3S1MI

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI02
1N2FA 1I3QI 2JA6I 4NBCA 4A3KI 3S14I 3GTLI 4X6AI 1DL6A 2K5RA 3I4MI 3S1NI 5C4XI 3FKII 3VMIA 4BBRI 2B63I 2DE7A 3Q87A 3D6WA 2J6AA 1TWAI 3K7AI 3GTPI 1ML8A 3LUSA 3S1RI 1WW9A 3VMHA 1X3ZA 3GTMS 2JR6A 3S1MI 4NBBA 3HOWI 4A3JI 3S15I 4BXXI 3VMGA 1SFOI 2NVQI 3ESWA 2JA8I 3GTGI 2F4MA 3VB9A 5FLMI 3S17I 1VLAA 3GTQI 3I07A 2JA5I 1YUAA 4NBDA 3S2DI 1TFIA 2BJOA 3HOZI 3M4OI 4QTTA 5IP9I 3HOXI 3GTKI 4QTUA 1I6HI 3PO2I 4MH4A 3EERA 4NBEA 3PO3S 2P3YA 1R9TI 3H0GI 3HOVI 4A3CI 2YU9I 4A3II 2F4OA 3GKQA 1I50I 3RZOI 3GTOI 4A93I 1TWHI 1ZB9A 1Y1VI 3HOUI 5IP7I 2DE5A 2PK7A 2JA7I 4A3DI 4A3LI 3HOYI 1USPA 1ZB8A 3M3YI 2E2II 2NVYI 3S16I 2AKLA 4NBGA 2R92I 3I4NI 1K83I 4A3BI 1NUIA 1Y1WI 4NOZA 3GTMI 1PFTA 3S2HI 5C44I 2NVTI 2JNYA 2E2JI 3S1QI 4BY7I 1LQLA 1TWFI 2RBLA 3H3VJ 4BBSI 4A3EI 3CQZI 1TWCI 4NB8A 3GCFA 4Y7NI 3U50C 5CM2M 4BY1I 2R7ZI 2KPIA 4NBHA 5C4JI 1QYPA 4A3MI 2NVXI 2DE6A 5C3EI 1RO4A 2R93I 1Y1VS 4NBAA 4A3GI 2VUMI 3GTJI 1X3WA 2HF1A 4NB9A 4Y52I 1RLYA 4A3FI 2E2HI 1WCMI 1USPB 3PO3I 4XX2A 1L1OC 4NBFA 1TWGI 3RZDI 2JS4A
chains in the Genus database with same CATH superfamily
5D1OA 1N2FA 3CCVZ 2JA6I 3EEDA 2NAPA 3CCRZ 4A3KI 2V8IA 4X6AI 3S1NI 2B63I 3FQMA 4MD8A 2OOYB 2PM9A 2QLVB 4DGLA 1WW9A 4NH1C 3VMHA 1VQ91 1VQ5Z 3G4SZ 1VQ6Z 2OOXB 1VQ71 1QF8A 3G6E1 4E33A 2VPYA 1K731 1VQN1 2YADA 3HKZA 4NBBA 3JAMb 2G2KA 3OW2Y 3VMGA 1VQKZ 5D1OB 1RQFA 1S72Z 1Q821 3GTQI 3CCMZ 1VQM1 3F3PC 3CCQZ 1K8A1 2BJOA 5A2Qb 2QA41 1QVGZ 2VPXA 1Z03A 3HOZI 4E32A 5IP9I 1I6HI 4MH4A 3EERA 1JJ2Y 4MRIA 4A3CI 4DK1A 5A2Qf 1K732 5FLXb 1TWHI 3HOUI 3CCL1 3NDIA 1QXFA 2PK7A 1KD12 4RVFA 3J80b 1Q822 2LIYA 1K8A2 2IV2X 2HU9A 1VQOZ 1M1K1 1VQ8Z 4NOZA 4E2WA 3GTMI 4E31A 1YHQ1 2NVTI 4E2YA 3CC2Z 1LQLA 3J80f 1W2BY 3CQZI 2AYDA 3U50C 2QRDB 4BY1I 3G711 1RO0A 1AA6A 2DE6A 2RIQA 1YJNZ 3NH8A 5IT9b 4NB9A 5T67A 1NJI1 1M1K2 2E2HI 1WCMI 3CCE1 1L1OC 1WIIA 3S2HI 2JS4A 3CC41 5IT9f 2PMZA 1FDIA 1I3QI 3MONA 1VQ41 4NBCA 3CPWY 2K3RA 1FDOA 4MONA 3KIHA 2V8JA 3I551 2OTJ1 3FKII 3CCJZ 2DE7A 1QVGY 2ZAEB 4HGYA 1TWAI 3K7AI 3GTPI 1YJ9Z 1ML8A 3S1RI 5D1PA 1Q811 3CME1 2JR6A 1W2BZ 2M48A 4CL1A 3S1MI 1YIT1 3G6EZ 4A3JI 3J7A4 2QKDA 1VQNZ 1Z01A 2I3CA 2NVQI 1YJW1 3F3FC 2Q4ZA 5FLMI 3S17I 4E2ZA 1YUAA 2GU2A 2P28A 2JIOA 3P5JB 1VQMZ 4MXUA 2QA4Z 1VQL1 2QR1B 1Q812 2P3YA 2V3VA 3H0GI 1R9TI 3HOVI 3QWUA 2YU9I 1QVFZ 4RVDA 3GKQA 3IF8A 3NDJA 3CPWZ 2DE5A 3CCS1 1K9M1 3HOYI 5AN9F 3S16I 4NBGA 2R92I 3I4NI 1YIJ1 1Q16A 5C44I 2JNYA 1M901 2E2JI 4BY7I 2QRCB 1TWFI 2RBLA 1YHQZ 3MZKB 4NB8A 3D9XA 3CMAZ 3BG0B 4NBHA 5T6BA 1QYPA 3J81b 5C3EI 1K9M2 3G71Z 4NBAA 4A3GI 3GTJI 1X3WA 2OTL1 1RNIA 3J81f 1N8R1 3PO3I 3D2LA 3CCEZ 3CD61 4NBFA 2GTIA 4MD7A 4E30A 1S721 3MZLB 3S14I 1VQ4Z 4TNUA 3CCM1 1DL6A 2KI7B 2K5RA 3I4MI 5C4XI 3CC71 3VMIA 3CXCZ 3Q87A 2OTJZ 2J6AA 2Q51A 3LUSA 2QEX1 1KC81 1VQP1 2JMOA 1Z02A 2W03A 2Y0SA 3T4NB 3GTMS 1QVFY 2JIPA 2VPWA 3FQQA 5LL6f 3TE5B 3CMEZ 2VPZA 2GTHA 3BG1B 3S15I 2VF1A 3ESWA 2JIMA 2F4MA 2R6MA 1VQO1 1YJWZ 1VQ81 2M6NA 1TFIA 3S2DI 1NJI2 3CC21 2WB1A 3M4OI 1SIWA 3HOXI 3GTKI 3PO2I 1Q7Y1 2QREB 1YI21 4NBEA 1KQSY 4MD9A 3I561 1VQLZ 4A3II 1VQ9Z 1VQ7Z 2V45A 3GTOI 4A93I 2JIQA 1ZB9A 2VUGA 1NP6A 2RT9A 4RV9A 2V8KA 3CCSZ 4A3LI 1USPA 4HGZA 1NUIA 1Y1WI 1PFTA 1YIJZ 1Q7Y2 4BBSI 3H3VJ 2EGTA 3CCU1 1TWCI 3GCFA 5CM2M 1Y8CA 1Q861 2IZ3A 5T64A 4A3MI 4HH4A 1RO4A 3CCJ1 3CCLZ 2OZKA 3CXCY 2VUMI 4Y52I 1RLYA 4A3FI 1YJ91 4DQYB 2OTLZ 2LFUA 3IR7A 4S1TA 1USPB 4EWCA 2H85A 1TWGI 3NH4A 3CCV1 3CD6Z 2RHBA 3CCR1 2LEXA 1KQSZ 3IX0A 4RVHA 2O4HA 1Q862 1WJ2A 1S7MA 1KD11 3GTLI 2JUBA 4BBRI 3IFUA 3JAMf 3CC7Z 3D6WA 1VQ51 3G4S1 1VQ61 2IZ4A 1M902 2QEXZ 2WAQA 1X3ZA 1VQPZ 2E7ZA 1VQK1 3CC4Z 3HOWI 4BXXI 3NH5A 1SFOI 2JA8I 3GTGI 3VTNA 3VB9A 3CCQ1 1VLAA 3I07A 5FLXf 2JA5I 4NBDA 3I55Z 1N8R2 4E2XA 4QTTA 4QTUA 2JIRA 3KIFA 3CMA1 3PO3S 4RVGA 1YI2Z 1YUKA 2F4OA 3I56Z 1I50I 3RZOI 2E9HA 3TDHB 3NFZA 1Y1VI 3OW2Z 5IP7I 1YITZ 1KRLA 2JA7I 4A3DI 1ZB8A 3M3YI 2E2II 2NVYI 2AKLA 1K83I 4A3BI 1KC82 3S1QI 2O53A 1JJ2Z 4A3EI 4Y7NI 1WZNA 3CCUZ 2R7ZI 2KPIA 2RPRA 5C4JI 2NVXI 4AYBA 1YJN1 1JWHC 1ZH1A 2R93I 1Y1VS 2HF1A 4XX2A 1RO2A 4NFRA 1P9NA 2W04A 1X0TA 4RS4A 3RZDI
chains in the Genus database with same CATH topology
5D1OA 1N2FA 3CCVZ 2JA6I 3EEDA 3CCRZ 4A3KI 2V8IA 4X6AI 3S1NI 2B63I 3FQMA 4MD8A 2OOYB 2PM9A 2QLVB 4DGLA 1WW9A 4NH1C 3VMHA 1VQ91 1VQ5Z 3G4SZ 1VQ6Z 2OOXB 1VQ71 1QF8A 3G6E1 4E33A 1K731 1VQN1 2YADA 3HKZA 4NBBA 3JAMb 2G2KA 3OW2Y 3VMGA 1VQKZ 5D1OB 1RQFA 1S72Z 1Q821 3GTQI 3CCMZ 1VQM1 3F3PC 3CCQZ 1K8A1 2BJOA 5A2Qb 2QA41 1QVGZ 1Z03A 3HOZI 4E32A 5IP9I 1I6HI 4MH4A 3EERA 1JJ2Y 4MRIA 4A3CI 4DK1A 5A2Qf 1K732 5FLXb 1TWHI 3HOUI 3CCL1 3NDIA 2PK7A 1KD12 4RVFA 3J80b 1Q822 2LIYA 1K8A2 2HU9A 1VQOZ 1M1K1 1VQ8Z 4NOZA 4E2WA 3GTMI 4E31A 1YHQ1 2NVTI 4E2YA 3CC2Z 1LQLA 3J80f 1W2BY 3CQZI 3U50C 2QRDB 4BY1I 3G711 1RO0A 2DE6A 2RIQA 1YJNZ 3NH8A 5IT9b 4NB9A 5T67A 1NJI1 1M1K2 2E2HI 1WCMI 3CCE1 1L1OC 1WIIA 3S2HI 2JS4A 3CC41 5IT9f 2PMZA 1I3QI 3MONA 1VQ41 4NBCA 3CPWY 2K3RA 4MONA 3KIHA 2V8JA 3I551 2OTJ1 3FKII 3CCJZ 2DE7A 1QVGY 2ZAEB 4HGYA 1TWAI 3K7AI 3GTPI 1YJ9Z 1ML8A 3S1RI 5D1PA 1Q811 3CME1 2JR6A 1W2BZ 2M48A 4CL1A 3S1MI 1YIT1 3G6EZ 4A3JI 3J7A4 2QKDA 1VQNZ 1Z01A 2I3CA 2NVQI 1YJW1 3F3FC 2Q4ZA 5FLMI 3S17I 4E2ZA 1YUAA 2GU2A 2P28A 3P5JB 1VQMZ 4MXUA 2QA4Z 1VQL1 2QR1B 1Q812 2P3YA 1R9TI 3H0GI 3HOVI 3QWUA 2YU9I 1QVFZ 4RVDA 3GKQA 3IF8A 3NDJA 3CPWZ 2DE5A 3CCS1 1K9M1 3HOYI 5AN9F 3S16I 4NBGA 2R92I 3I4NI 1YIJ1 5C44I 2JNYA 1M901 2E2JI 4BY7I 2QRCB 1TWFI 2RBLA 1YHQZ 3MZKB 4NB8A 3D9XA 3CMAZ 3BG0B 4NBHA 5T6BA 1QYPA 3J81b 5C3EI 1K9M2 3G71Z 4NBAA 4A3GI 3GTJI 1X3WA 2OTL1 1RNIA 3J81f 1N8R1 3PO3I 3CCEZ 3CD61 4NBFA 2GTIA 4MD7A 4E30A 1S721 3MZLB 3S14I 1VQ4Z 4TNUA 3CCM1 1DL6A 2KI7B 2K5RA 3I4MI 5C4XI 3CC71 3VMIA 3CXCZ 3Q87A 2OTJZ 2J6AA 2Q51A 3LUSA 2QEX1 1KC81 1VQP1 2JMOA 1Z02A 2W03A 2Y0SA 3T4NB 3GTMS 1QVFY 3FQQA 5LL6f 3TE5B 3CMEZ 3BG1B 2GTHA 3S15I 2VF1A 3ESWA 2F4MA 2R6MA 1VQO1 1YJWZ 1VQ81 2M6NA 1TFIA 3S2DI 1NJI2 3CC21 2WB1A 3M4OI 3HOXI 3GTKI 3PO2I 1Q7Y1 2QREB 1YI21 4NBEA 1KQSY 4MD9A 3I561 1VQLZ 4A3II 1VQ9Z 1VQ7Z 3GTOI 4A93I 1ZB9A 2VUGA 1NP6A 2RT9A 4RV9A 2V8KA 3CCSZ 4A3LI 1USPA 4HGZA 1NUIA 1Y1WI 1PFTA 1YIJZ 1Q7Y2 4BBSI 3H3VJ 2EGTA 3CCU1 1TWCI 3GCFA 5CM2M 1Q861 2IZ3A 5T64A 4A3MI 4HH4A 1RO4A 3CCJ1 3CCLZ 2OZKA 3CXCY 2VUMI 4Y52I 1RLYA 4A3FI 1YJ91 4DQYB 2OTLZ 2LFUA 4S1TA 1USPB 4EWCA 2H85A 1TWGI 3NH4A 3CCV1 3CD6Z 2RHBA 3CCR1 1KQSZ 3IX0A 4RVHA 2O4HA 1Q862 1S7MA 1KD11 3GTLI 2JUBA 4BBRI 3IFUA 3JAMf 3CC7Z 3D6WA 1VQ51 3G4S1 1VQ61 2IZ4A 1M902 2QEXZ 2WAQA 1X3ZA 1VQPZ 1VQK1 3CC4Z 3HOWI 4BXXI 3NH5A 1SFOI 2JA8I 3GTGI 3VTNA 3VB9A 3CCQ1 1VLAA 3I07A 5FLXf 2JA5I 4NBDA 3I55Z 1N8R2 4E2XA 4QTTA 4QTUA 3KIFA 3CMA1 3PO3S 4RVGA 1YI2Z 1YUKA 2F4OA 3I56Z 1I50I 3RZOI 2E9HA 3TDHB 3NFZA 1Y1VI 3OW2Z 5IP7I 1YITZ 1KRLA 2JA7I 4A3DI 1ZB8A 3M3YI 2E2II 2NVYI 2AKLA 1K83I 4A3BI 1KC82 3S1QI 2O53A 1JJ2Z 4A3EI 4Y7NI 3CCUZ 2R7ZI 2KPIA 2RPRA 5C4JI 2NVXI 4AYBA 1YJN1 1JWHC 1ZH1A 2R93I 1Y1VS 2HF1A 4XX2A 1RO2A 4NFRA 1P9NA 2W04A 1X0TA 4RS4A 3RZDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N2F A;  1I3Q I;  2JA6 I;  4NBC A;  4A3K I;  3S14 I;  3GTL I;  4X6A I;  1DL6 A;  2K5R A;  3I4M I;  3S1N I;  5C4X I;  3FKI I;  3VMI A;  4BBR I;  2B63 I;  2DE7 A;  3Q87 A;  3D6W A;  2J6A A;  1TWA I;  3K7A I;  3GTP I;  1ML8 A;  3LUS A;  3S1R I;  1WW9 A;  3VMH A;  1X3Z A;  3GTM S;  2JR6 A;  3S1M I;  4NBB A;  3HOW I;  4A3J I;  3S15 I;  4BXX I;  3VMG A;  1SFO I;  2NVQ I;  3ESW A;  2JA8 I;  3GTG I;  2F4M A;  3VB9 A;  5FLM I;  3S17 I;  1VLA A;  3GTQ I;  3I07 A;  2JA5 I;  1YUA A;  4NBD A;  3S2D I;  1TFI A;  2BJO A;  3HOZ I;  3M4O I;  4QTT A;  5IP9 I;  3HOX I;  3GTK I;  4QTU A;  1I6H I;  3PO2 I;  4MH4 A;  3EER A;  4NBE A;  3PO3 S;  2P3Y A;  1R9T I;  3H0G I;  3HOV I;  4A3C I;  2YU9 I;  4A3I I;  2F4O A;  3GKQ A;  1I50 I;  3RZO I;  3GTO I;  4A93 I;  1TWH I;  1ZB9 A;  1Y1V I;  3HOU I;  5IP7 I;  2DE5 A;  2PK7 A;  2JA7 I;  4A3D I;  4A3L I;  3HOY I;  1USP A;  1ZB8 A;  3M3Y I;  2E2I I;  2NVY I;  3S16 I;  2AKL A;  4NBG A;  2R92 I;  3I4N I;  1K83 I;  4A3B I;  1NUI A;  1Y1W I;  4NOZ A;  3GTM I;  1PFT A;  3S2H I;  5C44 I;  2NVT I;  2JNY A;  2E2J I;  3S1Q I;  4BY7 I;  1LQL A;  1TWF I;  2RBL A;  3H3V J;  4BBS I;  4A3E I;  3CQZ I;  1TWC I;  4NB8 A;  3GCF A;  4Y7N I;  3U50 C;  5CM2 M;  4BY1 I;  2R7Z I;  2KPI A;  4NBH A;  5C4J I;  1QYP A;  4A3M I;  2NVX I;  2DE6 A;  5C3E I;  1RO4 A;  2R93 I;  1Y1V S;  4NBA A;  4A3G I;  2VUM I;  3GTJ I;  1X3W A;  2HF1 A;  4NB9 A;  4Y52 I;  1RLY A;  4A3F I;  2E2H I;  1WCM I;  1USP B;  3PO3 I;  4XX2 A;  1L1O C;  4NBF A;  1TWG I;  3RZD I;  2JS4 A; 
#chains in the Genus database with same CATH topology
 5D1O A;  1N2F A;  3CCV Z;  2JA6 I;  3EED A;  2NAP A;  3CCR Z;  4A3K I;  2V8I A;  4X6A I;  3S1N I;  2B63 I;  3FQM A;  4MD8 A;  2OOY B;  2PM9 A;  2QLV B;  4DGL A;  1WW9 A;  4NH1 C;  3VMH A;  1VQ9 1;  1VQ5 Z;  3G4S Z;  1VQ6 Z;  2OOX B;  1VQ7 1;  1QF8 A;  3G6E 1;  4E33 A;  2VPY A;  1K73 1;  1VQN 1;  2YAD A;  3HKZ A;  4NBB A;  3JAM b;  2G2K A;  3OW2 Y;  3VMG A;  1VQK Z;  5D1O B;  1RQF A;  1S72 Z;  1Q82 1;  3GTQ I;  3CCM Z;  1VQM 1;  3F3P C;  3CCQ Z;  1K8A 1;  2BJO A;  5A2Q b;  2QA4 1;  1QVG Z;  2VPX A;  1Z03 A;  3HOZ I;  4E32 A;  5IP9 I;  1I6H I;  4MH4 A;  3EER A;  1JJ2 Y;  4MRI A;  4A3C I;  4DK1 A;  5A2Q f;  1K73 2;  5FLX b;  1TWH I;  3HOU I;  3CCL 1;  3NDI A;  1QXF A;  2PK7 A;  1KD1 2;  4RVF A;  3J80 b;  1Q82 2;  2LIY A;  1K8A 2;  2IV2 X;  2HU9 A;  1VQO Z;  1M1K 1;  1VQ8 Z;  4NOZ A;  4E2W A;  3GTM I;  4E31 A;  1YHQ 1;  2NVT I;  4E2Y A;  3CC2 Z;  1LQL A;  3J80 f;  1W2B Y;  3CQZ I;  2AYD A;  3U50 C;  2QRD B;  4BY1 I;  3G71 1;  1RO0 A;  1AA6 A;  2DE6 A;  2RIQ A;  1YJN Z;  3NH8 A;  5IT9 b;  4NB9 A;  5T67 A;  1NJI 1;  1M1K 2;  2E2H I;  1WCM I;  3CCE 1;  1L1O C;  1WII A;  3S2H I;  2JS4 A;  3CC4 1;  5IT9 f;  2PMZ A;  1FDI A;  1I3Q I;  3MON A;  1VQ4 1;  4NBC A;  3CPW Y;  2K3R A;  1FDO A;  4MON A;  3KIH A;  2V8J A;  3I55 1;  2OTJ 1;  3FKI I;  3CCJ Z;  2DE7 A;  1QVG Y;  2ZAE B;  4HGY A;  1TWA I;  3K7A I;  3GTP I;  1YJ9 Z;  1ML8 A;  3S1R I;  5D1P A;  1Q81 1;  3CME 1;  2JR6 A;  1W2B Z;  2M48 A;  4CL1 A;  3S1M I;  1YIT 1;  3G6E Z;  4A3J I;  3J7A 4;  2QKD A;  1VQN Z;  1Z01 A;  2I3C A;  2NVQ I;  1YJW 1;  3F3F C;  2Q4Z A;  5FLM I;  3S17 I;  4E2Z A;  1YUA A;  2GU2 A;  2P28 A;  2JIO A;  3P5J B;  1VQM Z;  4MXU A;  2QA4 Z;  1VQL 1;  2QR1 B;  1Q81 2;  2P3Y A;  2V3V A;  3H0G I;  1R9T I;  3HOV I;  3QWU A;  2YU9 I;  1QVF Z;  4RVD A;  3GKQ A;  3IF8 A;  3NDJ A;  3CPW Z;  2DE5 A;  3CCS 1;  1K9M 1;  3HOY I;  5AN9 F;  3S16 I;  4NBG A;  2R92 I;  3I4N I;  1YIJ 1;  1Q16 A;  5C44 I;  2JNY A;  1M90 1;  2E2J I;  4BY7 I;  2QRC B;  1TWF I;  2RBL A;  1YHQ Z;  3MZK B;  4NB8 A;  3D9X A;  3CMA Z;  3BG0 B;  4NBH A;  5T6B A;  1QYP A;  3J81 b;  5C3E I;  1K9M 2;  3G71 Z;  4NBA A;  4A3G I;  3GTJ I;  1X3W A;  2OTL 1;  1RNI A;  3J81 f;  1N8R 1;  3PO3 I;  3D2L A;  3CCE Z;  3CD6 1;  4NBF A;  2GTI A;  4MD7 A;  4E30 A;  1S72 1;  3MZL B;  3S14 I;  1VQ4 Z;  4TNU A;  3CCM 1;  1DL6 A;  2KI7 B;  2K5R A;  3I4M I;  5C4X I;  3CC7 1;  3VMI A;  3CXC Z;  3Q87 A;  2OTJ Z;  2J6A A;  2Q51 A;  3LUS A;  2QEX 1;  1KC8 1;  1VQP 1;  2JMO A;  1Z02 A;  2W03 A;  2Y0S A;  3T4N B;  3GTM S;  1QVF Y;  2JIP A;  2VPW A;  3FQQ A;  5LL6 f;  3TE5 B;  3CME Z;  2VPZ A;  2GTH A;  3BG1 B;  3S15 I;  2VF1 A;  3ESW A;  2JIM A;  2F4M A;  2R6M A;  1VQO 1;  1YJW Z;  1VQ8 1;  2M6N A;  1TFI A;  3S2D I;  1NJI 2;  3CC2 1;  2WB1 A;  3M4O I;  1SIW A;  3HOX I;  3GTK I;  3PO2 I;  1Q7Y 1;  2QRE B;  1YI2 1;  4NBE A;  1KQS Y;  4MD9 A;  3I56 1;  1VQL Z;  4A3I I;  1VQ9 Z;  1VQ7 Z;  2V45 A;  3GTO I;  4A93 I;  2JIQ A;  1ZB9 A;  2VUG A;  1NP6 A;  2RT9 A;  4RV9 A;  2V8K A;  3CCS Z;  4A3L I;  1USP A;  4HGZ A;  1NUI A;  1Y1W I;  1PFT A;  1YIJ Z;  1Q7Y 2;  4BBS I;  3H3V J;  2EGT A;  3CCU 1;  1TWC I;  3GCF A;  5CM2 M;  1Y8C A;  1Q86 1;  2IZ3 A;  5T64 A;  4A3M I;  4HH4 A;  1RO4 A;  3CCJ 1;  3CCL Z;  2OZK A;  3CXC Y;  2VUM I;  4Y52 I;  1RLY A;  4A3F I;  1YJ9 1;  4DQY B;  2OTL Z;  2LFU A;  3IR7 A;  4S1T A;  1USP B;  4EWC A;  2H85 A;  1TWG I;  3NH4 A;  3CCV 1;  3CD6 Z;  2RHB A;  3CCR 1;  2LEX A;  1KQS Z;  3IX0 A;  4RVH A;  2O4H A;  1Q86 2;  1WJ2 A;  1S7M A;  1KD1 1;  3GTL I;  2JUB A;  4BBR I;  3IFU A;  3JAM f;  3CC7 Z;  3D6W A;  1VQ5 1;  3G4S 1;  1VQ6 1;  2IZ4 A;  1M90 2;  2QEX Z;  2WAQ A;  1X3Z A;  1VQP Z;  2E7Z A;  1VQK 1;  3CC4 Z;  3HOW I;  4BXX I;  3NH5 A;  1SFO I;  2JA8 I;  3GTG I;  3VTN A;  3VB9 A;  3CCQ 1;  1VLA A;  3I07 A;  5FLX f;  2JA5 I;  4NBD A;  3I55 Z;  1N8R 2;  4E2X A;  4QTT A;  4QTU A;  2JIR A;  3KIF A;  3CMA 1;  3PO3 S;  4RVG A;  1YI2 Z;  1YUK A;  2F4O A;  3I56 Z;  1I50 I;  3RZO I;  2E9H A;  3TDH B;  3NFZ A;  1Y1V I;  3OW2 Z;  5IP7 I;  1YIT Z;  1KRL A;  2JA7 I;  4A3D I;  1ZB8 A;  3M3Y I;  2E2I I;  2NVY I;  2AKL A;  1K83 I;  4A3B I;  1KC8 2;  3S1Q I;  2O53 A;  1JJ2 Z;  4A3E I;  4Y7N I;  1WZN A;  3CCU Z;  2R7Z I;  2KPI A;  2RPR A;  5C4J I;  2NVX I;  4AYB A;  1YJN 1;  1JWH C;  1ZH1 A;  2R93 I;  1Y1V S;  2HF1 A;  4XX2 A;  1RO2 A;  4NFR A;  1P9N A;  2W04 A;  1X0T A;  4RS4 A;  3RZD I; 
#chains in the Genus database with same CATH homology
 5D1O A;  1N2F A;  3CCV Z;  2JA6 I;  3EED A;  3CCR Z;  4A3K I;  2V8I A;  4X6A I;  3S1N I;  2B63 I;  3FQM A;  4MD8 A;  2OOY B;  2PM9 A;  2QLV B;  4DGL A;  1WW9 A;  4NH1 C;  3VMH A;  1VQ9 1;  1VQ5 Z;  3G4S Z;  1VQ6 Z;  2OOX B;  1VQ7 1;  1QF8 A;  3G6E 1;  4E33 A;  1K73 1;  1VQN 1;  2YAD A;  3HKZ A;  4NBB A;  3JAM b;  2G2K A;  3OW2 Y;  3VMG A;  1VQK Z;  5D1O B;  1RQF A;  1S72 Z;  1Q82 1;  3GTQ I;  3CCM Z;  1VQM 1;  3F3P C;  3CCQ Z;  1K8A 1;  2BJO A;  5A2Q b;  2QA4 1;  1QVG Z;  1Z03 A;  3HOZ I;  4E32 A;  5IP9 I;  1I6H I;  4MH4 A;  3EER A;  1JJ2 Y;  4MRI A;  4A3C I;  4DK1 A;  5A2Q f;  1K73 2;  5FLX b;  1TWH I;  3HOU I;  3CCL 1;  3NDI A;  2PK7 A;  1KD1 2;  4RVF A;  3J80 b;  1Q82 2;  2LIY A;  1K8A 2;  2HU9 A;  1VQO Z;  1M1K 1;  1VQ8 Z;  4NOZ A;  4E2W A;  3GTM I;  4E31 A;  1YHQ 1;  2NVT I;  4E2Y A;  3CC2 Z;  1LQL A;  3J80 f;  1W2B Y;  3CQZ I;  3U50 C;  2QRD B;  4BY1 I;  3G71 1;  1RO0 A;  2DE6 A;  2RIQ A;  1YJN Z;  3NH8 A;  5IT9 b;  4NB9 A;  5T67 A;  1NJI 1;  1M1K 2;  2E2H I;  1WCM I;  3CCE 1;  1L1O C;  1WII A;  3S2H I;  2JS4 A;  3CC4 1;  5IT9 f;  2PMZ A;  1I3Q I;  3MON A;  1VQ4 1;  4NBC A;  3CPW Y;  2K3R A;  4MON A;  3KIH A;  2V8J A;  3I55 1;  2OTJ 1;  3FKI I;  3CCJ Z;  2DE7 A;  1QVG Y;  2ZAE B;  4HGY A;  1TWA I;  3K7A I;  3GTP I;  1YJ9 Z;  1ML8 A;  3S1R I;  5D1P A;  1Q81 1;  3CME 1;  2JR6 A;  1W2B Z;  2M48 A;  4CL1 A;  3S1M I;  1YIT 1;  3G6E Z;  4A3J I;  3J7A 4;  2QKD A;  1VQN Z;  1Z01 A;  2I3C A;  2NVQ I;  1YJW 1;  3F3F C;  2Q4Z A;  5FLM I;  3S17 I;  4E2Z A;  1YUA A;  2GU2 A;  2P28 A;  3P5J B;  1VQM Z;  4MXU A;  2QA4 Z;  1VQL 1;  2QR1 B;  1Q81 2;  2P3Y A;  1R9T I;  3H0G I;  3HOV I;  3QWU A;  2YU9 I;  1QVF Z;  4RVD A;  3GKQ A;  3IF8 A;  3NDJ A;  3CPW Z;  2DE5 A;  3CCS 1;  1K9M 1;  3HOY I;  5AN9 F;  3S16 I;  4NBG A;  2R92 I;  3I4N I;  1YIJ 1;  5C44 I;  2JNY A;  1M90 1;  2E2J I;  4BY7 I;  2QRC B;  1TWF I;  2RBL A;  1YHQ Z;  3MZK B;  4NB8 A;  3D9X A;  3CMA Z;  3BG0 B;  4NBH A;  5T6B A;  1QYP A;  3J81 b;  5C3E I;  1K9M 2;  3G71 Z;  4NBA A;  4A3G I;  3GTJ I;  1X3W A;  2OTL 1;  1RNI A;  3J81 f;  1N8R 1;  3PO3 I;  3CCE Z;  3CD6 1;  4NBF A;  2GTI A;  4MD7 A;  4E30 A;  1S72 1;  3MZL B;  3S14 I;  1VQ4 Z;  4TNU A;  3CCM 1;  1DL6 A;  2KI7 B;  2K5R A;  3I4M I;  5C4X I;  3CC7 1;  3VMI A;  3CXC Z;  3Q87 A;  2OTJ Z;  2J6A A;  2Q51 A;  3LUS A;  2QEX 1;  1KC8 1;  1VQP 1;  2JMO A;  1Z02 A;  2W03 A;  2Y0S A;  3T4N B;  3GTM S;  1QVF Y;  3FQQ A;  5LL6 f;  3TE5 B;  3CME Z;  3BG1 B;  2GTH A;  3S15 I;  2VF1 A;  3ESW A;  2F4M A;  2R6M A;  1VQO 1;  1YJW Z;  1VQ8 1;  2M6N A;  1TFI A;  3S2D I;  1NJI 2;  3CC2 1;  2WB1 A;  3M4O I;  3HOX I;  3GTK I;  3PO2 I;  1Q7Y 1;  2QRE B;  1YI2 1;  4NBE A;  1KQS Y;  4MD9 A;  3I56 1;  1VQL Z;  4A3I I;  1VQ9 Z;  1VQ7 Z;  3GTO I;  4A93 I;  1ZB9 A;  2VUG A;  1NP6 A;  2RT9 A;  4RV9 A;  2V8K A;  3CCS Z;  4A3L I;  1USP A;  4HGZ A;  1NUI A;  1Y1W I;  1PFT A;  1YIJ Z;  1Q7Y 2;  4BBS I;  3H3V J;  2EGT A;  3CCU 1;  1TWC I;  3GCF A;  5CM2 M;  1Q86 1;  2IZ3 A;  5T64 A;  4A3M I;  4HH4 A;  1RO4 A;  3CCJ 1;  3CCL Z;  2OZK A;  3CXC Y;  2VUM I;  4Y52 I;  1RLY A;  4A3F I;  1YJ9 1;  4DQY B;  2OTL Z;  2LFU A;  4S1T A;  1USP B;  4EWC A;  2H85 A;  1TWG I;  3NH4 A;  3CCV 1;  3CD6 Z;  2RHB A;  3CCR 1;  1KQS Z;  3IX0 A;  4RVH A;  2O4H A;  1Q86 2;  1S7M A;  1KD1 1;  3GTL I;  2JUB A;  4BBR I;  3IFU A;  3JAM f;  3CC7 Z;  3D6W A;  1VQ5 1;  3G4S 1;  1VQ6 1;  2IZ4 A;  1M90 2;  2QEX Z;  2WAQ A;  1X3Z A;  1VQP Z;  1VQK 1;  3CC4 Z;  3HOW I;  4BXX I;  3NH5 A;  1SFO I;  2JA8 I;  3GTG I;  3VTN A;  3VB9 A;  3CCQ 1;  1VLA A;  3I07 A;  5FLX f;  2JA5 I;  4NBD A;  3I55 Z;  1N8R 2;  4E2X A;  4QTT A;  4QTU A;  3KIF A;  3CMA 1;  3PO3 S;  4RVG A;  1YI2 Z;  1YUK A;  2F4O A;  3I56 Z;  1I50 I;  3RZO I;  2E9H A;  3TDH B;  3NFZ A;  1Y1V I;  3OW2 Z;  5IP7 I;  1YIT Z;  1KRL A;  2JA7 I;  4A3D I;  1ZB8 A;  3M3Y I;  2E2I I;  2NVY I;  2AKL A;  1K83 I;  4A3B I;  1KC8 2;  3S1Q I;  2O53 A;  1JJ2 Z;  4A3E I;  4Y7N I;  3CCU Z;  2R7Z I;  2KPI A;  2RPR A;  5C4J I;  2NVX I;  4AYB A;  1YJN 1;  1JWH C;  1ZH1 A;  2R93 I;  1Y1V S;  2HF1 A;  4XX2 A;  1RO2 A;  4NFR A;  1P9N A;  2W04 A;  1X0T A;  4RS4 A;  3RZD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...