2QRCB

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and amp
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
b'QYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 4
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qrcB01
2QLVB 3TDHB 2OOYB 2QR1B 2QRDB 2OOXB 3TE5B 2QRCB 3T4NB 2QREB
chains in the Genus database with same CATH superfamily
3CXCY 2R7ZI 1RLYA 4A3MI 1JJ2Z 4A3II 2NVXI 3HOZI 3CQZI 1S72Z 3NH8A 1QVGZ 4HGZA 2QR1B 1VQNZ 1KQSY 3H0GI 3G6E1 1YJN1 1K731 1YUAA 2BJOA 5FLXb 1Z01A 1VQMZ 3PO3I 3CCQ1 3GTLI 1YIJ1 3BG1B 1W2BY 1KC82 1RO2A 1JJ2Y 4E33A 2VPZA 3IR7A 3GTMS 2R92I 1WCMI 2V45A 2E2JI 1QVGY 3I56Z 3S1MI 3S17I 3I07A 3I55Z 3J7A4 3NH4A 2OTJ1 1USPB 2R6MA 1ZB9A 2DE5A 3EERA 4E2ZA 2P3YA 2NAPA 4E30A 5FLXf 3GCFA 4NBHA 4X6AI 2P28A 2ZAEB 1YITZ 2JA8I 2JNYA 3IX0A 3CCRZ 2VPXA 3F3FC 3FQMA 1KD12 2LIYA 3GTQI 3CC4Z 2F4MA 4MH4A 1Q861 4RV9A 1K8A1 1KC81 2PM9A 1RO4A 3S1NI 2PMZA 1WZNA 2AYDA 1YJW1 3CCMZ 3CC2Z 4RVFA 4A3DI 1VQ51 3CMEZ 1I50I 2GU2A 1Y1VS 3K7AI 3RZDI 3JAMb 1Q7Y2 2YADA 1ZH1A 1Z02A 3CC71 1TFIA 1YJNZ 3G6EZ 2O53A 3QWUA 2QREB 3CCV1 4NOZA 4DQYB 4NBFA 2V3VA 3CCQZ 2K5RA 1Q16A 1YIJZ 1KD11 1N2FA 4A3LI 5FLMI 2JA6I 1VLAA 1X0TA 1K9M2 2V8JA 2VF1A 2VPYA 3JAMf 2Q51A 2VUGA 1JWHC 4RVHA 2JMOA 2OTJZ 1PFTA 3D2LA 1SFOI 2Q4ZA 2QRCB 1Q7Y1 4A3CI 3NDIA 3CPWZ 4EWCA 3OW2Z 3S15I 5A2Qb 2I3CA 4BBRI 2V8IA 3CCJ1 4AYBA 2NVYI 1AA6A 3J80b 5AN9F 5T67A 3VB9A 3T4NB 4BY7I 1RQFA 2WAQA 3S2HI 3VMHA 2HF1A 1VQ61 1YUKA 1YHQ1 3MZKB 1M1K2 4MRIA 1K9M1 3GTJI 1YJWZ 4QTTA 3I4NI 3CCS1 5C4XI 1VQ5Z 2O4HA 5A2Qf 1QYPA 1NJI2 1I6HI 2RPRA 1K83I 2RIQA 3CD6Z 3PO2I 2H85A 3J80f 2OOXB 3CC7Z 3CCUZ 3GTMI 2W03A 1YI21 3VMGA 5C44I 4MD9A 3CCVZ 1TWGI 1ZB8A 1TWCI 3CCL1 3MONA 3Q87A 1VQKZ 4MD8A 4E2YA 4BY1I 1VQ8Z 2QKDA 1USPA 2JIPA 1FDIA 4E31A 2M6NA 3I4MI 2QA41 3S1RI 1VQ41 1Q822 2K3RA 2JR6A 4HGYA 1YJ91 2QRDB 4QTUA 5T6BA 3HOVI 1NUIA 2NVQI 1N8R2 4MXUA 3LUSA 2GTHA 4A93I 2W04A 4A3FI 2KPIA 2QEX1 5D1OB 3EEDA 2OZKA 4RVGA 2KI7B 1VQL1 1VQO1 1WIIA 3RZOI 1L1OC 4A3GI 3NH5A 3CCJZ 4DGLA 3GTPI 3MZLB 4TNUA 1Y1VI 3M4OI 1S7MA 3S1QI 3GKQA 3KIFA 3H3VJ 1VQ6Z 1YHQZ 1Y8CA 4A3BI 4RVDA 2HU9A 1Y1WI 4Y52I 1I3QI 1VQP1 3CCSZ 4BXXI 3U50C 3IFUA 1NP6A 2RT9A 1Q812 3CCE1 1N8R1 1R9TI 5LL6f 2JIMA 2IZ4A 3D6WA 2GTIA 1YI2Z 4RS4A 1TWAI 3CMA1 2RHBA 1QVFZ 3CCR1 3HOYI 2G2KA 1M902 3CXCZ 1KRLA 4NBCA 3GTOI 4E2WA 4NB8A 2R93I 4A3EI 1X3ZA 2WB1A 1TWHI 1ML8A 5IP7I 2QA4Z 1KQSZ 1VQ4Z 1QF8A 2E7ZA 1YJ9Z 2JIQA 5T64A 1VQ71 1W2BZ 2OTL1 1VQ91 3CPWY 4E2XA 3OW2Y 4NBDA 2AKLA 2JIRA 1Q811 3FQQA 3G4S1 3PO3S 3G711 3KIHA 2QEXZ 3M3YI 2EGTA 3D9XA 3TE5B 1VQLZ 1VQOZ 2V8KA 2E9HA 4DK1A 4NBEA 5IT9b 4NH1C 2JIOA 5C3EI 4NBAA 2LFUA 1Q862 1K8A2 2E2II 1M901 3VMIA 3S14I 2JUBA 2B63I 2Y0SA 1RO0A 4NBGA 1VQPZ 1QXFA 1P9NA 3CCEZ 2OOYB 4NFRA 4CL1A 1M1K1 3BG0B 5IT9f 1FDOA 2IV2X 4MD7A 3HOUI 3F3PC 2PK7A 1WW9A 1SIWA 3CMAZ 1NJI1 1DL6A 1S721 2JS4A 1VQN1 3TDHB 1WJ2A 3S2DI 3VTNA 4A3JI 2NVTI 4A3KI 3P5JB 4E32A 1VQM1 3IF8A 1LQLA 5D1OA 3GTKI 3HKZA 3I561 1VQ7Z 2IZ3A 2OTLZ 1VQ9Z 3FKII 3I551 1Q821 3G4SZ 4NB9A 3G71Z 4MONA 3GTGI 3CD61 3S16I 3NDJA 2DE6A 3CCU1 2QLVB 2F4OA 1X3WA 3J81b 2VPWA 2J6AA 2JA5I 5C4JI 1K732 2VUMI 1VQK1 1TWFI 1YIT1 1VQ81 4HH4A 4NBBA 1Z03A 3CCLZ 2JA7I 4Y7NI 2LEXA 3CC41 3HOWI 5CM2M 4XX2A 3ESWA 2RBLA 2M48A 4S1TA 5D1PA 3J81f 3CCM1 4BBSI 2YU9I 3HOXI 3CC21 1RNIA 3NFZA 5IP9I 2E2HI 3CME1 1QVFY 2DE7A
chains in the Genus database with same CATH topology
3CXCY 2R7ZI 1RLYA 4A3MI 1JJ2Z 4A3II 2NVXI 3HOZI 3CQZI 1S72Z 3NH8A 1QVGZ 4HGZA 2QR1B 1VQNZ 1KQSY 3H0GI 3G6E1 1YJN1 1K731 1YUAA 2BJOA 5FLXb 1Z01A 1VQMZ 3PO3I 3CCQ1 3GTLI 1YIJ1 3BG1B 1W2BY 1KC82 1RO2A 1JJ2Y 4E33A 3GTMS 2R92I 1WCMI 2E2JI 1QVGY 3I56Z 3S1MI 3S17I 3I07A 3I55Z 3J7A4 3NH4A 2OTJ1 1USPB 2R6MA 1ZB9A 2DE5A 3EERA 4E2ZA 2P3YA 4E30A 5FLXf 3GCFA 4NBHA 4X6AI 2P28A 2ZAEB 1YITZ 2JA8I 2JNYA 3IX0A 3CCRZ 3F3FC 3FQMA 1KD12 2LIYA 3GTQI 3CC4Z 2F4MA 4MH4A 1Q861 4RV9A 1K8A1 1KC81 2PM9A 1RO4A 3S1NI 2PMZA 1YJW1 3CCMZ 3CC2Z 4RVFA 4A3DI 1VQ51 3CMEZ 1I50I 2GU2A 1Y1VS 3K7AI 3RZDI 3JAMb 1Q7Y2 2YADA 1ZH1A 1Z02A 3CC71 1TFIA 1YJNZ 3G6EZ 2O53A 3QWUA 2QREB 3CCV1 4NOZA 4DQYB 4NBFA 3CCQZ 2K5RA 1YIJZ 1KD11 1N2FA 4A3LI 5FLMI 2JA6I 1VLAA 1X0TA 1K9M2 2V8JA 2VF1A 3JAMf 2Q51A 2VUGA 1JWHC 4RVHA 2JMOA 2OTJZ 1PFTA 1SFOI 2Q4ZA 2QRCB 1Q7Y1 4A3CI 3NDIA 3CPWZ 4EWCA 3OW2Z 3S15I 5A2Qb 2I3CA 4BBRI 2V8IA 3CCJ1 4AYBA 2NVYI 3J80b 5AN9F 5T67A 3VB9A 3T4NB 4BY7I 1RQFA 2WAQA 3S2HI 3VMHA 2HF1A 1VQ61 1YUKA 1YHQ1 3MZKB 1M1K2 4MRIA 1K9M1 3GTJI 1YJWZ 4QTTA 3I4NI 3CCS1 5C4XI 1VQ5Z 2O4HA 5A2Qf 1QYPA 1NJI2 1I6HI 2RPRA 1K83I 2RIQA 3CD6Z 3PO2I 2H85A 3J80f 2OOXB 3CC7Z 3CCUZ 3GTMI 2W03A 1YI21 3VMGA 5C44I 4MD9A 3CCVZ 1TWGI 1ZB8A 1TWCI 3CCL1 3MONA 3Q87A 1VQKZ 4MD8A 4E2YA 4BY1I 1VQ8Z 2QKDA 1USPA 4E31A 2M6NA 3I4MI 2QA41 3S1RI 1VQ41 1Q822 2K3RA 2JR6A 4HGYA 1YJ91 2QRDB 4QTUA 5T6BA 3HOVI 1NUIA 2NVQI 1N8R2 4MXUA 3LUSA 2GTHA 4A93I 2W04A 4A3FI 2KPIA 2QEX1 5D1OB 3EEDA 2OZKA 4RVGA 2KI7B 1VQL1 1VQO1 1WIIA 3RZOI 1L1OC 4A3GI 3NH5A 3CCJZ 4DGLA 3GTPI 3MZLB 4TNUA 1Y1VI 3M4OI 1S7MA 3S1QI 3GKQA 3KIFA 3H3VJ 1VQ6Z 1YHQZ 4A3BI 4RVDA 2HU9A 1Y1WI 4Y52I 1I3QI 1VQP1 3CCSZ 4BXXI 3U50C 3IFUA 1NP6A 2RT9A 1Q812 3CCE1 1N8R1 1R9TI 5LL6f 2IZ4A 3D6WA 2GTIA 1YI2Z 4RS4A 1TWAI 3CMA1 2RHBA 1QVFZ 3CCR1 3HOYI 2G2KA 1M902 3CXCZ 1KRLA 4NBCA 3GTOI 4E2WA 4NB8A 2R93I 4A3EI 1X3ZA 2WB1A 1TWHI 1ML8A 5IP7I 2QA4Z 1KQSZ 1VQ4Z 1QF8A 1YJ9Z 5T64A 1VQ71 1W2BZ 2OTL1 1VQ91 3CPWY 4E2XA 3OW2Y 4NBDA 2AKLA 3PO3S 1Q811 3FQQA 3G4S1 3G711 3KIHA 2QEXZ 3M3YI 2EGTA 3D9XA 3TE5B 1VQLZ 1VQOZ 2V8KA 2E9HA 4DK1A 4NBEA 5IT9b 4NH1C 5C3EI 4NBAA 2LFUA 1Q862 1K8A2 2E2II 1M901 3VMIA 3S14I 2JUBA 2B63I 2Y0SA 1RO0A 4NBGA 1VQPZ 1P9NA 3CCEZ 2OOYB 4NFRA 4CL1A 1M1K1 3BG0B 5IT9f 4MD7A 3HOUI 3F3PC 2PK7A 1WW9A 3CMAZ 1NJI1 1DL6A 1S721 2JS4A 1VQN1 3TDHB 3S2DI 3VTNA 4A3JI 2NVTI 4A3KI 3P5JB 4E32A 1VQM1 3IF8A 1LQLA 5D1OA 3GTKI 3HKZA 3I561 1VQ7Z 2IZ3A 2OTLZ 1VQ9Z 3FKII 3I551 1Q821 3G4SZ 4NB9A 3G71Z 4MONA 3GTGI 3CD61 3S16I 3NDJA 2DE6A 3CCU1 2QLVB 2F4OA 1X3WA 3J81b 2J6AA 2JA5I 5C4JI 1K732 2VUMI 1VQK1 1TWFI 1YIT1 1VQ81 4HH4A 4NBBA 1Z03A 3CCLZ 2JA7I 4Y7NI 3CC41 3HOWI 5CM2M 4XX2A 3ESWA 2RBLA 2M48A 4S1TA 5D1PA 3J81f 3CCM1 4BBSI 2YU9I 3HOXI 3CC21 1RNIA 3NFZA 5IP9I 2E2HI 3CME1 1QVFY 2DE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QLV B;  3TDH B;  2OOY B;  2QR1 B;  2QRD B;  2OOX B;  3TE5 B;  2QRC B;  3T4N B;  2QRE B; 
#chains in the Genus database with same CATH topology
 3CXC Y;  2R7Z I;  1RLY A;  4A3M I;  1JJ2 Z;  4A3I I;  2NVX I;  3HOZ I;  3CQZ I;  1S72 Z;  3NH8 A;  1QVG Z;  4HGZ A;  2QR1 B;  1VQN Z;  1KQS Y;  3H0G I;  3G6E 1;  1YJN 1;  1K73 1;  1YUA A;  2BJO A;  5FLX b;  1Z01 A;  1VQM Z;  3PO3 I;  3CCQ 1;  3GTL I;  1YIJ 1;  3BG1 B;  1W2B Y;  1KC8 2;  1RO2 A;  1JJ2 Y;  4E33 A;  2VPZ A;  3IR7 A;  3GTM S;  2R92 I;  1WCM I;  2V45 A;  2E2J I;  1QVG Y;  3I56 Z;  3S1M I;  3S17 I;  3I07 A;  3I55 Z;  3J7A 4;  3NH4 A;  2OTJ 1;  1USP B;  2R6M A;  1ZB9 A;  2DE5 A;  3EER A;  4E2Z A;  2P3Y A;  2NAP A;  4E30 A;  5FLX f;  3GCF A;  4NBH A;  4X6A I;  2P28 A;  2ZAE B;  1YIT Z;  2JA8 I;  2JNY A;  3IX0 A;  3CCR Z;  2VPX A;  3F3F C;  3FQM A;  1KD1 2;  2LIY A;  3GTQ I;  3CC4 Z;  2F4M A;  4MH4 A;  1Q86 1;  4RV9 A;  1K8A 1;  1KC8 1;  2PM9 A;  1RO4 A;  3S1N I;  2PMZ A;  1WZN A;  2AYD A;  1YJW 1;  3CCM Z;  3CC2 Z;  4RVF A;  4A3D I;  1VQ5 1;  3CME Z;  1I50 I;  2GU2 A;  1Y1V S;  3K7A I;  3RZD I;  3JAM b;  1Q7Y 2;  2YAD A;  1ZH1 A;  1Z02 A;  3CC7 1;  1TFI A;  1YJN Z;  3G6E Z;  2O53 A;  3QWU A;  2QRE B;  3CCV 1;  4NOZ A;  4DQY B;  4NBF A;  2V3V A;  3CCQ Z;  2K5R A;  1Q16 A;  1YIJ Z;  1KD1 1;  1N2F A;  4A3L I;  5FLM I;  2JA6 I;  1VLA A;  1X0T A;  1K9M 2;  2V8J A;  2VF1 A;  2VPY A;  3JAM f;  2Q51 A;  2VUG A;  1JWH C;  4RVH A;  2JMO A;  2OTJ Z;  1PFT A;  3D2L A;  1SFO I;  2Q4Z A;  2QRC B;  1Q7Y 1;  4A3C I;  3NDI A;  3CPW Z;  4EWC A;  3OW2 Z;  3S15 I;  5A2Q b;  2I3C A;  4BBR I;  2V8I A;  3CCJ 1;  4AYB A;  2NVY I;  1AA6 A;  3J80 b;  5AN9 F;  5T67 A;  3VB9 A;  3T4N B;  4BY7 I;  1RQF A;  2WAQ A;  3S2H I;  3VMH A;  2HF1 A;  1VQ6 1;  1YUK A;  1YHQ 1;  3MZK B;  1M1K 2;  4MRI A;  1K9M 1;  3GTJ I;  1YJW Z;  4QTT A;  3I4N I;  3CCS 1;  5C4X I;  1VQ5 Z;  2O4H A;  5A2Q f;  1QYP A;  1NJI 2;  1I6H I;  2RPR A;  1K83 I;  2RIQ A;  3CD6 Z;  3PO2 I;  2H85 A;  3J80 f;  2OOX B;  3CC7 Z;  3CCU Z;  3GTM I;  2W03 A;  1YI2 1;  3VMG A;  5C44 I;  4MD9 A;  3CCV Z;  1TWG I;  1ZB8 A;  1TWC I;  3CCL 1;  3MON A;  3Q87 A;  1VQK Z;  4MD8 A;  4E2Y A;  4BY1 I;  1VQ8 Z;  2QKD A;  1USP A;  2JIP A;  1FDI A;  4E31 A;  2M6N A;  3I4M I;  2QA4 1;  3S1R I;  1VQ4 1;  1Q82 2;  2K3R A;  2JR6 A;  4HGY A;  1YJ9 1;  2QRD B;  4QTU A;  5T6B A;  3HOV I;  1NUI A;  2NVQ I;  1N8R 2;  4MXU A;  3LUS A;  2GTH A;  4A93 I;  2W04 A;  4A3F I;  2KPI A;  2QEX 1;  5D1O B;  3EED A;  2OZK A;  4RVG A;  2KI7 B;  1VQL 1;  1VQO 1;  1WII A;  3RZO I;  1L1O C;  4A3G I;  3NH5 A;  3CCJ Z;  4DGL A;  3GTP I;  3MZL B;  4TNU A;  1Y1V I;  3M4O I;  1S7M A;  3S1Q I;  3GKQ A;  3KIF A;  3H3V J;  1VQ6 Z;  1YHQ Z;  1Y8C A;  4A3B I;  4RVD A;  2HU9 A;  1Y1W I;  4Y52 I;  1I3Q I;  1VQP 1;  3CCS Z;  4BXX I;  3U50 C;  3IFU A;  1NP6 A;  2RT9 A;  1Q81 2;  3CCE 1;  1N8R 1;  1R9T I;  5LL6 f;  2JIM A;  2IZ4 A;  3D6W A;  2GTI A;  1YI2 Z;  4RS4 A;  1TWA I;  3CMA 1;  2RHB A;  1QVF Z;  3CCR 1;  3HOY I;  2G2K A;  1M90 2;  3CXC Z;  1KRL A;  4NBC A;  3GTO I;  4E2W A;  4NB8 A;  2R93 I;  4A3E I;  1X3Z A;  2WB1 A;  1TWH I;  1ML8 A;  5IP7 I;  2QA4 Z;  1KQS Z;  1VQ4 Z;  1QF8 A;  2E7Z A;  1YJ9 Z;  2JIQ A;  5T64 A;  1VQ7 1;  1W2B Z;  2OTL 1;  1VQ9 1;  3CPW Y;  4E2X A;  3OW2 Y;  4NBD A;  2AKL A;  2JIR A;  1Q81 1;  3FQQ A;  3G4S 1;  3PO3 S;  3G71 1;  3KIH A;  2QEX Z;  3M3Y I;  2EGT A;  3D9X A;  3TE5 B;  1VQL Z;  1VQO Z;  2V8K A;  2E9H A;  4DK1 A;  4NBE A;  5IT9 b;  4NH1 C;  2JIO A;  5C3E I;  4NBA A;  2LFU A;  1Q86 2;  1K8A 2;  2E2I I;  1M90 1;  3VMI A;  3S14 I;  2JUB A;  2B63 I;  2Y0S A;  1RO0 A;  4NBG A;  1VQP Z;  1QXF A;  1P9N A;  3CCE Z;  2OOY B;  4NFR A;  4CL1 A;  1M1K 1;  3BG0 B;  5IT9 f;  1FDO A;  2IV2 X;  4MD7 A;  3HOU I;  3F3P C;  2PK7 A;  1WW9 A;  1SIW A;  3CMA Z;  1NJI 1;  1DL6 A;  1S72 1;  2JS4 A;  1VQN 1;  3TDH B;  1WJ2 A;  3S2D I;  3VTN A;  4A3J I;  2NVT I;  4A3K I;  3P5J B;  4E32 A;  1VQM 1;  3IF8 A;  1LQL A;  5D1O A;  3GTK I;  3HKZ A;  3I56 1;  1VQ7 Z;  2IZ3 A;  2OTL Z;  1VQ9 Z;  3FKI I;  3I55 1;  1Q82 1;  3G4S Z;  4NB9 A;  3G71 Z;  4MON A;  3GTG I;  3CD6 1;  3S16 I;  3NDJ A;  2DE6 A;  3CCU 1;  2QLV B;  2F4O A;  1X3W A;  3J81 b;  2VPW A;  2J6A A;  2JA5 I;  5C4J I;  1K73 2;  2VUM I;  1VQK 1;  1TWF I;  1YIT 1;  1VQ8 1;  4HH4 A;  4NBB A;  1Z03 A;  3CCL Z;  2JA7 I;  4Y7N I;  2LEX A;  3CC4 1;  3HOW I;  5CM2 M;  4XX2 A;  3ESW A;  2RBL A;  2M48 A;  4S1T A;  5D1P A;  3J81 f;  3CCM 1;  4BBS I;  2YU9 I;  3HOX I;  3CC2 1;  1RNI A;  3NFZ A;  5IP9 I;  2E2H I;  3CME 1;  1QVF Y;  2DE7 A; 
#chains in the Genus database with same CATH homology
 3CXC Y;  2R7Z I;  1RLY A;  4A3M I;  1JJ2 Z;  4A3I I;  2NVX I;  3HOZ I;  3CQZ I;  1S72 Z;  3NH8 A;  1QVG Z;  4HGZ A;  2QR1 B;  1VQN Z;  1KQS Y;  3H0G I;  3G6E 1;  1YJN 1;  1K73 1;  1YUA A;  2BJO A;  5FLX b;  1Z01 A;  1VQM Z;  3PO3 I;  3CCQ 1;  3GTL I;  1YIJ 1;  3BG1 B;  1W2B Y;  1KC8 2;  1RO2 A;  1JJ2 Y;  4E33 A;  3GTM S;  2R92 I;  1WCM I;  2E2J I;  1QVG Y;  3I56 Z;  3S1M I;  3S17 I;  3I07 A;  3I55 Z;  3J7A 4;  3NH4 A;  2OTJ 1;  1USP B;  2R6M A;  1ZB9 A;  2DE5 A;  3EER A;  4E2Z A;  2P3Y A;  4E30 A;  5FLX f;  3GCF A;  4NBH A;  4X6A I;  2P28 A;  2ZAE B;  1YIT Z;  2JA8 I;  2JNY A;  3IX0 A;  3CCR Z;  3F3F C;  3FQM A;  1KD1 2;  2LIY A;  3GTQ I;  3CC4 Z;  2F4M A;  4MH4 A;  1Q86 1;  4RV9 A;  1K8A 1;  1KC8 1;  2PM9 A;  1RO4 A;  3S1N I;  2PMZ A;  1YJW 1;  3CCM Z;  3CC2 Z;  4RVF A;  4A3D I;  1VQ5 1;  3CME Z;  1I50 I;  2GU2 A;  1Y1V S;  3K7A I;  3RZD I;  3JAM b;  1Q7Y 2;  2YAD A;  1ZH1 A;  1Z02 A;  3CC7 1;  1TFI A;  1YJN Z;  3G6E Z;  2O53 A;  3QWU A;  2QRE B;  3CCV 1;  4NOZ A;  4DQY B;  4NBF A;  3CCQ Z;  2K5R A;  1YIJ Z;  1KD1 1;  1N2F A;  4A3L I;  5FLM I;  2JA6 I;  1VLA A;  1X0T A;  1K9M 2;  2V8J A;  2VF1 A;  3JAM f;  2Q51 A;  2VUG A;  1JWH C;  4RVH A;  2JMO A;  2OTJ Z;  1PFT A;  1SFO I;  2Q4Z A;  2QRC B;  1Q7Y 1;  4A3C I;  3NDI A;  3CPW Z;  4EWC A;  3OW2 Z;  3S15 I;  5A2Q b;  2I3C A;  4BBR I;  2V8I A;  3CCJ 1;  4AYB A;  2NVY I;  3J80 b;  5AN9 F;  5T67 A;  3VB9 A;  3T4N B;  4BY7 I;  1RQF A;  2WAQ A;  3S2H I;  3VMH A;  2HF1 A;  1VQ6 1;  1YUK A;  1YHQ 1;  3MZK B;  1M1K 2;  4MRI A;  1K9M 1;  3GTJ I;  1YJW Z;  4QTT A;  3I4N I;  3CCS 1;  5C4X I;  1VQ5 Z;  2O4H A;  5A2Q f;  1QYP A;  1NJI 2;  1I6H I;  2RPR A;  1K83 I;  2RIQ A;  3CD6 Z;  3PO2 I;  2H85 A;  3J80 f;  2OOX B;  3CC7 Z;  3CCU Z;  3GTM I;  2W03 A;  1YI2 1;  3VMG A;  5C44 I;  4MD9 A;  3CCV Z;  1TWG I;  1ZB8 A;  1TWC I;  3CCL 1;  3MON A;  3Q87 A;  1VQK Z;  4MD8 A;  4E2Y A;  4BY1 I;  1VQ8 Z;  2QKD A;  1USP A;  4E31 A;  2M6N A;  3I4M I;  2QA4 1;  3S1R I;  1VQ4 1;  1Q82 2;  2K3R A;  2JR6 A;  4HGY A;  1YJ9 1;  2QRD B;  4QTU A;  5T6B A;  3HOV I;  1NUI A;  2NVQ I;  1N8R 2;  4MXU A;  3LUS A;  2GTH A;  4A93 I;  2W04 A;  4A3F I;  2KPI A;  2QEX 1;  5D1O B;  3EED A;  2OZK A;  4RVG A;  2KI7 B;  1VQL 1;  1VQO 1;  1WII A;  3RZO I;  1L1O C;  4A3G I;  3NH5 A;  3CCJ Z;  4DGL A;  3GTP I;  3MZL B;  4TNU A;  1Y1V I;  3M4O I;  1S7M A;  3S1Q I;  3GKQ A;  3KIF A;  3H3V J;  1VQ6 Z;  1YHQ Z;  4A3B I;  4RVD A;  2HU9 A;  1Y1W I;  4Y52 I;  1I3Q I;  1VQP 1;  3CCS Z;  4BXX I;  3U50 C;  3IFU A;  1NP6 A;  2RT9 A;  1Q81 2;  3CCE 1;  1N8R 1;  1R9T I;  5LL6 f;  2IZ4 A;  3D6W A;  2GTI A;  1YI2 Z;  4RS4 A;  1TWA I;  3CMA 1;  2RHB A;  1QVF Z;  3CCR 1;  3HOY I;  2G2K A;  1M90 2;  3CXC Z;  1KRL A;  4NBC A;  3GTO I;  4E2W A;  4NB8 A;  2R93 I;  4A3E I;  1X3Z A;  2WB1 A;  1TWH I;  1ML8 A;  5IP7 I;  2QA4 Z;  1KQS Z;  1VQ4 Z;  1QF8 A;  1YJ9 Z;  5T64 A;  1VQ7 1;  1W2B Z;  2OTL 1;  1VQ9 1;  3CPW Y;  4E2X A;  3OW2 Y;  4NBD A;  2AKL A;  3PO3 S;  1Q81 1;  3FQQ A;  3G4S 1;  3G71 1;  3KIH A;  2QEX Z;  3M3Y I;  2EGT A;  3D9X A;  3TE5 B;  1VQL Z;  1VQO Z;  2V8K A;  2E9H A;  4DK1 A;  4NBE A;  5IT9 b;  4NH1 C;  5C3E I;  4NBA A;  2LFU A;  1Q86 2;  1K8A 2;  2E2I I;  1M90 1;  3VMI A;  3S14 I;  2JUB A;  2B63 I;  2Y0S A;  1RO0 A;  4NBG A;  1VQP Z;  1P9N A;  3CCE Z;  2OOY B;  4NFR A;  4CL1 A;  1M1K 1;  3BG0 B;  5IT9 f;  4MD7 A;  3HOU I;  3F3P C;  2PK7 A;  1WW9 A;  3CMA Z;  1NJI 1;  1DL6 A;  1S72 1;  2JS4 A;  1VQN 1;  3TDH B;  3S2D I;  3VTN A;  4A3J I;  2NVT I;  4A3K I;  3P5J B;  4E32 A;  1VQM 1;  3IF8 A;  1LQL A;  5D1O A;  3GTK I;  3HKZ A;  3I56 1;  1VQ7 Z;  2IZ3 A;  2OTL Z;  1VQ9 Z;  3FKI I;  3I55 1;  1Q82 1;  3G4S Z;  4NB9 A;  3G71 Z;  4MON A;  3GTG I;  3CD6 1;  3S16 I;  3NDJ A;  2DE6 A;  3CCU 1;  2QLV B;  2F4O A;  1X3W A;  3J81 b;  2J6A A;  2JA5 I;  5C4J I;  1K73 2;  2VUM I;  1VQK 1;  1TWF I;  1YIT 1;  1VQ8 1;  4HH4 A;  4NBB A;  1Z03 A;  3CCL Z;  2JA7 I;  4Y7N I;  3CC4 1;  3HOW I;  5CM2 M;  4XX2 A;  3ESW A;  2RBL A;  2M48 A;  4S1T A;  5D1P A;  3J81 f;  3CCM 1;  4BBS I;  2YU9 I;  3HOX I;  3CC2 1;  1RNI A;  3NFZ A;  5IP9 I;  2E2H I;  3CME 1;  1QVF Y;  2DE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...