S1T A;  3CCL 1;  1NJI 1;  3CCM Z;  2YAD A;  2OTJ 1;  3EED A;  5FLM I;  1YUA A;  4NBG A;  4NBD A;  1S72 Z;  2VF1 A;  1Q7Y 2;  1QF8 A;  2LFU A;  1TWH I;  5D1P A;  3GTM S;  4MON A;  1RO0 A;  2RIQ A;  3J80 b;  2GTH A;  1Z01 A;  3S1R I;  4MD7 A;  1SFO I;  1Y1V I;  1ZH1 A;  3VB9 A;  2NVQ I;  1VQ8 Z;  1N8R 2;  3CCR Z;  5C4J I;  3HOU I;  1VQ5 1;  2JMO A;  2P28 A;  1YIT 1;  2NVY I;  1ML8 A;  3CCU Z;  3CC4 Z;  1NUI A;  3GKQ A;  5D1O A;  4A3G I;  4RV9 A;  3CME Z;  4BY1 I;  3S17 I;  2Y0S A;  1Q82 1;  1WII A;  1M90 2;  1USP B;  1X3Z A;  1TWG I;  1YI2 Z;  2IZ4 A;  3CC7 Z;  3J7A 4;  4MRI A;  2LIY A;  3I55 Z;  3G4S 1;  1VQM Z;  2W03 A;  2RPR A;  3Q87 A;  2JUB A;  1K83 I;  2K3R A;  3K7A I;  3I07 A;  2M6N A;  3GTP I;  2JNY A;  4BY7 I;  3QWU A;  3FQM A;  3GTQ I;  4A3K I;  4NBF A;  4CL1 A;  3VMI A;  5LL6 f;  2OTL 1;  2R7Z I;  2R92 I;  1VQ9 Z;  5C44 I;  4A3F I;  1LQL A;  3CCQ 1;  1VQL 1;  5AN9 F;  2K5R A;  3M4O I;  4NBC A;  1Q7Y 1;  1VQ6 Z;  3F3F C;  4HGZ A;  3PO3 I;  4MXU A;  3TE5 B;  4Y7N I;  2QRC B;  1I6H I;  3KIF A;  4A3C I;  1VQN 1;  2QEX Z;  3NH5 A;  4DQY B;  3G71 Z;  1Y1W I;  2V8I A;  2O4H A;  1K9M 2;  3CCS 1;  1N8R 1;  1YJ9 1;  3F3P C;  3VMG A;  2OOX B;  1Y1V S;  2ZAE B;  2E2J I;  2OOY B;  3I56 Z;  4NOZ A;  3NH8 A;  4NB9 A;  2JA5 I;  5FLX b;  2QRE B;  3JAM b;  4BBR I;  1VQ4 1;  3GTL I;  1YJW Z;  4RVG A;  3FKI I;  4EWC A;  2RBL A;  1VQP Z;  4E2W A;  5C4X I;  3CCM 1;  4BBS I;  5IT9 b;  3MZL B;  1VLA A;  3S14 I;  1N2F A;  1YIJ Z;  1M90 1;  2NVX I;  2YU9 I;  2HF1 A;  3T4N B;  2OZK A;  1W2B Z;  1QVF Z;  2QLV B;  3I4M I;  2HU9 A;  2JS4 A;  2JA6 I;  3CCJ Z;  1QVG Z;  2W04 A;  5D1O B;  1VQ8 1;  3CPW Z;  3CCR 1;  3S15 I;  3KIH A;  4MD9 A;  3J81 f;  4XX2 A;  1X0T A;  1RO2 A;  3CCU 1;  2V8K A;  3CC4 1;  1YHQ Z;  3GCF A;  2DE5 A;  3HOW I;  4MH4 A;  1Q81 2;  2NVT I;  3CQZ I;  4Y52 I;  3CME 1;  1JWH C;  3GTG I;  4A3I I;  3CCV Z;  3BG0 B;  4NFR A;  1VQ7 Z;  1VQK Z;  2E9H A;  5T67 A;  2PM9 A;  3TDH B;  2V8J A;  1YI2 1;  3PO3 S;  3CC7 1;  1L1O C;  1K9M 1;  3I55 1;  4DGL A;  1VQM 1;  3EER A;  3M3Y I;  3CD6 Z;  2VUM I;  1KD1 2;  3J80 f;  4A3M I;  2QA4 Z;  3HOV I;  1Q86 2;  4E32 A;  1W2B Y;  3RZO I;  1QVF Y;  5IP9 I;  3S2D I;  2JA8 I;  3G6E Z;  2IZ3 A;  4A3L I;  3IX0 A;  1VQO Z;  5IP7 I;  1QVG Y;  1VQ6 1;  4A3D I;  3D6W A;  1USP A;  3IF8 A;  3CXC Y;  3CPW Y;  1RO4 A;  4RVD A;  3VTN A;  3G71 1;  3HOZ I;  2QRD B;  3HOY I;  3GTK I;  4HGY A;  1PFT A;  3PO2 I;  4A3B I;  3S1N I;  3CC2 Z;  3I56 1;  1I3Q I;  5CM2 M;  4HH4 A;  1Q81 1;  3P5J B;  3NDJ A;  3CMA Z;  1YJW 1;  3HKZ A;  4NBE A;  4NB8 A;  1VQP 1;  3J81 b;  3RZD I;  3CCE Z;  1YIJ 1;  1WW9 A;  2E2I I;  1S72 1;  1YUK A;  1KC8 2;  1K73 2;  4BXX I;  2H85 A;  4RVF A;  2B63 I;  1RNI A;  1YJN Z;  1KRL A;  3GTJ I;  1RQF A;  1TWF I;  3CCJ 1;  3CCL Z;  4A93 I;  1KD1 1;  1TWC I;  4NBA A;  2Q51 A;  2OTJ Z;  1Q86 1;  1KQS Y;  2I3C A;  3CXC Z;  2GTI A;  1S7M A;  2F4M A;  4NBH A;  1M1K 2;  4A3J I;  3NFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...