3S1MI

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3s1mI02
3GTMS 3I4MI 2NVTI 4A3CI 4Y52I 5C44I 4A3FI 3HOUI 1USPB 1PFTA 2YU9I 3I4NI 1QYPA 2E2II 1L1OC 4MH4A 4NBGA 4A3EI 3H3VJ 3HOYI 1R9TI 3GTLI 2J6AA 4NBEA 4NBDA 2B63I 2DE6A 3HOWI 3CQZI 4NOZA 1ML8A 4Y7NI 3GTOI 2NVXI 3S15I 3K7AI 1WW9A 3LUSA 3GKQA 2R93I 1SFOI 3U50C 3VMIA 4A3BI 2E2HI 3M4OI 2JS4A 4BY1I 3RZOI 5C3EI 4A3MI 2BJOA 4X6AI 5FLMI 4BY7I 3PO3S 1TFIA 2F4OA 1USPA 2K5RA 4NB8A 1RLYA 2JNYA 1X3WA 1Y1VS 5C4JI 1TWCI 3S14I 3D6WA 1RO4A 1TWHI 2RBLA 3H0GI 4NBBA 1ZB9A 4BBRI 4NB9A 2R92I 4A3LI 1NUIA 2HF1A 3GTPI 1I50I 5CM2M 2JA6I 4NBCA 2VUMI 4QTTA 2JA5I 1X3ZA 1VLAA 1ZB8A 4A3II 3GTGI 3FKII 3I07A 3S1QI 1Y1WI 3ESWA 3VMGA 5IP7I 4A3KI 2JA7I 3S16I 1WCMI 1I3QI 3S2DI 3VB9A 1TWFI 3S17I 2E2JI 4A3DI 3HOVI 3GTKI 1TWGI 2JA8I 4A3GI 2P3YA 3S1MI 3RZDI 3M3YI 3S2HI 3GCFA 1YUAA 4BXXI 3GTQI 3EERA 5IP9I 2PK7A 3GTMI 1I6HI 4A93I 3VMHA 4NBAA 3PO2I 2NVQI 4A3JI 3PO3I 3HOXI 1K83I 1DL6A 1Y1VI 1N2FA 5C4XI 4BBSI 2DE5A 3HOZI 3Q87A 4QTUA 4NBFA 3GTJI 2NVYI 2F4MA 2JR6A 1TWAI 2AKLA 3S1RI 1LQLA 2DE7A 2KPIA 4XX2A 2R7ZI 3S1NI 4NBHA
chains in the Genus database with same CATH superfamily
3KIFA 4RVHA 4Y52I 3CCL1 5C44I 2PMZA 3CCM1 4E31A 2JIMA 2GTIA 1NJI1 3I4NI 1QYPA 1L1OC 4MH4A 3J81f 3NDIA 3GTLI 3I56Z 3CXCZ 4NBEA 2B63I 3NH8A 1Q16A 4Y7NI 3GTOI 1WW9A 3FQMA 3LUSA 1Q861 2R93I 1SFOI 3U50C 1Q7Y1 4A3BI 2E2HI 4A3MI 1YJ9Z 3G4S1 4CL1A 1VQ71 5FLMI 2OZKA 4BY7I 2IZ4A 3CCR1 2VPWA 1Y1VS 4DQYB 1KC81 3D9XA 5C4JI 1AA6A 4NH1C 2RBLA 3H0GI 1ZB9A 2VPYA 2JIOA 1QF8A 1JWHC 2HF1A 2GU2A 5A2Qf 2Y0SA 3CD61 4E2WA 2VPXA 2OOYB 1K9M1 1QXFA 3P5JB 3CCUZ 2OTJZ 2V8KA 1RO2A 3S2DI 1K8A1 2QREB 1TWFI 2IZ3A 3S17I 3HOVI 3T4NB 3J80b 2JA8I 1RO0A 4MXUA 2V8IA 1YUAA 3GCFA 4BXXI 3TE5B 1KC82 1YJ91 4A93I 3CCE1 2O53A 3PO2I 1VQ5Z 1Y1VI 3CCQ1 3CCQZ 2RPRA 3NH4A 1Q862 2NVYI 3CCJZ 1TWAI 1RNIA 2Q51A 3G6EZ 2R6MA 2DE7A 3CMEZ 4NBHA 2RIQA 1W2BZ 1WJ2A 2NVTI 3GTMS 3I4MI 4MD8A 5D1OB 2K3RA 3NFZA 1K8A2 1Q811 3MONA 2AYDA 3J81b 1USPB 3IF8A 3CC2Z 4MD7A 2ZAEB 3H3VJ 3HOYI 2RHBA 1K9M2 1M902 2J6AA 1Q821 3CQZI 3J80f 1ML8A 2NVXI 3S15I 2Q4ZA 1VQM1 4HH4A 3CCJ1 3VMIA 4MONA 3CC4Z 3M4OI 2VUGA 3I551 3RZOI 1KQSZ 3CCV1 3G4SZ 1S72Z 1TWCI 5FLXf 3S14I 4DGLA 2LIYA 2QKDA 2R92I 5T67A 3FQQA 3I55Z 5CM2M 1VQK1 2VUMI 1K731 2IV2X 2JA5I 2JMOA 3HKZA 1YUKA 2P28A 3VTNA 2OOXB 1YHQZ 2LEXA 1KQSY 1QVGZ 3BG1B 3VB9A 3OW2Z 4MRIA 4RVFA 4NFRA 4A3GI 3M3YI 1S721 2M48A 3GTQI 1Z02A 5IP9I 1VQ9Z 3VMHA 4NBAA 2WAQA 5D1PA 2NVQI 3PO3I 3HOXI 1K83I 1DL6A 1X0TA 3F3FC 5C4XI 4DK1A 2M6NA 4E30A 4BBSI 2DE5A 4QTUA 4NBFA 1K732 3GTJI 2QEX1 2AKLA 4TNUA 1VQMZ 1VQ7Z 2JIQA 5A2Qb 1VQP1 1YJNZ 3S1NI 2R7ZI 2OTJ1 1YITZ 1M901 3G711 2YADA 1KD12 4A3FI 3HOUI 1PFTA 3CC21 2E2II 1NP6A 4NBGA 2H85A 1R9TI 2NAPA 4EWCA 2V8JA 1VQOZ 2HU9A 4NBDA 2DE6A 3CCU1 1QVFZ 3HOWI 5AN9F 1RQFA 3K7AI 3CMA1 2VF1A 1YIJZ 2I3CA 4BY1I 1N8R1 1VQ81 3QWUA 4E2ZA 4E32A 3CCVZ 1WZNA 4RVGA 3PO3S 1TFIA 3CXCY 2F4OA 2E9HA 1RLYA 4NB8A 1X3WA 3MZKB 1Z03A 3CPWZ 1JJ2Y 1RO4A 1VQ91 1TWHI 1WIIA 4BBRI 1QVGY 2OTL1 5IT9f 4HGZA 3GTPI 2KI7B 2PM9A 1I50I 2QA4Z 5IT9b 1Y8CA 1ZB8A 3F3PC 1Q822 3S1QI 3ESWA 1QVFY 1YHQ1 4E33A 5IP7I 3S16I 2WB1A 1I3QI 3TDHB 2G2KA 2GTHA 4A3DI 3GTKI 1KRLA 2P3YA 3RZDI 4RV9A 3JAMb 3EEDA 2QA41 3CD6Z 4S1TA 2W03A 2EGTA 1FDIA 2PK7A 2OTLZ 2QLVB 5LL6f 3G71Z 1VQ41 1VQ61 1YIT1 1VQN1 3IFUA 1N2FA 1ZH1A 5T64A 3HOZI 2JR6A 3CCEZ 1M1K1 3OW2Y 3KIHA 1N8R2 4RS4A 4RVDA 3S1RI 1FDOA 2QRCB 2KPIA 3CCS1 4E2XA 2VPZA 1JJ2Z 4A3CI 2YU9I 4A3EI 1VQPZ 3MZLB 3CCSZ 1YI2Z 3D2LA 1YJW1 2JIPA 4NOZA 2JUBA 2V3VA 3CC71 3NDJA 3JAMf 3GKQA 1W2BY 2LFUA 2JIRA 3CPWY 2JS4A 4MD9A 5C3EI 3G6E1 2BJOA 4X6AI 4HGYA 1VQ8Z 1VQNZ 1USPA 2K5RA 1VQ51 2JNYA 1VQ6Z 3D6WA 4NBBA 5D1OA 3CMAZ 4NB9A 2O4HA 4A3LI 1NUIA 1Z01A 1KD11 2JA6I 4NBCA 3CC41 4QTTA 1X3ZA 4E2YA 1VLAA 5FLXb 4A3II 3GTGI 1S7MA 3FKII 3I07A 3NH5A 1Y1WI 3VMGA 3CME1 4A3KI 2JA7I 3IR7A 1WCMI 3I561 3CCMZ 2E2JI 2QRDB 3CCLZ 1TWGI 1P9NA 1Q812 3S1MI 3S2HI 1VQKZ 1YJN1 2E7ZA 1NJI2 3EERA 1M1K2 1VQL1 3GTMI 1I6HI 2QR1B 2QEXZ 3BG0B 4A3JI 1VQ4Z 3IX0A 3Q87A 1SIWA 3J7A4 1YIJ1 2F4MA 2W04A 1VQLZ 3CCRZ 3CC7Z 2RT9A 1Q7Y2 5T6BA 1LQLA 4XX2A 1YJWZ 4AYBA 1VQO1 1YI21 2V45A
chains in the Genus database with same CATH topology
3KIFA 4RVHA 4Y52I 3CCL1 5C44I 2PMZA 3CCM1 4E31A 2GTIA 1NJI1 3I4NI 1QYPA 1L1OC 4MH4A 3J81f 3NDIA 3GTLI 3I56Z 3CXCZ 4NBEA 2B63I 3NH8A 4Y7NI 3GTOI 1WW9A 3FQMA 3LUSA 1Q861 2R93I 1SFOI 3U50C 1Q7Y1 4A3BI 2E2HI 4A3MI 1YJ9Z 3G4S1 4CL1A 1VQ71 5FLMI 2OZKA 4BY7I 2IZ4A 3CCR1 1KC81 1Y1VS 4DQYB 3D9XA 5C4JI 4NH1C 2RBLA 3H0GI 1ZB9A 1QF8A 1JWHC 2HF1A 2GU2A 5A2Qf 2Y0SA 3CD61 4E2WA 2OOYB 1K9M1 3P5JB 3CCUZ 2OTJZ 2V8KA 1RO2A 3S2DI 1K8A1 2QREB 1TWFI 2IZ3A 3S17I 3HOVI 3T4NB 3J80b 2JA8I 1RO0A 4MXUA 2V8IA 1YUAA 3GCFA 4BXXI 3TE5B 1KC82 1YJ91 4A93I 3CCE1 2O53A 3PO2I 1VQ5Z 1Y1VI 3CCQ1 3CCQZ 2RPRA 3NH4A 1Q862 2NVYI 3CCJZ 1TWAI 1RNIA 2Q51A 3G6EZ 2R6MA 2DE7A 3CMEZ 4NBHA 2RIQA 1W2BZ 3GTMS 2NVTI 3I4MI 4MD8A 5D1OB 2K3RA 3NFZA 1K8A2 1Q811 3MONA 3J81b 1USPB 3IF8A 3CC2Z 4MD7A 2ZAEB 3H3VJ 3HOYI 2RHBA 1K9M2 1M902 2J6AA 1Q821 3CQZI 3J80f 1ML8A 2NVXI 3S15I 2Q4ZA 1VQM1 4HH4A 3CCJ1 3VMIA 4MONA 3CC4Z 3M4OI 2VUGA 3I551 3RZOI 1KQSZ 3CCV1 3G4SZ 1S72Z 1TWCI 5FLXf 3S14I 4DGLA 2LIYA 2QKDA 2R92I 5T67A 3FQQA 3I55Z 5CM2M 1VQK1 2VUMI 1K731 2JA5I 2JMOA 3HKZA 1YUKA 2P28A 3VTNA 2OOXB 1YHQZ 1KQSY 1QVGZ 3BG1B 3VB9A 3OW2Z 4MRIA 4RVFA 4NFRA 4A3GI 3M3YI 1S721 2M48A 3GTQI 1Z02A 5IP9I 1VQ9Z 3VMHA 4NBAA 2WAQA 5D1PA 2NVQI 3PO3I 3HOXI 1K83I 1DL6A 1X0TA 3F3FC 5C4XI 4DK1A 2M6NA 4E30A 4BBSI 2DE5A 4QTUA 1K732 4NBFA 3GTJI 2QEX1 2AKLA 4TNUA 1VQMZ 1VQ7Z 5A2Qb 1VQP1 1YJNZ 3S1NI 2R7ZI 2OTJ1 1YITZ 1M901 3G711 2YADA 1KD12 4A3FI 3HOUI 1PFTA 3CC21 2E2II 1NP6A 4NBGA 2H85A 1R9TI 4EWCA 2V8JA 1VQOZ 2HU9A 4NBDA 2DE6A 3CCU1 1QVFZ 3HOWI 5AN9F 1RQFA 3K7AI 3CMA1 2VF1A 1YIJZ 2I3CA 4BY1I 1N8R1 1VQ81 3QWUA 4E2ZA 4E32A 3CCVZ 4RVGA 3PO3S 1TFIA 3CXCY 2F4OA 2E9HA 1RLYA 4NB8A 1X3WA 3MZKB 1Z03A 3CPWZ 1JJ2Y 1RO4A 1VQ91 1TWHI 1WIIA 4BBRI 1QVGY 2OTL1 5IT9f 4HGZA 3GTPI 2KI7B 2PM9A 1I50I 2QA4Z 5IT9b 1ZB8A 3F3PC 1Q822 3S1QI 3ESWA 1QVFY 1YHQ1 4E33A 5IP7I 3S16I 2WB1A 1I3QI 3TDHB 2G2KA 2GTHA 4A3DI 3GTKI 1KRLA 2P3YA 3RZDI 4RV9A 3JAMb 3EEDA 2QA41 3CD6Z 4S1TA 2W03A 2EGTA 2PK7A 2OTLZ 2QLVB 5LL6f 3G71Z 1VQ41 1VQ61 1YIT1 1VQN1 3IFUA 1N2FA 1ZH1A 5T64A 3HOZI 2JR6A 3CCEZ 1M1K1 3OW2Y 3KIHA 1N8R2 4RS4A 4RVDA 3S1RI 2QRCB 2KPIA 3CCS1 4E2XA 1JJ2Z 4A3CI 2YU9I 4A3EI 1VQPZ 3MZLB 3CCSZ 1YI2Z 1YJW1 4NOZA 2JUBA 3CC71 3NDJA 3JAMf 3GKQA 1W2BY 2LFUA 3CPWY 2JS4A 4MD9A 5C3EI 3G6E1 2BJOA 4X6AI 4HGYA 1VQ8Z 1VQNZ 1USPA 2K5RA 1VQ51 2JNYA 1VQ6Z 3D6WA 4NBBA 5D1OA 3CMAZ 4NB9A 2O4HA 4A3LI 1NUIA 1Z01A 1KD11 2JA6I 4NBCA 3CC41 4QTTA 1X3ZA 4E2YA 1VLAA 5FLXb 4A3II 3GTGI 1S7MA 3FKII 3I07A 3NH5A 1Y1WI 3VMGA 3CME1 4A3KI 2JA7I 1WCMI 3CCMZ 2E2JI 2QRDB 3CCLZ 1TWGI 1P9NA 1Q812 3S1MI 3S2HI 1VQKZ 1YJN1 1NJI2 3EERA 1M1K2 1VQL1 3GTMI 1I6HI 2QR1B 2QEXZ 3BG0B 4A3JI 1VQ4Z 3IX0A 3Q87A 3J7A4 1YIJ1 2F4MA 2W04A 1VQLZ 3CCRZ 3CC7Z 2RT9A 1Q7Y2 5T6BA 1LQLA 4XX2A 1YJWZ 4AYBA 1VQO1 1YI21 3I561
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM S;  3I4M I;  2NVT I;  4A3C I;  4Y52 I;  5C44 I;  4A3F I;  3HOU I;  1USP B;  1PFT A;  2YU9 I;  3I4N I;  1QYP A;  2E2I I;  1L1O C;  4MH4 A;  4NBG A;  4A3E I;  3H3V J;  3HOY I;  1R9T I;  3GTL I;  2J6A A;  4NBE A;  4NBD A;  2B63 I;  2DE6 A;  3HOW I;  3CQZ I;  4NOZ A;  1ML8 A;  4Y7N I;  3GTO I;  2NVX I;  3S15 I;  3K7A I;  1WW9 A;  3LUS A;  3GKQ A;  2R93 I;  1SFO I;  3U50 C;  3VMI A;  4A3B I;  2E2H I;  3M4O I;  2JS4 A;  4BY1 I;  3RZO I;  5C3E I;  4A3M I;  2BJO A;  4X6A I;  5FLM I;  4BY7 I;  3PO3 S;  1TFI A;  2F4O A;  1USP A;  2K5R A;  4NB8 A;  1RLY A;  2JNY A;  1X3W A;  1Y1V S;  5C4J I;  1TWC I;  3S14 I;  3D6W A;  1RO4 A;  1TWH I;  2RBL A;  3H0G I;  4NBB A;  1ZB9 A;  4BBR I;  4NB9 A;  2R92 I;  4A3L I;  1NUI A;  2HF1 A;  3GTP I;  1I50 I;  5CM2 M;  2JA6 I;  4NBC A;  2VUM I;  4QTT A;  2JA5 I;  1X3Z A;  1VLA A;  1ZB8 A;  4A3I I;  3GTG I;  3FKI I;  3I07 A;  3S1Q I;  1Y1W I;  3ESW A;  3VMG A;  5IP7 I;  4A3K I;  2JA7 I;  3S16 I;  1WCM I;  1I3Q I;  3S2D I;  3VB9 A;  1TWF I;  3S17 I;  2E2J I;  4A3D I;  3HOV I;  3GTK I;  1TWG I;  2JA8 I;  4A3G I;  2P3Y A;  3S1M I;  3RZD I;  3M3Y I;  3S2H I;  3GCF A;  1YUA A;  4BXX I;  3GTQ I;  3EER A;  5IP9 I;  2PK7 A;  3GTM I;  1I6H I;  4A93 I;  3VMH A;  4NBA A;  3PO2 I;  2NVQ I;  4A3J I;  3PO3 I;  3HOX I;  1K83 I;  1DL6 A;  1Y1V I;  1N2F A;  5C4X I;  4BBS I;  2DE5 A;  3HOZ I;  3Q87 A;  4QTU A;  4NBF A;  3GTJ I;  2NVY I;  2F4M A;  2JR6 A;  1TWA I;  2AKL A;  3S1R I;  1LQL A;  2DE7 A;  2KPI A;  4XX2 A;  2R7Z I;  3S1N I;  4NBH A; 
#chains in the Genus database with same CATH topology
 3KIF A;  4RVH A;  4Y52 I;  3CCL 1;  5C44 I;  2PMZ A;  3CCM 1;  4E31 A;  2JIM A;  2GTI A;  1NJI 1;  3I4N I;  1QYP A;  1L1O C;  4MH4 A;  3J81 f;  3NDI A;  3GTL I;  3I56 Z;  3CXC Z;  4NBE A;  2B63 I;  3NH8 A;  1Q16 A;  4Y7N I;  3GTO I;  1WW9 A;  3FQM A;  3LUS A;  1Q86 1;  2R93 I;  1SFO I;  3U50 C;  1Q7Y 1;  4A3B I;  2E2H I;  4A3M I;  1YJ9 Z;  3G4S 1;  4CL1 A;  1VQ7 1;  5FLM I;  2OZK A;  4BY7 I;  2IZ4 A;  3CCR 1;  2VPW A;  1Y1V S;  4DQY B;  1KC8 1;  3D9X A;  5C4J I;  1AA6 A;  4NH1 C;  2RBL A;  3H0G I;  1ZB9 A;  2VPY A;  2JIO A;  1QF8 A;  1JWH C;  2HF1 A;  2GU2 A;  5A2Q f;  2Y0S A;  3CD6 1;  4E2W A;  2VPX A;  2OOY B;  1K9M 1;  1QXF A;  3P5J B;  3CCU Z;  2OTJ Z;  2V8K A;  1RO2 A;  3S2D I;  1K8A 1;  2QRE B;  1TWF I;  2IZ3 A;  3S17 I;  3HOV I;  3T4N B;  3J80 b;  2JA8 I;  1RO0 A;  4MXU A;  2V8I A;  1YUA A;  3GCF A;  4BXX I;  3TE5 B;  1KC8 2;  1YJ9 1;  4A93 I;  3CCE 1;  2O53 A;  3PO2 I;  1VQ5 Z;  1Y1V I;  3CCQ 1;  3CCQ Z;  2RPR A;  3NH4 A;  1Q86 2;  2NVY I;  3CCJ Z;  1TWA I;  1RNI A;  2Q51 A;  3G6E Z;  2R6M A;  2DE7 A;  3CME Z;  4NBH A;  2RIQ A;  1W2B Z;  1WJ2 A;  2NVT I;  3GTM S;  3I4M I;  4MD8 A;  5D1O B;  2K3R A;  3NFZ A;  1K8A 2;  1Q81 1;  3MON A;  2AYD A;  3J81 b;  1USP B;  3IF8 A;  3CC2 Z;  4MD7 A;  2ZAE B;  3H3V J;  3HOY I;  2RHB A;  1K9M 2;  1M90 2;  2J6A A;  1Q82 1;  3CQZ I;  3J80 f;  1ML8 A;  2NVX I;  3S15 I;  2Q4Z A;  1VQM 1;  4HH4 A;  3CCJ 1;  3VMI A;  4MON A;  3CC4 Z;  3M4O I;  2VUG A;  3I55 1;  3RZO I;  1KQS Z;  3CCV 1;  3G4S Z;  1S72 Z;  1TWC I;  5FLX f;  3S14 I;  4DGL A;  2LIY A;  2QKD A;  2R92 I;  5T67 A;  3FQQ A;  3I55 Z;  5CM2 M;  1VQK 1;  2VUM I;  1K73 1;  2IV2 X;  2JA5 I;  2JMO A;  3HKZ A;  1YUK A;  2P28 A;  3VTN A;  2OOX B;  1YHQ Z;  2LEX A;  1KQS Y;  1QVG Z;  3BG1 B;  3VB9 A;  3OW2 Z;  4MRI A;  4RVF A;  4NFR A;  4A3G I;  3M3Y I;  1S72 1;  2M48 A;  3GTQ I;  1Z02 A;  5IP9 I;  1VQ9 Z;  3VMH A;  4NBA A;  2WAQ A;  5D1P A;  2NVQ I;  3PO3 I;  3HOX I;  1K83 I;  1DL6 A;  1X0T A;  3F3F C;  5C4X I;  4DK1 A;  2M6N A;  4E30 A;  4BBS I;  2DE5 A;  4QTU A;  4NBF A;  1K73 2;  3GTJ I;  2QEX 1;  2AKL A;  4TNU A;  1VQM Z;  1VQ7 Z;  2JIQ A;  5A2Q b;  1VQP 1;  1YJN Z;  3S1N I;  2R7Z I;  2OTJ 1;  1YIT Z;  1M90 1;  3G71 1;  2YAD A;  1KD1 2;  4A3F I;  3HOU I;  1PFT A;  3CC2 1;  2E2I I;  1NP6 A;  4NBG A;  2H85 A;  1R9T I;  2NAP A;  4EWC A;  2V8J A;  1VQO Z;  2HU9 A;  4NBD A;  2DE6 A;  3CCU 1;  1QVF Z;  3HOW I;  5AN9 F;  1RQF A;  3K7A I;  3CMA 1;  2VF1 A;  1YIJ Z;  2I3C A;  4BY1 I;  1N8R 1;  1VQ8 1;  3QWU A;  4E2Z A;  4E32 A;  3CCV Z;  1WZN A;  4RVG A;  3PO3 S;  1TFI A;  3CXC Y;  2F4O A;  2E9H A;  1RLY A;  4NB8 A;  1X3W A;  3MZK B;  1Z03 A;  3CPW Z;  1JJ2 Y;  1RO4 A;  1VQ9 1;  1TWH I;  1WII A;  4BBR I;  1QVG Y;  2OTL 1;  5IT9 f;  4HGZ A;  3GTP I;  2KI7 B;  2PM9 A;  1I50 I;  2QA4 Z;  5IT9 b;  1Y8C A;  1ZB8 A;  3F3P C;  1Q82 2;  3S1Q I;  3ESW A;  1QVF Y;  1YHQ 1;  4E33 A;  5IP7 I;  3S16 I;  2WB1 A;  1I3Q I;  3TDH B;  2G2K A;  2GTH A;  4A3D I;  3GTK I;  1KRL A;  2P3Y A;  3RZD I;  4RV9 A;  3JAM b;  3EED A;  2QA4 1;  3CD6 Z;  4S1T A;  2W03 A;  2EGT A;  1FDI A;  2PK7 A;  2OTL Z;  2QLV B;  5LL6 f;  3G71 Z;  1VQ4 1;  1VQ6 1;  1YIT 1;  1VQN 1;  3IFU A;  1N2F A;  1ZH1 A;  5T64 A;  3HOZ I;  2JR6 A;  3CCE Z;  1M1K 1;  3OW2 Y;  3KIH A;  1N8R 2;  4RS4 A;  4RVD A;  3S1R I;  1FDO A;  2QRC B;  2KPI A;  3CCS 1;  4E2X A;  2VPZ A;  1JJ2 Z;  4A3C I;  2YU9 I;  4A3E I;  1VQP Z;  3MZL B;  3CCS Z;  1YI2 Z;  3D2L A;  1YJW 1;  2JIP A;  4NOZ A;  2JUB A;  2V3V A;  3CC7 1;  3NDJ A;  3JAM f;  3GKQ A;  1W2B Y;  2LFU A;  2JIR A;  3CPW Y;  2JS4 A;  4MD9 A;  5C3E I;  3G6E 1;  2BJO A;  4X6A I;  4HGY A;  1VQ8 Z;  1VQN Z;  1USP A;  2K5R A;  1VQ5 1;  2JNY A;  1VQ6 Z;  3D6W A;  4NBB A;  5D1O A;  3CMA Z;  4NB9 A;  2O4H A;  4A3L I;  1NUI A;  1Z01 A;  1KD1 1;  2JA6 I;  4NBC A;  3CC4 1;  4QTT A;  1X3Z A;  4E2Y A;  1VLA A;  5FLX b;  4A3I I;  3GTG I;  1S7M A;  3FKI I;  3I07 A;  3NH5 A;  1Y1W I;  3VMG A;  3CME 1;  4A3K I;  2JA7 I;  3IR7 A;  1WCM I;  3I56 1;  3CCM Z;  2E2J I;  2QRD B;  3CCL Z;  1TWG I;  1P9N A;  1Q81 2;  3S1M I;  3S2H I;  1VQK Z;  1YJN 1;  2E7Z A;  1NJI 2;  3EER A;  1M1K 2;  1VQL 1;  3GTM I;  1I6H I;  2QR1 B;  2QEX Z;  3BG0 B;  4A3J I;  1VQ4 Z;  3IX0 A;  3Q87 A;  1SIW A;  3J7A 4;  1YIJ 1;  2F4M A;  2W04 A;  1VQL Z;  3CCR Z;  3CC7 Z;  2RT9 A;  1Q7Y 2;  5T6B A;  1LQL A;  4XX2 A;  1YJW Z;  4AYB A;  1VQO 1;  1YI2 1;  2V45 A; 
#chains in the Genus database with same CATH homology
 3KIF A;  4RVH A;  4Y52 I;  3CCL 1;  5C44 I;  2PMZ A;  3CCM 1;  4E31 A;  2GTI A;  1NJI 1;  3I4N I;  1QYP A;  1L1O C;  4MH4 A;  3J81 f;  3NDI A;  3GTL I;  3I56 Z;  3CXC Z;  4NBE A;  2B63 I;  3NH8 A;  4Y7N I;  3GTO I;  1WW9 A;  3FQM A;  3LUS A;  1Q86 1;  2R93 I;  1SFO I;  3U50 C;  1Q7Y 1;  4A3B I;  2E2H I;  4A3M I;  1YJ9 Z;  3G4S 1;  4CL1 A;  1VQ7 1;  5FLM I;  2OZK A;  4BY7 I;  2IZ4 A;  3CCR 1;  1KC8 1;  1Y1V S;  4DQY B;  3D9X A;  5C4J I;  4NH1 C;  2RBL A;  3H0G I;  1ZB9 A;  1QF8 A;  1JWH C;  2HF1 A;  2GU2 A;  5A2Q f;  2Y0S A;  3CD6 1;  4E2W A;  2OOY B;  1K9M 1;  3P5J B;  3CCU Z;  2OTJ Z;  2V8K A;  1RO2 A;  3S2D I;  1K8A 1;  2QRE B;  1TWF I;  2IZ3 A;  3S17 I;  3HOV I;  3T4N B;  3J80 b;  2JA8 I;  1RO0 A;  4MXU A;  2V8I A;  1YUA A;  3GCF A;  4BXX I;  3TE5 B;  1KC8 2;  1YJ9 1;  4A93 I;  3CCE 1;  2O53 A;  3PO2 I;  1VQ5 Z;  1Y1V I;  3CCQ 1;  3CCQ Z;  2RPR A;  3NH4 A;  1Q86 2;  2NVY I;  3CCJ Z;  1TWA I;  1RNI A;  2Q51 A;  3G6E Z;  2R6M A;  2DE7 A;  3CME Z;  4NBH A;  2RIQ A;  1W2B Z;  3GTM S;  2NVT I;  3I4M I;  4MD8 A;  5D1O B;  2K3R A;  3NFZ A;  1K8A 2;  1Q81 1;  3MON A;  3J81 b;  1USP B;  3IF8 A;  3CC2 Z;  4MD7 A;  2ZAE B;  3H3V J;  3HOY I;  2RHB A;  1K9M 2;  1M90 2;  2J6A A;  1Q82 1;  3CQZ I;  3J80 f;  1ML8 A;  2NVX I;  3S15 I;  2Q4Z A;  1VQM 1;  4HH4 A;  3CCJ 1;  3VMI A;  4MON A;  3CC4 Z;  3M4O I;  2VUG A;  3I55 1;  3RZO I;  1KQS Z;  3CCV 1;  3G4S Z;  1S72 Z;  1TWC I;  5FLX f;  3S14 I;  4DGL A;  2LIY A;  2QKD A;  2R92 I;  5T67 A;  3FQQ A;  3I55 Z;  5CM2 M;  1VQK 1;  2VUM I;  1K73 1;  2JA5 I;  2JMO A;  3HKZ A;  1YUK A;  2P28 A;  3VTN A;  2OOX B;  1YHQ Z;  1KQS Y;  1QVG Z;  3BG1 B;  3VB9 A;  3OW2 Z;  4MRI A;  4RVF A;  4NFR A;  4A3G I;  3M3Y I;  1S72 1;  2M48 A;  3GTQ I;  1Z02 A;  5IP9 I;  1VQ9 Z;  3VMH A;  4NBA A;  2WAQ A;  5D1P A;  2NVQ I;  3PO3 I;  3HOX I;  1K83 I;  1DL6 A;  1X0T A;  3F3F C;  5C4X I;  4DK1 A;  2M6N A;  4E30 A;  4BBS I;  2DE5 A;  4QTU A;  1K73 2;  4NBF A;  3GTJ I;  2QEX 1;  2AKL A;  4TNU A;  1VQM Z;  1VQ7 Z;  5A2Q b;  1VQP 1;  1YJN Z;  3S1N I;  2R7Z I;  2OTJ 1;  1YIT Z;  1M90 1;  3G71 1;  2YAD A;  1KD1 2;  4A3F I;  3HOU I;  1PFT A;  3CC2 1;  2E2I I;  1NP6 A;  4NBG A;  2H85 A;  1R9T I;  4EWC A;  2V8J A;  1VQO Z;  2HU9 A;  4NBD A;  2DE6 A;  3CCU 1;  1QVF Z;  3HOW I;  5AN9 F;  1RQF A;  3K7A I;  3CMA 1;  2VF1 A;  1YIJ Z;  2I3C A;  4BY1 I;  1N8R 1;  1VQ8 1;  3QWU A;  4E2Z A;  4E32 A;  3CCV Z;  4RVG A;  3PO3 S;  1TFI A;  3CXC Y;  2F4O A;  2E9H A;  1RLY A;  4NB8 A;  1X3W A;  3MZK B;  1Z03 A;  3CPW Z;  1JJ2 Y;  1RO4 A;  1VQ9 1;  1TWH I;  1WII A;  4BBR I;  1QVG Y;  2OTL 1;  5IT9 f;  4HGZ A;  3GTP I;  2KI7 B;  2PM9 A;  1I50 I;  2QA4 Z;  5IT9 b;  1ZB8 A;  3F3P C;  1Q82 2;  3S1Q I;  3ESW A;  1QVF Y;  1YHQ 1;  4E33 A;  5IP7 I;  3S16 I;  2WB1 A;  1I3Q I;  3TDH B;  2G2K A;  2GTH A;  4A3D I;  3GTK I;  1KRL A;  2P3Y A;  3RZD I;  4RV9 A;  3JAM b;  3EED A;  2QA4 1;  3CD6 Z;  4S1T A;  2W03 A;  2EGT A;  2PK7 A;  2OTL Z;  2QLV B;  5LL6 f;  3G71 Z;  1VQ4 1;  1VQ6 1;  1YIT 1;  1VQN 1;  3IFU A;  1N2F A;  1ZH1 A;  5T64 A;  3HOZ I;  2JR6 A;  3CCE Z;  1M1K 1;  3OW2 Y;  3KIH A;  1N8R 2;  4RS4 A;  4RVD A;  3S1R I;  2QRC B;  2KPI A;  3CCS 1;  4E2X A;  1JJ2 Z;  4A3C I;  2YU9 I;  4A3E I;  1VQP Z;  3MZL B;  3CCS Z;  1YI2 Z;  1YJW 1;  4NOZ A;  2JUB A;  3CC7 1;  3NDJ A;  3JAM f;  3GKQ A;  1W2B Y;  2LFU A;  3CPW Y;  2JS4 A;  4MD9 A;  5C3E I;  3G6E 1;  2BJO A;  4X6A I;  4HGY A;  1VQ8 Z;  1VQN Z;  1USP A;  2K5R A;  1VQ5 1;  2JNY A;  1VQ6 Z;  3D6W A;  4NBB A;  5D1O A;  3CMA Z;  4NB9 A;  2O4H A;  4A3L I;  1NUI A;  1Z01 A;  1KD1 1;  2JA6 I;  4NBC A;  3CC4 1;  4QTT A;  1X3Z A;  4E2Y A;  1VLA A;  5FLX b;  4A3I I;  3GTG I;  1S7M A;  3FKI I;  3I07 A;  3NH5 A;  1Y1W I;  3VMG A;  3CME 1;  4A3K I;  2JA7 I;  1WCM I;  3CCM Z;  2E2J I;  2QRD B;  3CCL Z;  1TWG I;  1P9N A;  1Q81 2;  3S1M I;  3S2H I;  1VQK Z;  1YJN 1;  1NJI 2;  3EER A;  1M1K 2;  1VQL 1;  3GTM I;  1I6H I;  2QR1 B;  2QEX Z;  3BG0 B;  4A3J I;  1VQ4 Z;  3IX0 A;  3Q87 A;  3J7A 4;  1YIJ 1;  2F4M A;  2W04 A;  1VQL Z;  3CCR Z;  3CC7 Z;  2RT9 A;  1Q7Y 2;  5T6B A;  1LQL A;  4XX2 A;  1YJW Z;  4AYB A;  1VQO 1;  1YI2 1;  3I56 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...