2QRCB

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and amp
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
91
structure length
91
Chain Sequence
b'QYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 4
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04739 AMPKBI 5'-AMP-activated protein kinase beta subunit, interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.290 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2qrcB01
2QREB 2QRDB 2QLVB 2OOXB 3TDHB 3TE5B 3T4NB 2OOYB 2QR1B 2QRCB
chains in the Genus database with same CATH superfamily
1VQ41 4BBRI 1Q862 2AYDA 1USPA 3CCV1 3ESWA 2Y0SA 1YJW1 1JWHC 3MONA 3VB9A 1YUKA 1I3QI 3GTJI 1KC81 5C44I 1YJN1 3T4NB 4BXXI 1Z01A 1VQ7Z 2OTJZ 1K9M2 1FDOA 2YADA 3GKQA 4QTTA 1Q861 5C3EI 1SIWA 4BBSI 4NFRA 3CC71 1Q822 2V8KA 3MZLB 1VQL1 1ZH1A 2IZ3A 2VPWA 1YIJ1 3CCJ1 1Y1WI 2WB1A 3GTQI 2OOXB 2Q4ZA 4RV9A 1K9M1 1TWHI 2OTL1 1NUIA 1ZB9A 1VQ91 3KIHA 3HOYI 1WJ2A 1ZB8A 3VMGA 4A3CI 1NP6A 3I56Z 2M6NA 1VLAA 3CC4Z 1KRLA 2ZAEB 3HKZA 5CM2M 3J80f 2PM9A 2B63I 1Q7Y2 2QEX1 5C4JI 2GTIA 1VQ8Z 2E9HA 3NH4A 1X0TA 3S16I 1WCMI 5AN9F 3CME1 1KQSZ 3CCLZ 1VQNZ 4NB8A 1VQ61 4NBCA 4MONA 5C4XI 1Q7Y1 1TWCI 2KI7B 2K3RA 5D1OA 3D6WA 4MD9A 2PMZA 2O4HA 4NBHA 1QVGZ 3IX0A 1K731 4AYBA 2JA7I 5D1OB 2R93I 2F4MA 3IFUA 3G4SZ 1YIT1 1M1K2 4HGZA 3CXCY 4A3KI 3TE5B 2RBLA 1N2FA 4XX2A 2JIRA 2RHBA 2NVQI 1VQMZ 1X3ZA 2V45A 3QWUA 3J80b 3CD6Z 2RIQA 3CMA1 4A3BI 3H0GI 1Q812 2JS4A 3G6E1 1S72Z 2LEXA 3J81f 3CCEZ 3KIFA 3GTMS 4NBFA 4S1TA 3S1RI 1M902 3F3FC 3HOZI 3CQZI 2JA5I 3GCFA 2JMOA 3Q87A 1YI21 1N8R2 1Q811 1USPB 3I4NI 4E33A 1VQOZ 2IZ4A 1WIIA 4CL1A 1M901 4NBGA 5FLXf 1JJ2Z 3CPWZ 2VUMI 4E2WA 1YHQZ 3JAMf 1TWFI 2G2KA 1VQP1 4NBDA 3CCMZ 2QKDA 4A3DI 1WZNA 1VQ5Z 2H85A 3D2LA 2JNYA 4NB9A 2V3VA 1Q821 3GTMI 3PO3S 4Y7NI 4DGLA 1K8A2 1I6HI 5FLMI 3CCUZ 1VQ71 3J81b 2R6MA 2OTJ1 2VPXA 3FQMA 2P28A 3RZDI 2KPIA 2JIOA 1ML8A 1JJ2Y 2R7ZI 2LIYA 3CPWY 2E2HI 5IP7I 2NVTI 1QVFZ 5D1PA 4A3II 1RQFA 2NVXI 2JIPA 2PK7A 3M4OI 1NJI2 1RNIA 2QA4Z 3S2DI 2LFUA 3OW2Z 2EGTA 1W2BZ 3CCRZ 4NBEA 1VQKZ 1YJ9Z 4RVDA 4HGYA 5FLXb 3J7A4 3U50C 2VF1A 1RO0A 3S1MI 3I561 2R92I 3CCQZ 1Z03A 2OOYB 3CC41 3G71Z 3BG1B 3PO3I 3NDIA 2RPRA 4A3GI 4HH4A 2VUGA 1PFTA 4E30A 2JA6I 4EWCA 3CC2Z 1KD12 3I55Z 3CCSZ 5T64A 1VQ81 3HOUI 1Q16A 4A3JI 4X6AI 3NFZA 1AA6A 3CCL1 3S17I 1VQN1 3OW2Y 1W2BY 4MRIA 2QLVB 1VQ4Z 1M1K1 1SFOI 1KQSY 3H3VJ 1K83I 3GTOI 3CCVZ 1YJWZ 1QVGY 2OZKA 3I4MI 3TDHB 3G4S1 1YJNZ 3BG0B 3I07A 3PO2I 4A3MI 1L1OC 3GTLI 3CC7Z 1QYPA 4A3FI 2W03A 1VQM1 3IF8A 2IV2X 1VQLZ 4E2XA 2Q51A 1YIJZ 4A3LI 2K5RA 3CCJZ 1KC82 2E2JI 2V8JA 3CD61 5T67A 1WW9A 1N8R1 2OTLZ 5IT9f 4E32A 5LL6f 1VQ9Z 1S721 2HU9A 3HOWI 3F3PC 4RVGA 3CCE1 1RO4A 1LQLA 3S15I 2DE7A 4MXUA 4QTUA 4DK1A 2JIMA 2VPZA 3GTGI 2M48A 1RLYA 3GTKI 1YUAA 4RVFA 1VQO1 2W04A 2VPYA 4RS4A 3VMIA 3P5JB 2QEXZ 2V8IA 3RZOI 3NDJA 1I50I 2F4OA 2QRCB 3VTNA 1YHQ1 4E31A 2JIQA 2RT9A 3CMEZ 3CCM1 1K8A1 1VQ6Z 1VQ51 2GTHA 1Y1VS 1Y8CA 1TWAI 3M3YI 3S1QI 4A3EI 3HOVI 4DQYB 2E7ZA 3MZKB 2I3CA 1Z02A 2DE5A 2JUBA 2P3YA 4E2YA 1P9NA 2QR1B 2JR6A 3CXCZ 5IT9b 1NJI1 3CCU1 3JAMb 3S2HI 1YITZ 2E2II 5A2Qf 4BY7I 1QXFA 1TWGI 3NH8A 4NBAA 5IP9I 1DL6A 1K732 4NBBA 4RVHA 3NH5A 2JA8I 3IR7A 2HF1A 1QVFY 2QA41 3HOXI 3CMAZ 2YU9I 1VQK1 3CCR1 3VMHA 1YJ91 3G6EZ 4MD7A 2GU2A 2BJOA 1Y1VI 4TNUA 3K7AI 3FQQA 3EEDA 1KD11 4NOZA 1R9TI 1S7MA 2DE6A 1X3WA 3CCQ1 2AKLA 4BY1I 3G711 3S14I 2J6AA 4MD8A 1YI2Z 2QRDB 3GTPI 4Y52I 2O53A 2QREB 3FKII 2NAPA 5T6BA 3CC21 1QF8A 3I551 3CCS1 4MH4A 2WAQA 4NH1C 1FDIA 3EERA 3D9XA 3S1NI 1TFIA 1RO2A 5A2Qb 1VQPZ 2NVYI 3LUSA 4A93I 4E2ZA
chains in the Genus database with same CATH topology
1VQ41 4BBRI 1Q862 1USPA 3CCV1 3ESWA 2Y0SA 1YJW1 1JWHC 3MONA 3VB9A 1YUKA 1I3QI 3GTJI 1KC81 5C44I 1YJN1 3T4NB 4BXXI 1Z01A 1VQ7Z 2OTJZ 1K9M2 2YADA 3GKQA 4QTTA 1Q861 4BBSI 5C3EI 4NFRA 3CC71 1Q822 2V8KA 3MZLB 1VQL1 1ZH1A 2IZ3A 1YIJ1 3CCJ1 1Y1WI 2WB1A 3GTQI 2OOXB 2Q4ZA 4RV9A 1K9M1 1TWHI 2OTL1 1NUIA 1ZB9A 1VQ91 3KIHA 3HOYI 1ZB8A 3VMGA 4A3CI 1NP6A 3I56Z 2M6NA 1VLAA 3CC4Z 1KRLA 2ZAEB 3HKZA 5CM2M 3J80f 2PM9A 2B63I 1Q7Y2 2QEX1 5C4JI 2GTIA 1VQ8Z 2E9HA 3NH4A 1X0TA 3S16I 1WCMI 5AN9F 3CME1 1KQSZ 3CCLZ 1VQNZ 4NB8A 1VQ61 4NBCA 4MONA 5C4XI 1Q7Y1 2KI7B 1TWCI 2K3RA 5D1OA 3D6WA 4MD9A 2PMZA 2O4HA 4NBHA 1QVGZ 3IX0A 1K731 4AYBA 2JA7I 5D1OB 2R93I 2F4MA 3IFUA 3G4SZ 1YIT1 1M1K2 4HGZA 3CXCY 4A3KI 3TE5B 2RBLA 1N2FA 4XX2A 2RHBA 2NVQI 1VQMZ 1X3ZA 3QWUA 3J80b 3CD6Z 2RIQA 3CMA1 4A3BI 3H0GI 1Q812 2JS4A 3G6E1 1S72Z 3J81f 3CCEZ 3KIFA 3GTMS 4NBFA 4S1TA 3S1RI 1M902 3F3FC 3HOZI 3CQZI 2JA5I 3GCFA 2JMOA 3Q87A 1YI21 1N8R2 1Q811 1USPB 3I4NI 4E33A 1VQOZ 2IZ4A 1WIIA 4CL1A 1M901 4NBGA 5FLXf 1JJ2Z 3CPWZ 2VUMI 4E2WA 1YHQZ 3JAMf 1TWFI 2G2KA 1VQP1 4NBDA 3CCMZ 2QKDA 4A3DI 1VQ5Z 2H85A 2JNYA 4NB9A 1Q821 3GTMI 3PO3S 4Y7NI 4DGLA 1K8A2 1I6HI 5FLMI 3CCUZ 1VQ71 3J81b 2R6MA 2OTJ1 3FQMA 2P28A 3RZDI 2KPIA 2R7ZI 1ML8A 1JJ2Y 2LIYA 3CPWY 2E2HI 5IP7I 2NVTI 1QVFZ 5D1PA 4A3II 1RQFA 2NVXI 2PK7A 3M4OI 1NJI2 1RNIA 2QA4Z 3S2DI 2LFUA 3OW2Z 2EGTA 1W2BZ 3CCRZ 4NBEA 1VQKZ 1YJ9Z 4RVDA 4HGYA 5FLXb 3J7A4 3U50C 2VF1A 1RO0A 3S1MI 3I561 2R92I 3CCQZ 1Z03A 2OOYB 3CC41 3G71Z 3BG1B 3PO3I 3NDIA 2RPRA 4A3GI 4HH4A 2VUGA 1PFTA 4E30A 2JA6I 4EWCA 3CC2Z 1KD12 3I55Z 3CCSZ 5T64A 1VQ81 3HOUI 4A3JI 4X6AI 3NFZA 3CCL1 3S17I 1VQN1 3OW2Y 1W2BY 4MRIA 2QLVB 1VQ4Z 1M1K1 1SFOI 1KQSY 3H3VJ 1K83I 3GTOI 3CCVZ 1YJWZ 1QVGY 2OZKA 3I4MI 3TDHB 3G4S1 1YJNZ 3BG0B 3I07A 3PO2I 4A3MI 1L1OC 3GTLI 3CC7Z 1QYPA 4A3FI 2W03A 1VQM1 3IF8A 1VQLZ 4E2XA 2Q51A 1YIJZ 4A3LI 2K5RA 3CCJZ 1KC82 2E2JI 2V8JA 3CD61 5T67A 1WW9A 1N8R1 2OTLZ 5IT9f 4E32A 5LL6f 1VQ9Z 1S721 2HU9A 3HOWI 3F3PC 4RVGA 3CCE1 1RO4A 1LQLA 3S15I 2DE7A 4MXUA 4QTUA 4DK1A 3GTGI 2M48A 1RLYA 3GTKI 1YUAA 4RVFA 1VQO1 2W04A 4RS4A 3VMIA 3P5JB 2QEXZ 2V8IA 3RZOI 3NDJA 1I50I 2F4OA 2QRCB 3VTNA 1YHQ1 4E31A 2RT9A 3CMEZ 3CCM1 1K8A1 1VQ6Z 1VQ51 1Y1VS 2GTHA 1TWAI 3M3YI 3S1QI 4A3EI 3HOVI 4DQYB 3MZKB 2I3CA 1Z02A 2DE5A 2JUBA 2P3YA 4E2YA 1P9NA 2QR1B 2JR6A 3CXCZ 5IT9b 1NJI1 3CCU1 3JAMb 3S2HI 1YITZ 2E2II 5A2Qf 4BY7I 1TWGI 3NH8A 4NBAA 5IP9I 1DL6A 1K732 4NBBA 4RVHA 3NH5A 2JA8I 2HF1A 1QVFY 2QA41 3HOXI 3CMAZ 2YU9I 1VQK1 3CCR1 3VMHA 1YJ91 3G6EZ 4MD7A 2GU2A 2BJOA 1Y1VI 4TNUA 3K7AI 3FQQA 3EEDA 1KD11 4NOZA 1R9TI 1S7MA 2DE6A 1X3WA 3CCQ1 2AKLA 4BY1I 3G711 3S14I 2J6AA 4MD8A 1YI2Z 2QRDB 3GTPI 4Y52I 2O53A 2QREB 3FKII 5T6BA 3CC21 1QF8A 3I551 3CCS1 4MH4A 2WAQA 4NH1C 3EERA 3D9XA 3S1NI 1TFIA 1RO2A 5A2Qb 1VQPZ 2NVYI 3LUSA 4A93I 4E2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRE B;  2QRD B;  2QLV B;  2OOX B;  3TDH B;  3TE5 B;  3T4N B;  2OOY B;  2QR1 B;  2QRC B; 
#chains in the Genus database with same CATH topology
 1VQ4 1;  4BBR I;  1Q86 2;  2AYD A;  1USP A;  3CCV 1;  3ESW A;  2Y0S A;  1YJW 1;  1JWH C;  3MON A;  3VB9 A;  1YUK A;  1I3Q I;  3GTJ I;  1KC8 1;  5C44 I;  1YJN 1;  3T4N B;  4BXX I;  1Z01 A;  1VQ7 Z;  2OTJ Z;  1K9M 2;  1FDO A;  2YAD A;  3GKQ A;  4QTT A;  1Q86 1;  5C3E I;  1SIW A;  4BBS I;  4NFR A;  3CC7 1;  1Q82 2;  2V8K A;  3MZL B;  1VQL 1;  1ZH1 A;  2IZ3 A;  2VPW A;  1YIJ 1;  3CCJ 1;  1Y1W I;  2WB1 A;  3GTQ I;  2OOX B;  2Q4Z A;  4RV9 A;  1K9M 1;  1TWH I;  2OTL 1;  1NUI A;  1ZB9 A;  1VQ9 1;  3KIH A;  3HOY I;  1WJ2 A;  1ZB8 A;  3VMG A;  4A3C I;  1NP6 A;  3I56 Z;  2M6N A;  1VLA A;  3CC4 Z;  1KRL A;  2ZAE B;  3HKZ A;  5CM2 M;  3J80 f;  2PM9 A;  2B63 I;  1Q7Y 2;  2QEX 1;  5C4J I;  2GTI A;  1VQ8 Z;  2E9H A;  3NH4 A;  1X0T A;  3S16 I;  1WCM I;  5AN9 F;  3CME 1;  1KQS Z;  3CCL Z;  1VQN Z;  4NB8 A;  1VQ6 1;  4NBC A;  4MON A;  5C4X I;  1Q7Y 1;  1TWC I;  2KI7 B;  2K3R A;  5D1O A;  3D6W A;  4MD9 A;  2PMZ A;  2O4H A;  4NBH A;  1QVG Z;  3IX0 A;  1K73 1;  4AYB A;  2JA7 I;  5D1O B;  2R93 I;  2F4M A;  3IFU A;  3G4S Z;  1YIT 1;  1M1K 2;  4HGZ A;  3CXC Y;  4A3K I;  3TE5 B;  2RBL A;  1N2F A;  4XX2 A;  2JIR A;  2RHB A;  2NVQ I;  1VQM Z;  1X3Z A;  2V45 A;  3QWU A;  3J80 b;  3CD6 Z;  2RIQ A;  3CMA 1;  4A3B I;  3H0G I;  1Q81 2;  2JS4 A;  3G6E 1;  1S72 Z;  2LEX A;  3J81 f;  3CCE Z;  3KIF A;  3GTM S;  4NBF A;  4S1T A;  3S1R I;  1M90 2;  3F3F C;  3HOZ I;  3CQZ I;  2JA5 I;  3GCF A;  2JMO A;  3Q87 A;  1YI2 1;  1N8R 2;  1Q81 1;  1USP B;  3I4N I;  4E33 A;  1VQO Z;  2IZ4 A;  1WII A;  4CL1 A;  1M90 1;  4NBG A;  5FLX f;  1JJ2 Z;  3CPW Z;  2VUM I;  4E2W A;  1YHQ Z;  3JAM f;  1TWF I;  2G2K A;  1VQP 1;  4NBD A;  3CCM Z;  2QKD A;  4A3D I;  1WZN A;  1VQ5 Z;  2H85 A;  3D2L A;  2JNY A;  4NB9 A;  2V3V A;  1Q82 1;  3GTM I;  3PO3 S;  4Y7N I;  4DGL A;  1K8A 2;  1I6H I;  5FLM I;  3CCU Z;  1VQ7 1;  3J81 b;  2R6M A;  2OTJ 1;  2VPX A;  3FQM A;  2P28 A;  3RZD I;  2KPI A;  2JIO A;  1ML8 A;  1JJ2 Y;  2R7Z I;  2LIY A;  3CPW Y;  2E2H I;  5IP7 I;  2NVT I;  1QVF Z;  5D1P A;  4A3I I;  1RQF A;  2NVX I;  2JIP A;  2PK7 A;  3M4O I;  1NJI 2;  1RNI A;  2QA4 Z;  3S2D I;  2LFU A;  3OW2 Z;  2EGT A;  1W2B Z;  3CCR Z;  4NBE A;  1VQK Z;  1YJ9 Z;  4RVD A;  4HGY A;  5FLX b;  3J7A 4;  3U50 C;  2VF1 A;  1RO0 A;  3S1M I;  3I56 1;  2R92 I;  3CCQ Z;  1Z03 A;  2OOY B;  3CC4 1;  3G71 Z;  3BG1 B;  3PO3 I;  3NDI A;  2RPR A;  4A3G I;  4HH4 A;  2VUG A;  1PFT A;  4E30 A;  2JA6 I;  4EWC A;  3CC2 Z;  1KD1 2;  3I55 Z;  3CCS Z;  5T64 A;  1VQ8 1;  3HOU I;  1Q16 A;  4A3J I;  4X6A I;  3NFZ A;  1AA6 A;  3CCL 1;  3S17 I;  1VQN 1;  3OW2 Y;  1W2B Y;  4MRI A;  2QLV B;  1VQ4 Z;  1M1K 1;  1SFO I;  1KQS Y;  3H3V J;  1K83 I;  3GTO I;  3CCV Z;  1YJW Z;  1QVG Y;  2OZK A;  3I4M I;  3TDH B;  3G4S 1;  1YJN Z;  3BG0 B;  3I07 A;  3PO2 I;  4A3M I;  1L1O C;  3GTL I;  3CC7 Z;  1QYP A;  4A3F I;  2W03 A;  1VQM 1;  3IF8 A;  2IV2 X;  1VQL Z;  4E2X A;  2Q51 A;  1YIJ Z;  4A3L I;  2K5R A;  3CCJ Z;  1KC8 2;  2E2J I;  2V8J A;  3CD6 1;  5T67 A;  1WW9 A;  1N8R 1;  2OTL Z;  5IT9 f;  4E32 A;  5LL6 f;  1VQ9 Z;  1S72 1;  2HU9 A;  3HOW I;  3F3P C;  4RVG A;  3CCE 1;  1RO4 A;  1LQL A;  3S15 I;  2DE7 A;  4MXU A;  4QTU A;  4DK1 A;  2JIM A;  2VPZ A;  3GTG I;  2M48 A;  1RLY A;  3GTK I;  1YUA A;  4RVF A;  1VQO 1;  2W04 A;  2VPY A;  4RS4 A;  3VMI A;  3P5J B;  2QEX Z;  2V8I A;  3RZO I;  3NDJ A;  1I50 I;  2F4O A;  2QRC B;  3VTN A;  1YHQ 1;  4E31 A;  2JIQ A;  2RT9 A;  3CME Z;  3CCM 1;  1K8A 1;  1VQ6 Z;  1VQ5 1;  2GTH A;  1Y1V S;  1Y8C A;  1TWA I;  3M3Y I;  3S1Q I;  4A3E I;  3HOV I;  4DQY B;  2E7Z A;  3MZK B;  2I3C A;  1Z02 A;  2DE5 A;  2JUB A;  2P3Y A;  4E2Y A;  1P9N A;  2QR1 B;  2JR6 A;  3CXC Z;  5IT9 b;  1NJI 1;  3CCU 1;  3JAM b;  3S2H I;  1YIT Z;  2E2I I;  5A2Q f;  4BY7 I;  1QXF A;  1TWG I;  3NH8 A;  4NBA A;  5IP9 I;  1DL6 A;  1K73 2;  4NBB A;  4RVH A;  3NH5 A;  2JA8 I;  3IR7 A;  2HF1 A;  1QVF Y;  2QA4 1;  3HOX I;  3CMA Z;  2YU9 I;  1VQK 1;  3CCR 1;  3VMH A;  1YJ9 1;  3G6E Z;  4MD7 A;  2GU2 A;  2BJO A;  1Y1V I;  4TNU A;  3K7A I;  3FQQ A;  3EED A;  1KD1 1;  4NOZ A;  1R9T I;  1S7M A;  2DE6 A;  1X3W A;  3CCQ 1;  2AKL A;  4BY1 I;  3G71 1;  3S14 I;  2J6A A;  4MD8 A;  1YI2 Z;  2QRD B;  3GTP I;  4Y52 I;  2O53 A;  2QRE B;  3FKI I;  2NAP A;  5T6B A;  3CC2 1;  1QF8 A;  3I55 1;  3CCS 1;  4MH4 A;  2WAQ A;  4NH1 C;  1FDI A;  3EER A;  3D9X A;  3S1N I;  1TFI A;  1RO2 A;  5A2Q b;  1VQP Z;  2NVY I;  3LUS A;  4A93 I;  4E2Z A; 
#chains in the Genus database with same CATH homology
 1VQ4 1;  4BBR I;  1Q86 2;  1USP A;  3CCV 1;  3ESW A;  2Y0S A;  1YJW 1;  1JWH C;  3MON A;  3VB9 A;  1YUK A;  1I3Q I;  3GTJ I;  1KC8 1;  5C44 I;  1YJN 1;  3T4N B;  4BXX I;  1Z01 A;  1VQ7 Z;  2OTJ Z;  1K9M 2;  2YAD A;  3GKQ A;  4QTT A;  1Q86 1;  4BBS I;  5C3E I;  4NFR A;  3CC7 1;  1Q82 2;  2V8K A;  3MZL B;  1VQL 1;  1ZH1 A;  2IZ3 A;  1YIJ 1;  3CCJ 1;  1Y1W I;  2WB1 A;  3GTQ I;  2OOX B;  2Q4Z A;  4RV9 A;  1K9M 1;  1TWH I;  2OTL 1;  1NUI A;  1ZB9 A;  1VQ9 1;  3KIH A;  3HOY I;  1ZB8 A;  3VMG A;  4A3C I;  1NP6 A;  3I56 Z;  2M6N A;  1VLA A;  3CC4 Z;  1KRL A;  2ZAE B;  3HKZ A;  5CM2 M;  3J80 f;  2PM9 A;  2B63 I;  1Q7Y 2;  2QEX 1;  5C4J I;  2GTI A;  1VQ8 Z;  2E9H A;  3NH4 A;  1X0T A;  3S16 I;  1WCM I;  5AN9 F;  3CME 1;  1KQS Z;  3CCL Z;  1VQN Z;  4NB8 A;  1VQ6 1;  4NBC A;  4MON A;  5C4X I;  1Q7Y 1;  2KI7 B;  1TWC I;  2K3R A;  5D1O A;  3D6W A;  4MD9 A;  2PMZ A;  2O4H A;  4NBH A;  1QVG Z;  3IX0 A;  1K73 1;  4AYB A;  2JA7 I;  5D1O B;  2R93 I;  2F4M A;  3IFU A;  3G4S Z;  1YIT 1;  1M1K 2;  4HGZ A;  3CXC Y;  4A3K I;  3TE5 B;  2RBL A;  1N2F A;  4XX2 A;  2RHB A;  2NVQ I;  1VQM Z;  1X3Z A;  3QWU A;  3J80 b;  3CD6 Z;  2RIQ A;  3CMA 1;  4A3B I;  3H0G I;  1Q81 2;  2JS4 A;  3G6E 1;  1S72 Z;  3J81 f;  3CCE Z;  3KIF A;  3GTM S;  4NBF A;  4S1T A;  3S1R I;  1M90 2;  3F3F C;  3HOZ I;  3CQZ I;  2JA5 I;  3GCF A;  2JMO A;  3Q87 A;  1YI2 1;  1N8R 2;  1Q81 1;  1USP B;  3I4N I;  4E33 A;  1VQO Z;  2IZ4 A;  1WII A;  4CL1 A;  1M90 1;  4NBG A;  5FLX f;  1JJ2 Z;  3CPW Z;  2VUM I;  4E2W A;  1YHQ Z;  3JAM f;  1TWF I;  2G2K A;  1VQP 1;  4NBD A;  3CCM Z;  2QKD A;  4A3D I;  1VQ5 Z;  2H85 A;  2JNY A;  4NB9 A;  1Q82 1;  3GTM I;  3PO3 S;  4Y7N I;  4DGL A;  1K8A 2;  1I6H I;  5FLM I;  3CCU Z;  1VQ7 1;  3J81 b;  2R6M A;  2OTJ 1;  3FQM A;  2P28 A;  3RZD I;  2KPI A;  2R7Z I;  1ML8 A;  1JJ2 Y;  2LIY A;  3CPW Y;  2E2H I;  5IP7 I;  2NVT I;  1QVF Z;  5D1P A;  4A3I I;  1RQF A;  2NVX I;  2PK7 A;  3M4O I;  1NJI 2;  1RNI A;  2QA4 Z;  3S2D I;  2LFU A;  3OW2 Z;  2EGT A;  1W2B Z;  3CCR Z;  4NBE A;  1VQK Z;  1YJ9 Z;  4RVD A;  4HGY A;  5FLX b;  3J7A 4;  3U50 C;  2VF1 A;  1RO0 A;  3S1M I;  3I56 1;  2R92 I;  3CCQ Z;  1Z03 A;  2OOY B;  3CC4 1;  3G71 Z;  3BG1 B;  3PO3 I;  3NDI A;  2RPR A;  4A3G I;  4HH4 A;  2VUG A;  1PFT A;  4E30 A;  2JA6 I;  4EWC A;  3CC2 Z;  1KD1 2;  3I55 Z;  3CCS Z;  5T64 A;  1VQ8 1;  3HOU I;  4A3J I;  4X6A I;  3NFZ A;  3CCL 1;  3S17 I;  1VQN 1;  3OW2 Y;  1W2B Y;  4MRI A;  2QLV B;  1VQ4 Z;  1M1K 1;  1SFO I;  1KQS Y;  3H3V J;  1K83 I;  3GTO I;  3CCV Z;  1YJW Z;  1QVG Y;  2OZK A;  3I4M I;  3TDH B;  3G4S 1;  1YJN Z;  3BG0 B;  3I07 A;  3PO2 I;  4A3M I;  1L1O C;  3GTL I;  3CC7 Z;  1QYP A;  4A3F I;  2W03 A;  1VQM 1;  3IF8 A;  1VQL Z;  4E2X A;  2Q51 A;  1YIJ Z;  4A3L I;  2K5R A;  3CCJ Z;  1KC8 2;  2E2J I;  2V8J A;  3CD6 1;  5T67 A;  1WW9 A;  1N8R 1;  2OTL Z;  5IT9 f;  4E32 A;  5LL6 f;  1VQ9 Z;  1S72 1;  2HU9 A;  3HOW I;  3F3P C;  4RVG A;  3CCE 1;  1RO4 A;  1LQL A;  3S15 I;  2DE7 A;  4MXU A;  4QTU A;  4DK1 A;  3GTG I;  2M48 A;  1RLY A;  3GTK I;  1YUA A;  4RVF A;  1VQO 1;  2W04 A;  4RS4 A;  3VMI A;  3P5J B;  2QEX Z;  2V8I A;  3RZO I;  3NDJ A;  1I50 I;  2F4O A;  2QRC B;  3VTN A;  1YHQ 1;  4E31 A;  2RT9 A;  3CME Z;  3CCM 1;  1K8A 1;  1VQ6 Z;  1VQ5 1;  1Y1V S;  2GTH A;  1TWA I;  3M3Y I;  3S1Q I;  4A3E I;  3HOV I;  4DQY B;  3MZK B;  2I3C A;  1Z02 A;  2DE5 A;  2JUB A;  2P3Y A;  4E2Y A;  1P9N A;  2QR1 B;  2JR6 A;  3CXC Z;  5IT9 b;  1NJI 1;  3CCU 1;  3JAM b;  3S2H I;  1YIT Z;  2E2I I;  5A2Q f;  4BY7 I;  1TWG I;  3NH8 A;  4NBA A;  5IP9 I;  1DL6 A;  1K73 2;  4NBB A;  4RVH A;  3NH5 A;  2JA8 I;  2HF1 A;  1QVF Y;  2QA4 1;  3HOX I;  3CMA Z;  2YU9 I;  1VQK 1;  3CCR 1;  3VMH A;  1YJ9 1;  3G6E Z;  4MD7 A;  2GU2 A;  2BJO A;  1Y1V I;  4TNU A;  3K7A I;  3FQQ A;  3EED A;  1KD1 1;  4NOZ A;  1R9T I;  1S7M A;  2DE6 A;  1X3W A;  3CCQ 1;  2AKL A;  4BY1 I;  3G71 1;  3S14 I;  2J6A A;  4MD8 A;  1YI2 Z;  2QRD B;  3GTP I;  4Y52 I;  2O53 A;  2QRE B;  3FKI I;  5T6B A;  3CC2 1;  1QF8 A;  3I55 1;  3CCS 1;  4MH4 A;  2WAQ A;  4NH1 C;  3EER A;  3D9X A;  3S1N I;  1TFI A;  1RO2 A;  5A2Q b;  1VQP Z;  2NVY I;  3LUS A;  4A93 I;  4E2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...