2LIYA

Plant peptide hormone regulating stomatal density
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
45
structure length
45
Chain Sequence
IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL PATTERNING FACTOR-like protein 9
publication title The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone
total genus 3
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.390 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2liyA00
2LIYA
chains in the Genus database with same CATH superfamily
3CMA1 3QWUA 1JJ2Z 5T6BA 3H3VJ 5T64A 3CCJ1 3HOWI 3GCFA 3GTPI 3HOXI 3I56Z 2PM9A 3TE5B 1L1OC 2IZ3A 1S721 3NDJA 4NBCA 3J81b 1VQ61 3LUSA 3CCSZ 1RO0A 1M1K1 1YIJZ 2K3RA 2DE6A 2Q51A 2QRCB 3FQQA 4HH4A 1ZB8A 1N8R2 4MD8A 3CPWZ 2M48A 2P28A 1VQ41 2VUGA 3BG1B 1K8A2 1TWCI 1Y1WI 5C4XI 3HOVI 3CCEZ 2RT9A 2OTL1 1Q16A 1YJWZ 1VQN1 4A3CI 2VUMI 2OTJZ 4NBEA 2E2II 2WAQA 3HOZI 3F3FC 4E30A 3PO3I 2W03A 4NFRA 1VQ5Z 1SIWA 5C44I 4MRIA 2JUBA 4NBDA 1VQ81 2NVTI 2W04A 4X6AI 3VMGA 2V8JA 3FQMA 3P5JB 1K731 2AKLA 4A93I 2JA5I 1USPA 1Q7Y1 2V3VA 1WIIA 2F4MA 1VQMZ 3CCQ1 3S17I 3CXCY 1SFOI 2GTHA 4TNUA 2BJOA 4E33A 2I3CA 3NH4A 4A3BI 1QVFY 5CM2M 1RLYA 1YHQZ 3TDHB 4A3DI 1I6HI 1YIT1 3G6EZ 3RZOI 2DE7A 3S1QI 3I4NI 1NJI1 4A3MI 3MZLB 5C3EI 1WZNA 2HU9A 1QVGZ 1YHQ1 4NBHA 2K5RA 4HGYA 1M902 1RQFA 3OW2Z 4DGLA 1N8R1 3CQZI 3H0GI 2R7ZI 2OZKA 3CD61 3GTGI 3CCL1 1VQ9Z 2QA4Z 1JWHC 3F3PC 1DL6A 5D1OB 3CCV1 5FLMI 4NB9A 4CL1A 4RS4A 2QEXZ 2AYDA 1WJ2A 2VF1A 3GTJI 3IF8A 5D1PA 1VQ91 3I07A 2OOYB 3FKII 3EEDA 1QXFA 1YI2Z 3GTOI 4RVHA 1X3WA 3I561 2HF1A 5LL6f 4QTUA 2ZAEB 3CCS1 1YIJ1 4NBBA 2QREB 1VQ7Z 3EERA 1KD12 3G4SZ 1KQSZ 4NBGA 4NH1C 1VQPZ 3J80f 1TWFI 4RVDA 1K9M2 1TWGI 2PMZA 2QKDA 3VMHA 1VLAA 1VQ71 3NDIA 3CCUZ 4A3FI 3GTMS 1ML8A 3GKQA 3CCE1 3S15I 3CCMZ 1P9NA 1QYPA 1YJW1 4MXUA 1Z03A 1FDOA 1YJN1 3NH8A 4E31A 2KPIA 2OTJ1 3M4OI 1N2FA 1S7MA 2EGTA 3G71Z 1M1K2 1FDIA 1RNIA 1VQ51 1M901 1VQLZ 2LEXA 1RO2A 2RPRA 4NB8A 3I55Z 1TFIA 1X3ZA 3G711 1JJ2Y 1Q812 1YUAA 1Q822 2V8KA 3IX0A 4XX2A 1VQM1 4DK1A 2YADA 1VQKZ 1TWAI 1VQOZ 1WW9A 4NOZA 3JAMb 3CCRZ 3I551 4MH4A 4QTTA 3D2LA 2E2HI 3D9XA 3J7A4 2QLVB 1Q862 2RBLA 1R9TI 3ESWA 1Y8CA 3G6E1 4A3LI 5A2Qf 1RO4A 2JIRA 2WB1A 4NBAA 3CPWY 2M6NA 3VMIA 3CC2Z 4HGZA 2QRDB 2JA8I 3GTKI 3S16I 4DQYB 2VPXA 2J6AA 3CMEZ 1K8A1 3GTMI 1K83I 2G2KA 3GTQI 1YJNZ 1KC82 1USPB 3CMAZ 3J80b 3JAMf 1Z02A 1WCMI 1K9M1 5C4JI 3CCJZ 3CXCZ 3GTLI 1KRLA 2PK7A 2OOXB 2QA41 1LQLA 2JNYA 1S72Z 3HKZA 1W2BZ 1QVFZ 4RV9A 1VQ6Z 4RVGA 3HOYI 1NJI2 4E2YA 5IT9f 1X0TA 1NUIA 2QEX1 1AA6A 2LFUA 2O53A 3S2HI 1YJ9Z 2RIQA 4BXXI 4BBRI 1I50I 3D6WA 2JIMA 1YI21 2O4HA 2Q4ZA 2R6MA 1VQ4Z 4MD9A 1Y1VS 2QR1B 3VB9A 4MONA 1TWHI 5FLXf 2JIPA 1YJ91 2JR6A 3T4NB 2OTLZ 3S14I 5IP9I 2JIQA 3NH5A 4BY7I 2NVQI 2GU2A 3G4S1 1VQNZ 1Q811 1Q821 1VQP1 4A3JI 3S1NI 2RHBA 3Q87A 3IR7A 2DE5A 4A3GI 2B63I 1QVGY 2VPZA 3CCU1 5T67A 1VQ8Z 1Q861 5AN9F 3J81f 3CCM1 2E9HA 3I4MI 3VTNA 5A2Qb 4E2XA 3OW2Y 2NVYI 4E2WA 3KIHA 2JA7I 4A3KI 1ZB9A 3U50C 2YU9I 4Y52I 2P3YA 3CCQZ 4AYBA 4BY1I 1PFTA 4EWCA 4NBFA 2E2JI 4S1TA 4E32A 3CC7Z 2Y0SA 2H85A 3IFUA 3NFZA 3CC4Z 1KC81 3BG0B 1VQL1 4BBSI 3S2DI 5D1OA 5IP7I 3HOUI 2VPYA 1YITZ 3MONA 2NVXI 4MD7A 2V8IA 3CC71 2R92I 3KIFA 1W2BY 3CC41 3S1MI 4A3EI 1Y1VI 1VQK1 1QF8A 3MZKB 1VQO1 1ZH1A 3CCR1 3PO2I 2JA6I 2IV2X 2IZ4A 5IT9b 2GTIA 2V45A 2VPWA 2R93I 4E2ZA 1K732 1I3QI 2F4OA 1Q7Y2 2NAPA 1KQSY 4A3II 3K7AI 1KD11 3S1RI 2JMOA 3RZDI 3CD6Z 2JIOA 1YUKA 3CCLZ 1Z01A 5FLXb 3CC21 3PO3S 2JS4A 4RVFA 2KI7B 4Y7NI 3CCVZ 3CME1 1NP6A 3M3YI 2LIYA 2E7ZA
chains in the Genus database with same CATH topology
3CMA1 3QWUA 1JJ2Z 5T6BA 3H3VJ 5T64A 3CCJ1 3HOWI 3GCFA 3GTPI 3HOXI 3I56Z 2PM9A 3TE5B 1L1OC 2IZ3A 1S721 3NDJA 4NBCA 3J81b 1VQ61 3LUSA 3CCSZ 1RO0A 1M1K1 1YIJZ 2K3RA 2DE6A 2Q51A 2QRCB 3FQQA 4HH4A 1ZB8A 1N8R2 4MD8A 3CPWZ 2M48A 2P28A 1VQ41 2VUGA 3BG1B 1K8A2 1TWCI 1Y1WI 5C4XI 3HOVI 3CCEZ 2RT9A 2OTL1 1YJWZ 1VQN1 4A3CI 2VUMI 2OTJZ 4NBEA 2E2II 2WAQA 3HOZI 3F3FC 4E30A 3PO3I 2W03A 4NFRA 1VQ5Z 5C44I 4MRIA 2JUBA 4NBDA 1VQ81 2NVTI 2W04A 4X6AI 3VMGA 2V8JA 3FQMA 3P5JB 1K731 2AKLA 4A93I 2JA5I 1USPA 1Q7Y1 1WIIA 2F4MA 1VQMZ 3CCQ1 3S17I 3CXCY 1SFOI 2GTHA 4TNUA 2BJOA 4E33A 2I3CA 3NH4A 4A3BI 1QVFY 5CM2M 1RLYA 1YHQZ 3TDHB 4A3DI 1I6HI 1YIT1 3G6EZ 3RZOI 2DE7A 3S1QI 3I4NI 1NJI1 4A3MI 3MZLB 5C3EI 2HU9A 1QVGZ 1YHQ1 4NBHA 2K5RA 4HGYA 1M902 1RQFA 3OW2Z 4DGLA 1N8R1 3CQZI 3H0GI 2R7ZI 2OZKA 3CD61 3GTGI 3CCL1 1VQ9Z 2QA4Z 1JWHC 3F3PC 1DL6A 5D1OB 3CCV1 5FLMI 4NB9A 4CL1A 4RS4A 2QEXZ 2VF1A 3GTJI 3IF8A 5D1PA 1VQ91 3I07A 2OOYB 3FKII 3EEDA 1YI2Z 3GTOI 4RVHA 1X3WA 3I561 2HF1A 5LL6f 4QTUA 2ZAEB 3CCS1 1YIJ1 4NBBA 2QREB 1VQ7Z 3EERA 1KD12 3G4SZ 1KQSZ 4NBGA 4NH1C 1VQPZ 3J80f 1TWFI 4RVDA 1K9M2 1TWGI 2PMZA 2QKDA 3VMHA 1VLAA 1VQ71 3NDIA 3CCUZ 4A3FI 3GTMS 1ML8A 3GKQA 3CCE1 3S15I 3CCMZ 1P9NA 1QYPA 1YJW1 4MXUA 1Z03A 3NH8A 4E31A 2KPIA 2OTJ1 3M4OI 1N2FA 1S7MA 2EGTA 3G71Z 1M1K2 1RNIA 1VQ51 1M901 1VQLZ 1RO2A 2RPRA 4NB8A 3I55Z 1TFIA 1X3ZA 3G711 1JJ2Y 1Q812 1YUAA 1Q822 2V8KA 3IX0A 4XX2A 1VQM1 4DK1A 2YADA 1VQKZ 1TWAI 1VQOZ 1WW9A 4NOZA 3JAMb 3CCRZ 3I551 4MH4A 4QTTA 2E2HI 3D9XA 3J7A4 2QLVB 1Q862 2RBLA 1R9TI 3ESWA 3G6E1 4A3LI 5A2Qf 1RO4A 2WB1A 4NBAA 3CPWY 2M6NA 3VMIA 3CC2Z 4HGZA 2QRDB 2JA8I 3GTKI 3S16I 4DQYB 2J6AA 3CMEZ 1K8A1 3GTMI 1K83I 2G2KA 3GTQI 1YJNZ 1KC82 1USPB 3CMAZ 3J80b 3JAMf 1Z02A 1WCMI 1K9M1 5C4JI 3CCJZ 3CXCZ 3GTLI 1KRLA 2PK7A 2OOXB 2QA41 1LQLA 2JNYA 1S72Z 3HKZA 1W2BZ 1QVFZ 4RV9A 1VQ6Z 4RVGA 3HOYI 1NJI2 4E2YA 5IT9f 1X0TA 1NUIA 2QEX1 2LFUA 2O53A 3S2HI 1YJ9Z 2RIQA 4BXXI 4BBRI 1I50I 3D6WA 1YI21 2O4HA 2Q4ZA 2R6MA 1VQ4Z 4MD9A 1Y1VS 2QR1B 3VB9A 4MONA 1TWHI 5FLXf 1YJ91 2JR6A 3T4NB 2OTLZ 3S14I 5IP9I 3NH5A 4BY7I 2NVQI 2GU2A 3G4S1 1VQNZ 1Q811 1Q821 1VQP1 4A3JI 3S1NI 2RHBA 3Q87A 2DE5A 4A3GI 2B63I 1QVGY 3CCU1 5T67A 1VQ8Z 1Q861 5AN9F 3J81f 3CCM1 2E9HA 3I4MI 3VTNA 5A2Qb 4E2XA 3OW2Y 2NVYI 4E2WA 3KIHA 2JA7I 4A3KI 1ZB9A 3U50C 2YU9I 4Y52I 2P3YA 3CCQZ 4AYBA 4BY1I 1PFTA 4EWCA 4NBFA 2E2JI 4S1TA 4E32A 3CC7Z 2Y0SA 2H85A 3IFUA 3NFZA 3CC4Z 1KC81 3BG0B 1VQL1 4BBSI 3S2DI 5D1OA 5IP7I 3HOUI 1YITZ 3MONA 2NVXI 4MD7A 2V8IA 3CC71 2R92I 3KIFA 1W2BY 3CC41 3S1MI 4A3EI 1Y1VI 1VQK1 1QF8A 3MZKB 1VQO1 1ZH1A 3CCR1 3PO2I 2JA6I 2IZ4A 5IT9b 2GTIA 2R93I 4E2ZA 1K732 1I3QI 2F4OA 1Q7Y2 1KQSY 4A3II 3K7AI 1KD11 3S1RI 2JMOA 3RZDI 3CD6Z 1YUKA 3CCLZ 1Z01A 5FLXb 3CC21 3PO3S 2JS4A 4RVFA 2KI7B 4Y7NI 3CCVZ 3CME1 1NP6A 3M3YI 2LIYA 1YJN1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIY A; 
#chains in the Genus database with same CATH topology
 3CMA 1;  3QWU A;  1JJ2 Z;  5T6B A;  3H3V J;  5T64 A;  3CCJ 1;  3HOW I;  3GCF A;  3GTP I;  3HOX I;  3I56 Z;  2PM9 A;  3TE5 B;  1L1O C;  2IZ3 A;  1S72 1;  3NDJ A;  4NBC A;  3J81 b;  1VQ6 1;  3LUS A;  3CCS Z;  1RO0 A;  1M1K 1;  1YIJ Z;  2K3R A;  2DE6 A;  2Q51 A;  2QRC B;  3FQQ A;  4HH4 A;  1ZB8 A;  1N8R 2;  4MD8 A;  3CPW Z;  2M48 A;  2P28 A;  1VQ4 1;  2VUG A;  3BG1 B;  1K8A 2;  1TWC I;  1Y1W I;  5C4X I;  3HOV I;  3CCE Z;  2RT9 A;  2OTL 1;  1Q16 A;  1YJW Z;  1VQN 1;  4A3C I;  2VUM I;  2OTJ Z;  4NBE A;  2E2I I;  2WAQ A;  3HOZ I;  3F3F C;  4E30 A;  3PO3 I;  2W03 A;  4NFR A;  1VQ5 Z;  1SIW A;  5C44 I;  4MRI A;  2JUB A;  4NBD A;  1VQ8 1;  2NVT I;  2W04 A;  4X6A I;  3VMG A;  2V8J A;  3FQM A;  3P5J B;  1K73 1;  2AKL A;  4A93 I;  2JA5 I;  1USP A;  1Q7Y 1;  2V3V A;  1WII A;  2F4M A;  1VQM Z;  3CCQ 1;  3S17 I;  3CXC Y;  1SFO I;  2GTH A;  4TNU A;  2BJO A;  4E33 A;  2I3C A;  3NH4 A;  4A3B I;  1QVF Y;  5CM2 M;  1RLY A;  1YHQ Z;  3TDH B;  4A3D I;  1I6H I;  1YIT 1;  3G6E Z;  3RZO I;  2DE7 A;  3S1Q I;  3I4N I;  1NJI 1;  4A3M I;  3MZL B;  5C3E I;  1WZN A;  2HU9 A;  1QVG Z;  1YHQ 1;  4NBH A;  2K5R A;  4HGY A;  1M90 2;  1RQF A;  3OW2 Z;  4DGL A;  1N8R 1;  3CQZ I;  3H0G I;  2R7Z I;  2OZK A;  3CD6 1;  3GTG I;  3CCL 1;  1VQ9 Z;  2QA4 Z;  1JWH C;  3F3P C;  1DL6 A;  5D1O B;  3CCV 1;  5FLM I;  4NB9 A;  4CL1 A;  4RS4 A;  2QEX Z;  2AYD A;  1WJ2 A;  2VF1 A;  3GTJ I;  3IF8 A;  5D1P A;  1VQ9 1;  3I07 A;  2OOY B;  3FKI I;  3EED A;  1QXF A;  1YI2 Z;  3GTO I;  4RVH A;  1X3W A;  3I56 1;  2HF1 A;  5LL6 f;  4QTU A;  2ZAE B;  3CCS 1;  1YIJ 1;  4NBB A;  2QRE B;  1VQ7 Z;  3EER A;  1KD1 2;  3G4S Z;  1KQS Z;  4NBG A;  4NH1 C;  1VQP Z;  3J80 f;  1TWF I;  4RVD A;  1K9M 2;  1TWG I;  2PMZ A;  2QKD A;  3VMH A;  1VLA A;  1VQ7 1;  3NDI A;  3CCU Z;  4A3F I;  3GTM S;  1ML8 A;  3GKQ A;  3CCE 1;  3S15 I;  3CCM Z;  1P9N A;  1QYP A;  1YJW 1;  4MXU A;  1Z03 A;  1FDO A;  1YJN 1;  3NH8 A;  4E31 A;  2KPI A;  2OTJ 1;  3M4O I;  1N2F A;  1S7M A;  2EGT A;  3G71 Z;  1M1K 2;  1FDI A;  1RNI A;  1VQ5 1;  1M90 1;  1VQL Z;  2LEX A;  1RO2 A;  2RPR A;  4NB8 A;  3I55 Z;  1TFI A;  1X3Z A;  3G71 1;  1JJ2 Y;  1Q81 2;  1YUA A;  1Q82 2;  2V8K A;  3IX0 A;  4XX2 A;  1VQM 1;  4DK1 A;  2YAD A;  1VQK Z;  1TWA I;  1VQO Z;  1WW9 A;  4NOZ A;  3JAM b;  3CCR Z;  3I55 1;  4MH4 A;  4QTT A;  3D2L A;  2E2H I;  3D9X A;  3J7A 4;  2QLV B;  1Q86 2;  2RBL A;  1R9T I;  3ESW A;  1Y8C A;  3G6E 1;  4A3L I;  5A2Q f;  1RO4 A;  2JIR A;  2WB1 A;  4NBA A;  3CPW Y;  2M6N A;  3VMI A;  3CC2 Z;  4HGZ A;  2QRD B;  2JA8 I;  3GTK I;  3S16 I;  4DQY B;  2VPX A;  2J6A A;  3CME Z;  1K8A 1;  3GTM I;  1K83 I;  2G2K A;  3GTQ I;  1YJN Z;  1KC8 2;  1USP B;  3CMA Z;  3J80 b;  3JAM f;  1Z02 A;  1WCM I;  1K9M 1;  5C4J I;  3CCJ Z;  3CXC Z;  3GTL I;  1KRL A;  2PK7 A;  2OOX B;  2QA4 1;  1LQL A;  2JNY A;  1S72 Z;  3HKZ A;  1W2B Z;  1QVF Z;  4RV9 A;  1VQ6 Z;  4RVG A;  3HOY I;  1NJI 2;  4E2Y A;  5IT9 f;  1X0T A;  1NUI A;  2QEX 1;  1AA6 A;  2LFU A;  2O53 A;  3S2H I;  1YJ9 Z;  2RIQ A;  4BXX I;  4BBR I;  1I50 I;  3D6W A;  2JIM A;  1YI2 1;  2O4H A;  2Q4Z A;  2R6M A;  1VQ4 Z;  4MD9 A;  1Y1V S;  2QR1 B;  3VB9 A;  4MON A;  1TWH I;  5FLX f;  2JIP A;  1YJ9 1;  2JR6 A;  3T4N B;  2OTL Z;  3S14 I;  5IP9 I;  2JIQ A;  3NH5 A;  4BY7 I;  2NVQ I;  2GU2 A;  3G4S 1;  1VQN Z;  1Q81 1;  1Q82 1;  1VQP 1;  4A3J I;  3S1N I;  2RHB A;  3Q87 A;  3IR7 A;  2DE5 A;  4A3G I;  2B63 I;  1QVG Y;  2VPZ A;  3CCU 1;  5T67 A;  1VQ8 Z;  1Q86 1;  5AN9 F;  3J81 f;  3CCM 1;  2E9H A;  3I4M I;  3VTN A;  5A2Q b;  4E2X A;  3OW2 Y;  2NVY I;  4E2W A;  3KIH A;  2JA7 I;  4A3K I;  1ZB9 A;  3U50 C;  2YU9 I;  4Y52 I;  2P3Y A;  3CCQ Z;  4AYB A;  4BY1 I;  1PFT A;  4EWC A;  4NBF A;  2E2J I;  4S1T A;  4E32 A;  3CC7 Z;  2Y0S A;  2H85 A;  3IFU A;  3NFZ A;  3CC4 Z;  1KC8 1;  3BG0 B;  1VQL 1;  4BBS I;  3S2D I;  5D1O A;  5IP7 I;  3HOU I;  2VPY A;  1YIT Z;  3MON A;  2NVX I;  4MD7 A;  2V8I A;  3CC7 1;  2R92 I;  3KIF A;  1W2B Y;  3CC4 1;  3S1M I;  4A3E I;  1Y1V I;  1VQK 1;  1QF8 A;  3MZK B;  1VQO 1;  1ZH1 A;  3CCR 1;  3PO2 I;  2JA6 I;  2IV2 X;  2IZ4 A;  5IT9 b;  2GTI A;  2V45 A;  2VPW A;  2R93 I;  4E2Z A;  1K73 2;  1I3Q I;  2F4O A;  1Q7Y 2;  2NAP A;  1KQS Y;  4A3I I;  3K7A I;  1KD1 1;  3S1R I;  2JMO A;  3RZD I;  3CD6 Z;  2JIO A;  1YUK A;  3CCL Z;  1Z01 A;  5FLX b;  3CC2 1;  3PO3 S;  2JS4 A;  4RVF A;  2KI7 B;  4Y7N I;  3CCV Z;  3CME 1;  1NP6 A;  3M3Y I;  2LIY A;  2E7Z A; 
#chains in the Genus database with same CATH homology
 3CMA 1;  3QWU A;  1JJ2 Z;  5T6B A;  3H3V J;  5T64 A;  3CCJ 1;  3HOW I;  3GCF A;  3GTP I;  3HOX I;  3I56 Z;  2PM9 A;  3TE5 B;  1L1O C;  2IZ3 A;  1S72 1;  3NDJ A;  4NBC A;  3J81 b;  1VQ6 1;  3LUS A;  3CCS Z;  1RO0 A;  1M1K 1;  1YIJ Z;  2K3R A;  2DE6 A;  2Q51 A;  2QRC B;  3FQQ A;  4HH4 A;  1ZB8 A;  1N8R 2;  4MD8 A;  3CPW Z;  2M48 A;  2P28 A;  1VQ4 1;  2VUG A;  3BG1 B;  1K8A 2;  1TWC I;  1Y1W I;  5C4X I;  3HOV I;  3CCE Z;  2RT9 A;  2OTL 1;  1YJW Z;  1VQN 1;  4A3C I;  2VUM I;  2OTJ Z;  4NBE A;  2E2I I;  2WAQ A;  3HOZ I;  3F3F C;  4E30 A;  3PO3 I;  2W03 A;  4NFR A;  1VQ5 Z;  5C44 I;  4MRI A;  2JUB A;  4NBD A;  1VQ8 1;  2NVT I;  2W04 A;  4X6A I;  3VMG A;  2V8J A;  3FQM A;  3P5J B;  1K73 1;  2AKL A;  4A93 I;  2JA5 I;  1USP A;  1Q7Y 1;  1WII A;  2F4M A;  1VQM Z;  3CCQ 1;  3S17 I;  3CXC Y;  1SFO I;  2GTH A;  4TNU A;  2BJO A;  4E33 A;  2I3C A;  3NH4 A;  4A3B I;  1QVF Y;  5CM2 M;  1RLY A;  1YHQ Z;  3TDH B;  4A3D I;  1I6H I;  1YIT 1;  3G6E Z;  3RZO I;  2DE7 A;  3S1Q I;  3I4N I;  1NJI 1;  4A3M I;  3MZL B;  5C3E I;  2HU9 A;  1QVG Z;  1YHQ 1;  4NBH A;  2K5R A;  4HGY A;  1M90 2;  1RQF A;  3OW2 Z;  4DGL A;  1N8R 1;  3CQZ I;  3H0G I;  2R7Z I;  2OZK A;  3CD6 1;  3GTG I;  3CCL 1;  1VQ9 Z;  2QA4 Z;  1JWH C;  3F3P C;  1DL6 A;  5D1O B;  3CCV 1;  5FLM I;  4NB9 A;  4CL1 A;  4RS4 A;  2QEX Z;  2VF1 A;  3GTJ I;  3IF8 A;  5D1P A;  1VQ9 1;  3I07 A;  2OOY B;  3FKI I;  3EED A;  1YI2 Z;  3GTO I;  4RVH A;  1X3W A;  3I56 1;  2HF1 A;  5LL6 f;  4QTU A;  2ZAE B;  3CCS 1;  1YIJ 1;  4NBB A;  2QRE B;  1VQ7 Z;  3EER A;  1KD1 2;  3G4S Z;  1KQS Z;  4NBG A;  4NH1 C;  1VQP Z;  3J80 f;  1TWF I;  4RVD A;  1K9M 2;  1TWG I;  2PMZ A;  2QKD A;  3VMH A;  1VLA A;  1VQ7 1;  3NDI A;  3CCU Z;  4A3F I;  3GTM S;  1ML8 A;  3GKQ A;  3CCE 1;  3S15 I;  3CCM Z;  1P9N A;  1QYP A;  1YJW 1;  4MXU A;  1Z03 A;  3NH8 A;  4E31 A;  2KPI A;  2OTJ 1;  3M4O I;  1N2F A;  1S7M A;  2EGT A;  3G71 Z;  1M1K 2;  1RNI A;  1VQ5 1;  1M90 1;  1VQL Z;  1RO2 A;  2RPR A;  4NB8 A;  3I55 Z;  1TFI A;  1X3Z A;  3G71 1;  1JJ2 Y;  1Q81 2;  1YUA A;  1Q82 2;  2V8K A;  3IX0 A;  4XX2 A;  1VQM 1;  4DK1 A;  2YAD A;  1VQK Z;  1TWA I;  1VQO Z;  1WW9 A;  4NOZ A;  3JAM b;  3CCR Z;  3I55 1;  4MH4 A;  4QTT A;  2E2H I;  3D9X A;  3J7A 4;  2QLV B;  1Q86 2;  2RBL A;  1R9T I;  3ESW A;  3G6E 1;  4A3L I;  5A2Q f;  1RO4 A;  2WB1 A;  4NBA A;  3CPW Y;  2M6N A;  3VMI A;  3CC2 Z;  4HGZ A;  2QRD B;  2JA8 I;  3GTK I;  3S16 I;  4DQY B;  2J6A A;  3CME Z;  1K8A 1;  3GTM I;  1K83 I;  2G2K A;  3GTQ I;  1YJN Z;  1KC8 2;  1USP B;  3CMA Z;  3J80 b;  3JAM f;  1Z02 A;  1WCM I;  1K9M 1;  5C4J I;  3CCJ Z;  3CXC Z;  3GTL I;  1KRL A;  2PK7 A;  2OOX B;  2QA4 1;  1LQL A;  2JNY A;  1S72 Z;  3HKZ A;  1W2B Z;  1QVF Z;  4RV9 A;  1VQ6 Z;  4RVG A;  3HOY I;  1NJI 2;  4E2Y A;  5IT9 f;  1X0T A;  1NUI A;  2QEX 1;  2LFU A;  2O53 A;  3S2H I;  1YJ9 Z;  2RIQ A;  4BXX I;  4BBR I;  1I50 I;  3D6W A;  1YI2 1;  2O4H A;  2Q4Z A;  2R6M A;  1VQ4 Z;  4MD9 A;  1Y1V S;  2QR1 B;  3VB9 A;  4MON A;  1TWH I;  5FLX f;  1YJ9 1;  2JR6 A;  3T4N B;  2OTL Z;  3S14 I;  5IP9 I;  3NH5 A;  4BY7 I;  2NVQ I;  2GU2 A;  3G4S 1;  1VQN Z;  1Q81 1;  1Q82 1;  1VQP 1;  4A3J I;  3S1N I;  2RHB A;  3Q87 A;  2DE5 A;  4A3G I;  2B63 I;  1QVG Y;  3CCU 1;  5T67 A;  1VQ8 Z;  1Q86 1;  5AN9 F;  3J81 f;  3CCM 1;  2E9H A;  3I4M I;  3VTN A;  5A2Q b;  4E2X A;  3OW2 Y;  2NVY I;  4E2W A;  3KIH A;  2JA7 I;  4A3K I;  1ZB9 A;  3U50 C;  2YU9 I;  4Y52 I;  2P3Y A;  3CCQ Z;  4AYB A;  4BY1 I;  1PFT A;  4EWC A;  4NBF A;  2E2J I;  4S1T A;  4E32 A;  3CC7 Z;  2Y0S A;  2H85 A;  3IFU A;  3NFZ A;  3CC4 Z;  1KC8 1;  3BG0 B;  1VQL 1;  4BBS I;  3S2D I;  5D1O A;  5IP7 I;  3HOU I;  1YIT Z;  3MON A;  2NVX I;  4MD7 A;  2V8I A;  3CC7 1;  2R92 I;  3KIF A;  1W2B Y;  3CC4 1;  3S1M I;  4A3E I;  1Y1V I;  1VQK 1;  1QF8 A;  3MZK B;  1VQO 1;  1ZH1 A;  3CCR 1;  3PO2 I;  2JA6 I;  2IZ4 A;  5IT9 b;  2GTI A;  2R93 I;  4E2Z A;  1K73 2;  1I3Q I;  2F4O A;  1Q7Y 2;  1KQS Y;  4A3I I;  3K7A I;  1KD1 1;  3S1R I;  2JMO A;  3RZD I;  3CD6 Z;  1YUK A;  3CCL Z;  1Z01 A;  5FLX b;  3CC2 1;  3PO3 S;  2JS4 A;  4RVF A;  2KI7 B;  4Y7N I;  3CCV Z;  3CME 1;  1NP6 A;  3M3Y I;  2LIY A;  1YJN 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...