3S1MI

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI02
4A3EI 4NOZA 3M4OI 2KPIA 4XX2A 3I4MI 3GTMS 1VLAA 1X3ZA 4NBBA 2YU9I 4BBSI 5FLMI 3HOWI 3RZOI 5C3EI 1QYPA 2JS4A 4A3BI 1DL6A 2P3YA 4A3KI 2PK7A 4A3MI 3S14I 3HOXI 1X3WA 4A3LI 3RZDI 3GTQI 4NBCA 2DE6A 3VMGA 2JR6A 2R93I 2JNYA 3U50C 4A3FI 4NB9A 4BY1I 3HOUI 3I07A 3LUSA 4BXXI 3K7AI 3VMIA 3GTJI 4A93I 2RBLA 1PFTA 3S2HI 4Y52I 1I6HI 1RLYA 4BBRI 3VB9A 3S1RI 5IP7I 2JA7I 1R9TI 1YUAA 2NVTI 3GTKI 5IP9I 3GTMI 3ESWA 2HF1A 2F4OA 2E2HI 3GCFA 1N2FA 3HOVI 3FKII 3GTLI 2VUMI 4BY7I 3S17I 4A3GI 3H0GI 1Y1VS 3M3YI 4NBAA 3S1QI 4NB8A 1ML8A 3GTOI 2K5RA 3Q87A 4NBHA 3H3VJ 1LQLA 1I50I 2NVYI 1RO4A 1TWCI 2JA5I 4MH4A 4A3DI 1Y1WI 1TFIA 1TWFI 3PO3S 5C4JI 2R92I 1TWAI 2JA8I 3CQZI 2F4MA 1SFOI 3VMHA 2DE7A 4NBFA 2E2JI 1I3QI 3PO2I 3PO3I 1USPB 2DE5A 1ZB8A 2NVQI 1ZB9A 4A3JI 3D6WA 2AKLA 2NVXI 1NUIA 3GTGI 4NBEA 4A3CI 3I4NI 2B63I 5CM2M 3EERA 4QTUA 2JA6I 1L1OC 1TWGI 3S1NI 1WCMI 1Y1VI 4NBDA 3HOYI 4Y7NI 3S15I 3GKQA 5C44I 4X6AI 3S2DI 1WW9A 3S1MI 3GTPI 2R7ZI 4A3II 4NBGA 1TWHI 2E2II 1K83I 1USPA 5C4XI 2BJOA 2J6AA 4QTTA 3S16I 3HOZI
chains in the Genus database with same CATH superfamily
1KC82 5T64A 2LIYA 4NOZA 1K732 3CCLZ 5D1OA 2V8JA 4BBSI 5FLMI 3HOWI 1Z01A 5C3EI 2JS4A 2VF1A 3CMA1 1DL6A 5D1OB 2P3YA 3CCE1 2PK7A 2RIQA 3CCQ1 5FLXb 3RZDI 1KQSZ 5FLXf 3CCJ1 4NBCA 3MONA 2JNYA 4MRIA 3JAMb 2ZAEB 3U50C 1N8R1 2O53A 1VQOZ 3LUSA 3CXCZ 1QXFA 3GTJI 2JIQA 2PMZA 1VQ51 1FDOA 3CC2Z 3F3FC 1YUAA 3D2LA 1VQ71 1WZNA 3G4SZ 3TE5B 1YIJZ 1VQ4Z 3FKII 3VTNA 2VUMI 3CCU1 1Q862 1M1K1 1Y1VS 2V8IA 3GTOI 4MD9A 2K5RA 3H3VJ 2NVYI 1RO4A 4MH4A 2IV2X 1VQP1 3FQMA 3NH8A 5C4JI 3CQZI 2F4MA 1Q822 2OTL1 4HGZA 1NJI1 2DE7A 4NBFA 1P9NA 4E2ZA 2QA41 3PO3I 2NVQI 2QA4Z 3G6E1 4E31A 2OOXB 3D6WA 2AKLA 4DK1A 4MD8A 4EWCA 3EERA 1QVFZ 3S1NI 1Y1VI 3CCS1 3HOYI 3HKZA 5C44I 2O4HA 1KD11 1RO0A 1VQ91 4A3II 3CC4Z 4E2XA 4NBGA 1USPA 4QTTA 3S16I 4A3EI 3FQQA 2JIRA 4MONA 4NH1C 1YJWZ 2KPIA 2V3VA 3GTMS 3IFUA 2Y0SA 1VQN1 1VQLZ 3CC71 4A3BI 2LFUA 4A3KI 3CD61 1VQ61 2JIPA 1VQ6Z 1X3WA 1FDIA 4RVFA 3VMGA 2DE6A 1NP6A 1W2BY 1KC81 1K731 1S72Z 3NH5A 1YHQ1 1YIT1 3MZLB 3IX0A 1YJNZ 4MD7A 4BY1I 2VPZA 1WIIA 3I07A 4BXXI 2E9HA 2PM9A 3CCL1 1R9TI 2G2KA 3GTMI 3CPWZ 2HF1A 2F4OA 3I551 2E2HI 3I55Z 4RVGA 1K8A2 2Q51A 3JAMf 1VQO1 4NB8A 1QVGY 4S1TA 2EGTA 3Q87A 4NBHA 4E2YA 3CMEZ 2K3RA 2RT9A 1TWCI 2JA5I 4A3DI 2GTIA 3CC21 2QR1B 3PO3S 2NAPA 3G4S1 1SFOI 3VMHA 5AN9F 1YIJ1 1Q7Y2 1VQ41 1Q861 2RHBA 3PO2I 1QVFY 5IT9b 5IT9f 4A3JI 2NVXI 3GTGI 4NBEA 2QLVB 3NDIA 2B63I 2M48A 1WJ2A 2JA6I 1Q821 1YJ91 3G711 1JJ2Y 1YJ9Z 3S1MI 3G71Z 5C4XI 2AYDA 2J6AA 2RPRA 1JWHC 4XX2A 4NBBA 1YI2Z 2YU9I 1RQFA 3CCVZ 2QRCB 1Y8CA 2W04A 4A3MI 2QEXZ 3S14I 3CC41 1VQ8Z 3GTQI 2R93I 3NH4A 2JMOA 4RVDA 4E33A 4A3FI 4NB9A 3I561 5A2Qb 3HOUI 1YJW1 5A2Qf 3I56Z 3VMIA 2RBLA 3S2HI 2OTJZ 1I6HI 4TNUA 1VQK1 1VQL1 3S1RI 3P5JB 5IP7I 3CPWY 2JA7I 1RNIA 1VQKZ 1KQSY 1AA6A 3CCRZ 2NVTI 2V45A 5IP9I 1VQMZ 3ESWA 3GCFA 1N2FA 1S721 3CXCY 3S17I 1YJN1 2M6NA 3M3YI 4NBAA 3S1QI 2LEXA 3CCMZ 3MZKB 4RS4A 4DQYB 3KIFA 1TFIA 2VPXA 3OW2Z 2W03A 1Q812 1K8A1 2OZKA 2KI7B 2H85A 1ZB8A 2DE5A 1ZB9A 1NUIA 4A3CI 1S7MA 3NFZA 5CM2M 3CME1 1WCMI 1Q7Y1 4Y7NI 3S15I 3CMAZ 4X6AI 3CCEZ 3BG1B 2JIMA 3CCQZ 3IF8A 1TWHI 2E2II 1K83I 3CCJZ 2BJOA 1KRLA 3HOZI 2IZ4A 1W2BZ 3D9XA 3M4OI 3T4NB 3I4MI 2VPYA 1N8R2 1QF8A 1ZH1A 1VLAA 1X3ZA 1SIWA 1X0TA 3RZOI 1QYPA 1VQ5Z 1VQ7Z 3HOXI 2VUGA 4A3LI 3J80b 3J80f 2JR6A 2QKDA 2WAQA 3F3PC 4MXUA 4CL1A 3CCUZ 4E2WA 3K7AI 4A93I 1M1K2 1PFTA 4Y52I 1RLYA 1QVGZ 1YI21 4BBRI 3VB9A 1RO2A 3CCV1 3J7A4 2HU9A 2IZ3A 2E7ZA 3BG0B 1YUKA 2QEX1 1VQPZ 1M901 2OOYB 3GTKI 3KIHA 5LL6f 3TDHB 2OTLZ 1VQ81 3J81b 3J81f 3HOVI 3GTLI 1M902 1Z03A 4BY7I 4A3GI 4RV9A 2GU2A 3H0GI 1NJI2 4AYBA 3G6EZ 4RVHA 2GTHA 4E30A 1ML8A 2JUBA 3NDJA 2QREB 2OTJ1 3OW2Y 3QWUA 2Q4ZA 2YADA 1LQLA 1I50I 2WB1A 3IR7A 1Q16A 1K9M1 1Y1WI 3CCR1 1TWFI 3CCSZ 2JIOA 2R92I 1TWAI 2JA8I 1VQM1 2R6MA 1VQ9Z 1K9M2 1JJ2Z 2E2JI 2V8KA 1KD12 1I3QI 1Z02A 1USPB 5D1PA 2QRDB 3CCM1 4DGLA 4HH4A 3I4NI 2P28A 4QTUA 1L1OC 1TWGI 3EEDA 1VQNZ 5T6BA 4NFRA 4NBDA 1Q811 3CC7Z 3GKQA 2VPWA 3CD6Z 3S2DI 1WW9A 3GTPI 2R7ZI 2I3CA 4E32A 5T67A 4HGYA 1YHQZ 1YITZ
chains in the Genus database with same CATH topology
1KC82 5T64A 2LIYA 4NOZA 1K732 3CCLZ 5D1OA 2V8JA 4BBSI 5FLMI 3HOWI 1Z01A 5C3EI 2JS4A 2VF1A 3CMA1 1DL6A 5D1OB 2P3YA 3CCE1 2PK7A 2RIQA 3CCQ1 5FLXb 3RZDI 1KQSZ 5FLXf 3CCJ1 4NBCA 3MONA 2JNYA 4MRIA 3JAMb 2ZAEB 3U50C 1N8R1 2O53A 1VQOZ 3LUSA 3CXCZ 3GTJI 2PMZA 1VQ51 3CC2Z 3F3FC 1YUAA 1VQ71 3G4SZ 3TE5B 1YIJZ 1VQ4Z 3FKII 3VTNA 2VUMI 3CCU1 1Q862 1M1K1 1Y1VS 2V8IA 3GTOI 4MD9A 2K5RA 3H3VJ 2NVYI 1RO4A 4MH4A 1VQP1 3FQMA 3NH8A 5C4JI 3CQZI 2F4MA 1Q822 2OTL1 4HGZA 1NJI1 2DE7A 4NBFA 1P9NA 4E2ZA 2QA41 3PO3I 2NVQI 2QA4Z 3G6E1 4E31A 2OOXB 3D6WA 2AKLA 4DK1A 4MD8A 4EWCA 3EERA 1QVFZ 3S1NI 1Y1VI 3CCS1 3HOYI 3HKZA 5C44I 2O4HA 1KD11 1RO0A 1VQ91 4A3II 3CC4Z 4E2XA 4NBGA 1USPA 4QTTA 3S16I 4A3EI 3FQQA 4MONA 4NH1C 1YJWZ 2KPIA 3GTMS 3IFUA 2Y0SA 1VQN1 1VQLZ 3CC71 4A3BI 2LFUA 4A3KI 3CD61 1VQ61 1VQ6Z 1X3WA 4RVFA 3VMGA 2DE6A 1NP6A 1W2BY 1KC81 1K731 1S72Z 3NH5A 1YHQ1 1YIT1 3MZLB 3IX0A 1YJNZ 4MD7A 4BY1I 1WIIA 3I07A 4BXXI 2E9HA 2PM9A 3CCL1 1R9TI 2G2KA 3GTMI 3CPWZ 2HF1A 2F4OA 3I551 2E2HI 3I55Z 4RVGA 1K8A2 2Q51A 3JAMf 1VQO1 4NB8A 1QVGY 4S1TA 2EGTA 3Q87A 4NBHA 4E2YA 3CMEZ 2K3RA 2RT9A 1TWCI 2JA5I 4A3DI 2GTIA 3CC21 2QR1B 3PO3S 3G4S1 1SFOI 3VMHA 5AN9F 1YIJ1 1Q7Y2 1VQ41 1Q861 2RHBA 3PO2I 1QVFY 5IT9b 5IT9f 4A3JI 2NVXI 3GTGI 4NBEA 2QLVB 3NDIA 2B63I 2M48A 2JA6I 1Q821 1YJ91 3G711 1JJ2Y 1YJ9Z 3S1MI 3G71Z 5C4XI 2J6AA 2RPRA 1JWHC 4XX2A 4NBBA 1YI2Z 2YU9I 1RQFA 3CCVZ 2QRCB 2W04A 4A3MI 2QEXZ 3S14I 3CC41 1VQ8Z 3GTQI 2R93I 3NH4A 2JMOA 4RVDA 4E33A 4A3FI 4NB9A 3I561 5A2Qb 3HOUI 1YJW1 5A2Qf 3I56Z 3VMIA 2RBLA 3S2HI 2OTJZ 1I6HI 4TNUA 1VQK1 1VQL1 3S1RI 3P5JB 5IP7I 3CPWY 2JA7I 1RNIA 1VQKZ 1KQSY 3CCRZ 2NVTI 5IP9I 1VQMZ 3ESWA 3GCFA 1N2FA 1S721 3CXCY 3S17I 1YJN1 2M6NA 3M3YI 4NBAA 3S1QI 3CCMZ 3MZKB 4RS4A 4DQYB 3KIFA 1TFIA 3OW2Z 2W03A 1Q812 1K8A1 2OZKA 2KI7B 2H85A 1ZB8A 2DE5A 1ZB9A 1NUIA 4A3CI 1S7MA 3NFZA 5CM2M 3CME1 1WCMI 1Q7Y1 4Y7NI 3S15I 3CMAZ 4X6AI 3CCEZ 3BG1B 3CCQZ 3IF8A 1TWHI 2E2II 1K83I 3CCJZ 2BJOA 1KRLA 3HOZI 2IZ4A 1W2BZ 3D9XA 3M4OI 3T4NB 3I4MI 1N8R2 1QF8A 1ZH1A 1VLAA 1X3ZA 1X0TA 3RZOI 1QYPA 1VQ5Z 1VQ7Z 3HOXI 2VUGA 4A3LI 3J80b 3J80f 2JR6A 2QKDA 2WAQA 3F3PC 4MXUA 4CL1A 3CCUZ 4E2WA 3K7AI 4A93I 1M1K2 1PFTA 4Y52I 1RLYA 1QVGZ 1YI21 4BBRI 3VB9A 1RO2A 3CCV1 3J7A4 2HU9A 2IZ3A 2QEX1 3BG0B 1YUKA 1VQPZ 1M901 2OOYB 3GTKI 3KIHA 5LL6f 3TDHB 2OTLZ 1VQ81 3J81b 3J81f 3HOVI 3GTLI 1M902 1Z03A 4BY7I 4A3GI 4RV9A 2GU2A 3H0GI 1NJI2 4AYBA 3G6EZ 4RVHA 2GTHA 4E30A 1ML8A 2JUBA 3NDJA 2QREB 2OTJ1 3OW2Y 3QWUA 2Q4ZA 2YADA 1LQLA 1I50I 2WB1A 1K9M1 1Y1WI 3CCR1 1TWFI 3CCSZ 2R92I 1TWAI 2JA8I 1VQM1 2R6MA 1VQ9Z 1K9M2 1JJ2Z 2E2JI 2V8KA 1KD12 1I3QI 1Z02A 1USPB 5D1PA 2QRDB 3CCM1 4DGLA 4HH4A 3I4NI 2P28A 4QTUA 1L1OC 1TWGI 3EEDA 1VQNZ 5T6BA 4NFRA 4NBDA 1Q811 3CC7Z 3GKQA 3CD6Z 3S2DI 1WW9A 3GTPI 2R7ZI 2I3CA 4E32A 5T67A 4HGYA 1YHQZ 1YITZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E I;  4NOZ A;  3M4O I;  2KPI A;  4XX2 A;  3I4M I;  3GTM S;  1VLA A;  1X3Z A;  4NBB A;  2YU9 I;  4BBS I;  5FLM I;  3HOW I;  3RZO I;  5C3E I;  1QYP A;  2JS4 A;  4A3B I;  1DL6 A;  2P3Y A;  4A3K I;  2PK7 A;  4A3M I;  3S14 I;  3HOX I;  1X3W A;  4A3L I;  3RZD I;  3GTQ I;  4NBC A;  2DE6 A;  3VMG A;  2JR6 A;  2R93 I;  2JNY A;  3U50 C;  4A3F I;  4NB9 A;  4BY1 I;  3HOU I;  3I07 A;  3LUS A;  4BXX I;  3K7A I;  3VMI A;  3GTJ I;  4A93 I;  2RBL A;  1PFT A;  3S2H I;  4Y52 I;  1I6H I;  1RLY A;  4BBR I;  3VB9 A;  3S1R I;  5IP7 I;  2JA7 I;  1R9T I;  1YUA A;  2NVT I;  3GTK I;  5IP9 I;  3GTM I;  3ESW A;  2HF1 A;  2F4O A;  2E2H I;  3GCF A;  1N2F A;  3HOV I;  3FKI I;  3GTL I;  2VUM I;  4BY7 I;  3S17 I;  4A3G I;  3H0G I;  1Y1V S;  3M3Y I;  4NBA A;  3S1Q I;  4NB8 A;  1ML8 A;  3GTO I;  2K5R A;  3Q87 A;  4NBH A;  3H3V J;  1LQL A;  1I50 I;  2NVY I;  1RO4 A;  1TWC I;  2JA5 I;  4MH4 A;  4A3D I;  1Y1W I;  1TFI A;  1TWF I;  3PO3 S;  5C4J I;  2R92 I;  1TWA I;  2JA8 I;  3CQZ I;  2F4M A;  1SFO I;  3VMH A;  2DE7 A;  4NBF A;  2E2J I;  1I3Q I;  3PO2 I;  3PO3 I;  1USP B;  2DE5 A;  1ZB8 A;  2NVQ I;  1ZB9 A;  4A3J I;  3D6W A;  2AKL A;  2NVX I;  1NUI A;  3GTG I;  4NBE A;  4A3C I;  3I4N I;  2B63 I;  5CM2 M;  3EER A;  4QTU A;  2JA6 I;  1L1O C;  1TWG I;  3S1N I;  1WCM I;  1Y1V I;  4NBD A;  3HOY I;  4Y7N I;  3S15 I;  3GKQ A;  5C44 I;  4X6A I;  3S2D I;  1WW9 A;  3S1M I;  3GTP I;  2R7Z I;  4A3I I;  4NBG A;  1TWH I;  2E2I I;  1K83 I;  1USP A;  5C4X I;  2BJO A;  2J6A A;  4QTT A;  3S16 I;  3HOZ I; 
#chains in the Genus database with same CATH topology
 1KC8 2;  5T64 A;  2LIY A;  4NOZ A;  1K73 2;  3CCL Z;  5D1O A;  2V8J A;  4BBS I;  5FLM I;  3HOW I;  1Z01 A;  5C3E I;  2JS4 A;  2VF1 A;  3CMA 1;  1DL6 A;  5D1O B;  2P3Y A;  3CCE 1;  2PK7 A;  2RIQ A;  3CCQ 1;  5FLX b;  3RZD I;  1KQS Z;  5FLX f;  3CCJ 1;  4NBC A;  3MON A;  2JNY A;  4MRI A;  3JAM b;  2ZAE B;  3U50 C;  1N8R 1;  2O53 A;  1VQO Z;  3LUS A;  3CXC Z;  1QXF A;  3GTJ I;  2JIQ A;  2PMZ A;  1VQ5 1;  1FDO A;  3CC2 Z;  3F3F C;  1YUA A;  3D2L A;  1VQ7 1;  1WZN A;  3G4S Z;  3TE5 B;  1YIJ Z;  1VQ4 Z;  3FKI I;  3VTN A;  2VUM I;  3CCU 1;  1Q86 2;  1M1K 1;  1Y1V S;  2V8I A;  3GTO I;  4MD9 A;  2K5R A;  3H3V J;  2NVY I;  1RO4 A;  4MH4 A;  2IV2 X;  1VQP 1;  3FQM A;  3NH8 A;  5C4J I;  3CQZ I;  2F4M A;  1Q82 2;  2OTL 1;  4HGZ A;  1NJI 1;  2DE7 A;  4NBF A;  1P9N A;  4E2Z A;  2QA4 1;  3PO3 I;  2NVQ I;  2QA4 Z;  3G6E 1;  4E31 A;  2OOX B;  3D6W A;  2AKL A;  4DK1 A;  4MD8 A;  4EWC A;  3EER A;  1QVF Z;  3S1N I;  1Y1V I;  3CCS 1;  3HOY I;  3HKZ A;  5C44 I;  2O4H A;  1KD1 1;  1RO0 A;  1VQ9 1;  4A3I I;  3CC4 Z;  4E2X A;  4NBG A;  1USP A;  4QTT A;  3S16 I;  4A3E I;  3FQQ A;  2JIR A;  4MON A;  4NH1 C;  1YJW Z;  2KPI A;  2V3V A;  3GTM S;  3IFU A;  2Y0S A;  1VQN 1;  1VQL Z;  3CC7 1;  4A3B I;  2LFU A;  4A3K I;  3CD6 1;  1VQ6 1;  2JIP A;  1VQ6 Z;  1X3W A;  1FDI A;  4RVF A;  3VMG A;  2DE6 A;  1NP6 A;  1W2B Y;  1KC8 1;  1K73 1;  1S72 Z;  3NH5 A;  1YHQ 1;  1YIT 1;  3MZL B;  3IX0 A;  1YJN Z;  4MD7 A;  4BY1 I;  2VPZ A;  1WII A;  3I07 A;  4BXX I;  2E9H A;  2PM9 A;  3CCL 1;  1R9T I;  2G2K A;  3GTM I;  3CPW Z;  2HF1 A;  2F4O A;  3I55 1;  2E2H I;  3I55 Z;  4RVG A;  1K8A 2;  2Q51 A;  3JAM f;  1VQO 1;  4NB8 A;  1QVG Y;  4S1T A;  2EGT A;  3Q87 A;  4NBH A;  4E2Y A;  3CME Z;  2K3R A;  2RT9 A;  1TWC I;  2JA5 I;  4A3D I;  2GTI A;  3CC2 1;  2QR1 B;  3PO3 S;  2NAP A;  3G4S 1;  1SFO I;  3VMH A;  5AN9 F;  1YIJ 1;  1Q7Y 2;  1VQ4 1;  1Q86 1;  2RHB A;  3PO2 I;  1QVF Y;  5IT9 b;  5IT9 f;  4A3J I;  2NVX I;  3GTG I;  4NBE A;  2QLV B;  3NDI A;  2B63 I;  2M48 A;  1WJ2 A;  2JA6 I;  1Q82 1;  1YJ9 1;  3G71 1;  1JJ2 Y;  1YJ9 Z;  3S1M I;  3G71 Z;  5C4X I;  2AYD A;  2J6A A;  2RPR A;  1JWH C;  4XX2 A;  4NBB A;  1YI2 Z;  2YU9 I;  1RQF A;  3CCV Z;  2QRC B;  1Y8C A;  2W04 A;  4A3M I;  2QEX Z;  3S14 I;  3CC4 1;  1VQ8 Z;  3GTQ I;  2R93 I;  3NH4 A;  2JMO A;  4RVD A;  4E33 A;  4A3F I;  4NB9 A;  3I56 1;  5A2Q b;  3HOU I;  1YJW 1;  5A2Q f;  3I56 Z;  3VMI A;  2RBL A;  3S2H I;  2OTJ Z;  1I6H I;  4TNU A;  1VQK 1;  1VQL 1;  3S1R I;  3P5J B;  5IP7 I;  3CPW Y;  2JA7 I;  1RNI A;  1VQK Z;  1KQS Y;  1AA6 A;  3CCR Z;  2NVT I;  2V45 A;  5IP9 I;  1VQM Z;  3ESW A;  3GCF A;  1N2F A;  1S72 1;  3CXC Y;  3S17 I;  1YJN 1;  2M6N A;  3M3Y I;  4NBA A;  3S1Q I;  2LEX A;  3CCM Z;  3MZK B;  4RS4 A;  4DQY B;  3KIF A;  1TFI A;  2VPX A;  3OW2 Z;  2W03 A;  1Q81 2;  1K8A 1;  2OZK A;  2KI7 B;  2H85 A;  1ZB8 A;  2DE5 A;  1ZB9 A;  1NUI A;  4A3C I;  1S7M A;  3NFZ A;  5CM2 M;  3CME 1;  1WCM I;  1Q7Y 1;  4Y7N I;  3S15 I;  3CMA Z;  4X6A I;  3CCE Z;  3BG1 B;  2JIM A;  3CCQ Z;  3IF8 A;  1TWH I;  2E2I I;  1K83 I;  3CCJ Z;  2BJO A;  1KRL A;  3HOZ I;  2IZ4 A;  1W2B Z;  3D9X A;  3M4O I;  3T4N B;  3I4M I;  2VPY A;  1N8R 2;  1QF8 A;  1ZH1 A;  1VLA A;  1X3Z A;  1SIW A;  1X0T A;  3RZO I;  1QYP A;  1VQ5 Z;  1VQ7 Z;  3HOX I;  2VUG A;  4A3L I;  3J80 b;  3J80 f;  2JR6 A;  2QKD A;  2WAQ A;  3F3P C;  4MXU A;  4CL1 A;  3CCU Z;  4E2W A;  3K7A I;  4A93 I;  1M1K 2;  1PFT A;  4Y52 I;  1RLY A;  1QVG Z;  1YI2 1;  4BBR I;  3VB9 A;  1RO2 A;  3CCV 1;  3J7A 4;  2HU9 A;  2IZ3 A;  2E7Z A;  3BG0 B;  1YUK A;  2QEX 1;  1VQP Z;  1M90 1;  2OOY B;  3GTK I;  3KIH A;  5LL6 f;  3TDH B;  2OTL Z;  1VQ8 1;  3J81 b;  3J81 f;  3HOV I;  3GTL I;  1M90 2;  1Z03 A;  4BY7 I;  4A3G I;  4RV9 A;  2GU2 A;  3H0G I;  1NJI 2;  4AYB A;  3G6E Z;  4RVH A;  2GTH A;  4E30 A;  1ML8 A;  2JUB A;  3NDJ A;  2QRE B;  2OTJ 1;  3OW2 Y;  3QWU A;  2Q4Z A;  2YAD A;  1LQL A;  1I50 I;  2WB1 A;  3IR7 A;  1Q16 A;  1K9M 1;  1Y1W I;  3CCR 1;  1TWF I;  3CCS Z;  2JIO A;  2R92 I;  1TWA I;  2JA8 I;  1VQM 1;  2R6M A;  1VQ9 Z;  1K9M 2;  1JJ2 Z;  2E2J I;  2V8K A;  1KD1 2;  1I3Q I;  1Z02 A;  1USP B;  5D1P A;  2QRD B;  3CCM 1;  4DGL A;  4HH4 A;  3I4N I;  2P28 A;  4QTU A;  1L1O C;  1TWG I;  3EED A;  1VQN Z;  5T6B A;  4NFR A;  4NBD A;  1Q81 1;  3CC7 Z;  3GKQ A;  2VPW A;  3CD6 Z;  3S2D I;  1WW9 A;  3GTP I;  2R7Z I;  2I3C A;  4E32 A;  5T67 A;  4HGY A;  1YHQ Z;  1YIT Z; 
#chains in the Genus database with same CATH homology
 1KC8 2;  5T64 A;  2LIY A;  4NOZ A;  1K73 2;  3CCL Z;  5D1O A;  2V8J A;  4BBS I;  5FLM I;  3HOW I;  1Z01 A;  5C3E I;  2JS4 A;  2VF1 A;  3CMA 1;  1DL6 A;  5D1O B;  2P3Y A;  3CCE 1;  2PK7 A;  2RIQ A;  3CCQ 1;  5FLX b;  3RZD I;  1KQS Z;  5FLX f;  3CCJ 1;  4NBC A;  3MON A;  2JNY A;  4MRI A;  3JAM b;  2ZAE B;  3U50 C;  1N8R 1;  2O53 A;  1VQO Z;  3LUS A;  3CXC Z;  3GTJ I;  2PMZ A;  1VQ5 1;  3CC2 Z;  3F3F C;  1YUA A;  1VQ7 1;  3G4S Z;  3TE5 B;  1YIJ Z;  1VQ4 Z;  3FKI I;  3VTN A;  2VUM I;  3CCU 1;  1Q86 2;  1M1K 1;  1Y1V S;  2V8I A;  3GTO I;  4MD9 A;  2K5R A;  3H3V J;  2NVY I;  1RO4 A;  4MH4 A;  1VQP 1;  3FQM A;  3NH8 A;  5C4J I;  3CQZ I;  2F4M A;  1Q82 2;  2OTL 1;  4HGZ A;  1NJI 1;  2DE7 A;  4NBF A;  1P9N A;  4E2Z A;  2QA4 1;  3PO3 I;  2NVQ I;  2QA4 Z;  3G6E 1;  4E31 A;  2OOX B;  3D6W A;  2AKL A;  4DK1 A;  4MD8 A;  4EWC A;  3EER A;  1QVF Z;  3S1N I;  1Y1V I;  3CCS 1;  3HOY I;  3HKZ A;  5C44 I;  2O4H A;  1KD1 1;  1RO0 A;  1VQ9 1;  4A3I I;  3CC4 Z;  4E2X A;  4NBG A;  1USP A;  4QTT A;  3S16 I;  4A3E I;  3FQQ A;  4MON A;  4NH1 C;  1YJW Z;  2KPI A;  3GTM S;  3IFU A;  2Y0S A;  1VQN 1;  1VQL Z;  3CC7 1;  4A3B I;  2LFU A;  4A3K I;  3CD6 1;  1VQ6 1;  1VQ6 Z;  1X3W A;  4RVF A;  3VMG A;  2DE6 A;  1NP6 A;  1W2B Y;  1KC8 1;  1K73 1;  1S72 Z;  3NH5 A;  1YHQ 1;  1YIT 1;  3MZL B;  3IX0 A;  1YJN Z;  4MD7 A;  4BY1 I;  1WII A;  3I07 A;  4BXX I;  2E9H A;  2PM9 A;  3CCL 1;  1R9T I;  2G2K A;  3GTM I;  3CPW Z;  2HF1 A;  2F4O A;  3I55 1;  2E2H I;  3I55 Z;  4RVG A;  1K8A 2;  2Q51 A;  3JAM f;  1VQO 1;  4NB8 A;  1QVG Y;  4S1T A;  2EGT A;  3Q87 A;  4NBH A;  4E2Y A;  3CME Z;  2K3R A;  2RT9 A;  1TWC I;  2JA5 I;  4A3D I;  2GTI A;  3CC2 1;  2QR1 B;  3PO3 S;  3G4S 1;  1SFO I;  3VMH A;  5AN9 F;  1YIJ 1;  1Q7Y 2;  1VQ4 1;  1Q86 1;  2RHB A;  3PO2 I;  1QVF Y;  5IT9 b;  5IT9 f;  4A3J I;  2NVX I;  3GTG I;  4NBE A;  2QLV B;  3NDI A;  2B63 I;  2M48 A;  2JA6 I;  1Q82 1;  1YJ9 1;  3G71 1;  1JJ2 Y;  1YJ9 Z;  3S1M I;  3G71 Z;  5C4X I;  2J6A A;  2RPR A;  1JWH C;  4XX2 A;  4NBB A;  1YI2 Z;  2YU9 I;  1RQF A;  3CCV Z;  2QRC B;  2W04 A;  4A3M I;  2QEX Z;  3S14 I;  3CC4 1;  1VQ8 Z;  3GTQ I;  2R93 I;  3NH4 A;  2JMO A;  4RVD A;  4E33 A;  4A3F I;  4NB9 A;  3I56 1;  5A2Q b;  3HOU I;  1YJW 1;  5A2Q f;  3I56 Z;  3VMI A;  2RBL A;  3S2H I;  2OTJ Z;  1I6H I;  4TNU A;  1VQK 1;  1VQL 1;  3S1R I;  3P5J B;  5IP7 I;  3CPW Y;  2JA7 I;  1RNI A;  1VQK Z;  1KQS Y;  3CCR Z;  2NVT I;  5IP9 I;  1VQM Z;  3ESW A;  3GCF A;  1N2F A;  1S72 1;  3CXC Y;  3S17 I;  1YJN 1;  2M6N A;  3M3Y I;  4NBA A;  3S1Q I;  3CCM Z;  3MZK B;  4RS4 A;  4DQY B;  3KIF A;  1TFI A;  3OW2 Z;  2W03 A;  1Q81 2;  1K8A 1;  2OZK A;  2KI7 B;  2H85 A;  1ZB8 A;  2DE5 A;  1ZB9 A;  1NUI A;  4A3C I;  1S7M A;  3NFZ A;  5CM2 M;  3CME 1;  1WCM I;  1Q7Y 1;  4Y7N I;  3S15 I;  3CMA Z;  4X6A I;  3CCE Z;  3BG1 B;  3CCQ Z;  3IF8 A;  1TWH I;  2E2I I;  1K83 I;  3CCJ Z;  2BJO A;  1KRL A;  3HOZ I;  2IZ4 A;  1W2B Z;  3D9X A;  3M4O I;  3T4N B;  3I4M I;  1N8R 2;  1QF8 A;  1ZH1 A;  1VLA A;  1X3Z A;  1X0T A;  3RZO I;  1QYP A;  1VQ5 Z;  1VQ7 Z;  3HOX I;  2VUG A;  4A3L I;  3J80 b;  3J80 f;  2JR6 A;  2QKD A;  2WAQ A;  3F3P C;  4MXU A;  4CL1 A;  3CCU Z;  4E2W A;  3K7A I;  4A93 I;  1M1K 2;  1PFT A;  4Y52 I;  1RLY A;  1QVG Z;  1YI2 1;  4BBR I;  3VB9 A;  1RO2 A;  3CCV 1;  3J7A 4;  2HU9 A;  2IZ3 A;  2QEX 1;  3BG0 B;  1YUK A;  1VQP Z;  1M90 1;  2OOY B;  3GTK I;  3KIH A;  5LL6 f;  3TDH B;  2OTL Z;  1VQ8 1;  3J81 b;  3J81 f;  3HOV I;  3GTL I;  1M90 2;  1Z03 A;  4BY7 I;  4A3G I;  4RV9 A;  2GU2 A;  3H0G I;  1NJI 2;  4AYB A;  3G6E Z;  4RVH A;  2GTH A;  4E30 A;  1ML8 A;  2JUB A;  3NDJ A;  2QRE B;  2OTJ 1;  3OW2 Y;  3QWU A;  2Q4Z A;  2YAD A;  1LQL A;  1I50 I;  2WB1 A;  1K9M 1;  1Y1W I;  3CCR 1;  1TWF I;  3CCS Z;  2R92 I;  1TWA I;  2JA8 I;  1VQM 1;  2R6M A;  1VQ9 Z;  1K9M 2;  1JJ2 Z;  2E2J I;  2V8K A;  1KD1 2;  1I3Q I;  1Z02 A;  1USP B;  5D1P A;  2QRD B;  3CCM 1;  4DGL A;  4HH4 A;  3I4N I;  2P28 A;  4QTU A;  1L1O C;  1TWG I;  3EED A;  1VQN Z;  5T6B A;  4NFR A;  4NBD A;  1Q81 1;  3CC7 Z;  3GKQ A;  3CD6 Z;  3S2D I;  1WW9 A;  3GTP I;  2R7Z I;  2I3C A;  4E32 A;  5T67 A;  4HGY A;  1YHQ Z;  1YIT Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...