2LIYA

Plant peptide hormone regulating stomatal density
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
45
structure length
45
Chain Sequence
b'IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL PATTERNING FACTOR-like protein 9
publication title The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone
total genus 3
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.390 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2liyA00
2LIYA
chains in the Genus database with same CATH superfamily
4A3LI 3HOXI 2IZ3A 2WAQA 3LUSA 4E2WA 1USPA 2IV2X 3GTPI 3J7A4 1VQ81 4QTUA 1VQL1 2YADA 2RPRA 4DQYB 5IT9f 2OTL1 3CCUZ 3CCSZ 4NBHA 4NB8A 2QREB 3T4NB 1QYPA 4NBAA 3CXCY 3I07A 3HOZI 3RZOI 1VQ5Z 3HOVI 1M1K1 3I561 4BXXI 5FLXb 3U50C 3S2DI 1KQSY 3S14I 2VUGA 5C3EI 3CCQ1 1QF8A 5T67A 1YJ9Z 4BBSI 1VQMZ 3GKQA 3GTMS 1VQNZ 1NJI1 1L1OC 1VQ6Z 2J6AA 2Q4ZA 5LL6f 3I4NI 3CXCZ 3VB9A 2R6MA 2QLVB 1WCMI 3GTQI 2K3RA 4RV9A 1Z03A 2E2II 3HKZA 2G2KA 1VQM1 3GTMI 1KC81 3CCJZ 3CCLZ 3MONA 2RIQA 1JJ2Y 2B63I 4RVDA 3HOWI 2JIOA 2VPZA 3CC41 1Y1WI 1WW9A 1RLYA 2VF1A 3CCR1 3CC2Z 1K9M1 4MD9A 4RS4A 2QA4Z 3CCJ1 2LFUA 2JS4A 1YJWZ 1SIWA 3CC7Z 3CCE1 3S1MI 2LEXA 4Y7NI 1USPB 2V3VA 2PK7A 2R93I 5FLXf 1TWCI 1JJ2Z 3NDJA 4NH1C 4DGLA 2OTJZ 2O53A 1WIIA 3FQQA 2QA41 2QKDA 4DK1A 3M4OI 1VQOZ 3J81b 4BY1I 1K731 2ZAEB 1YJW1 3CC71 2O4HA 1VQ9Z 2AKLA 5A2Qb 1YHQ1 5D1OA 3CMA1 2M48A 2EGTA 2JIQA 4E2XA 2DE6A 2H85A 3G4S1 1YI2Z 2JMOA 2NVTI 3I55Z 2JR6A 3S2HI 3PO3S 3Q87A 1TWGI 1VQ91 1TWAI 1K9M2 3CD61 3CCV1 2GTHA 2QEXZ 1VQ4Z 3I4MI 4MH4A 1YI21 1VQ7Z 3ESWA 1S7MA 4X6AI 1VQK1 3QWUA 4E30A 3EERA 3CMEZ 4RVFA 2P28A 2VUMI 4CL1A 5AN9F 2JIPA 3NDIA 2QEX1 1K732 3TE5B 1M902 3PO2I 1YUKA 1VQ71 3CQZI 1Q821 5T6BA 3CME1 2JIMA 3J81f 3S15I 4A3MI 3VTNA 3NH4A 1S72Z 2F4OA 3OW2Y 4MD7A 4NBEA 4A3FI 1QVFY 2F4MA 3CCU1 5FLMI 3CCS1 3GTOI 1YITZ 2JUBA 4BBRI 3CCMZ 1I3QI 4NBBA 1VQ51 1RO2A 2JA5I 3NH5A 2RHBA 2PMZA 5D1OB 3NFZA 4E2ZA 2RT9A 3OW2Z 1DL6A 1YIT1 1Y8CA 1YJ91 1KQSZ 3GTGI 1QVFZ 1VQN1 2GU2A 1VQ61 4E33A 1Q822 1FDOA 2E7ZA 1N8R1 2R92I 2V8IA 3IF8A 2Y0SA 3F3PC 4A3JI 3BG0B 1W2BY 3K7AI 2NVXI 3JAMb 1VLAA 4S1TA 3CCL1 4E32A 1YIJZ 1R9TI 3GTJI 1RQFA 4AYBA 1LQLA 1ZB9A 5CM2M 1K8A2 2JA6I 1P9NA 3KIHA 2K5RA 1PFTA 3CC21 2RBLA 3H3VJ 1W2BZ 1ZB8A 2OOXB 1AA6A 1M901 2I3CA 2JNYA 1TWFI 1QVGY 3IX0A 2DE7A 5IP7I 4A93I 2OTJ1 4HGYA 5C44I 2LIYA 3F3FC 2M6NA 1N8R2 1ZH1A 4A3DI 2W04A 3VMGA 1WJ2A 3HOYI 1VQO1 3S17I 1Q7Y2 1JWHC 1VQPZ 4XX2A 3G6EZ 3G71Z 4A3II 4A3EI 2OOYB 1YUAA 1YJNZ 1X3WA 2QR1B 2BJOA 4MXUA 3D9XA 3I551 3JAMf 3PO3I 4NBGA 1KD12 1K83I 2YU9I 1Q16A 3S1RI 2AYDA 2E2HI 3J80b 4QTTA 3S16I 1VQ41 1VQ8Z 1Y1VS 3VMIA 3D2LA 1VQLZ 2V8JA 3GTKI 2R7ZI 4MRIA 1Z01A 2QRCB 3GTLI 2OTLZ 2VPWA 1RO0A 3RZDI 3S1QI 1TWHI 5A2Qf 2E9HA 2KI7B 2V45A 1Q812 1Y1VI 2JA7I 2GTIA 3I56Z 3IFUA 1SFOI 3VMHA 3CCQZ 3M3YI 4A3KI 1K8A1 1S721 1FDIA 2PM9A 4A3BI 1Q862 1KRLA 2NAPA 1ML8A 1Z02A 3KIFA 4BY7I 2QRDB 3P5JB 3CCM1 1RNIA 2Q51A 1RO4A 1NP6A 3J80f 5IP9I 3IR7A 4A3GI 2JIRA 1Q7Y1 2P3YA 3CC4Z 3NH8A 2VPYA 3HOUI 3BG1B 3CCRZ 4MD8A 1N2FA 2E2JI 4RVGA 4NOZA 5C4JI 3CCEZ 4Y52I 2V8KA 4E31A 1KD11 2NVYI 3FKII 1M1K2 1YIJ1 3GCFA 3FQMA 2DE5A 5D1PA 4NFRA 4RVHA 2IZ4A 1I6HI 3MZLB 5C4XI 4HGZA 1YHQZ 3CMAZ 1NJI2 1WZNA 4HH4A 2NVQI 5IT9b 2W03A 4NBDA 3G4SZ 1NUIA 3TDHB 1Q811 4A3CI 3EEDA 4E2YA 2OZKA 4MONA 1X3ZA 4TNUA 4NBFA 2WB1A 1X0TA 1TFIA 3CD6Z 3CCVZ 1KC82 3CPWY 1QVGZ 2HF1A 2VPXA 1VQP1 3G6E1 3G711 1Q861 1VQKZ 1QXFA 3H0GI 1I50I 3MZKB 1YJN1 4EWCA 3D6WA 5T64A 3S1NI 2KPIA 4NBCA 4NB9A 2HU9A 3CPWZ 2JA8I
chains in the Genus database with same CATH topology
4A3LI 3HOXI 2IZ3A 2WAQA 3LUSA 4E2WA 1USPA 3GTPI 3J7A4 1VQ81 4QTUA 1VQL1 2YADA 2RPRA 4DQYB 5IT9f 2OTL1 3CCUZ 3CCSZ 4NBHA 4NB8A 2QREB 3T4NB 1QYPA 4NBAA 3CXCY 3I07A 3HOZI 3RZOI 1VQ5Z 3HOVI 1M1K1 3I561 4BXXI 5FLXb 3U50C 3S2DI 1KQSY 3S14I 2VUGA 5C3EI 3CCQ1 1QF8A 5T67A 1YJ9Z 4BBSI 1VQMZ 3GKQA 3GTMS 1VQNZ 1NJI1 1L1OC 1VQ6Z 2J6AA 2Q4ZA 5LL6f 3I4NI 3CXCZ 3VB9A 2R6MA 2QLVB 1WCMI 3GTQI 2K3RA 4RV9A 1Z03A 2E2II 3HKZA 2G2KA 1VQM1 3GTMI 1KC81 3CCJZ 3CCLZ 3MONA 2RIQA 1JJ2Y 2B63I 4RVDA 3HOWI 3CC41 1Y1WI 1WW9A 1RLYA 2VF1A 3CCR1 3CC2Z 1K9M1 4MD9A 4RS4A 2QA4Z 3CCJ1 2LFUA 2JS4A 1YJWZ 3CC7Z 3CCE1 3S1MI 4Y7NI 1USPB 2PK7A 2R93I 5FLXf 1TWCI 1JJ2Z 3NDJA 4NH1C 4DGLA 2OTJZ 2O53A 1WIIA 3FQQA 2QA41 2QKDA 4DK1A 3M4OI 1VQOZ 3J81b 4BY1I 1K731 2ZAEB 1YJW1 3CC71 2O4HA 1VQ9Z 2AKLA 5A2Qb 1YHQ1 5D1OA 3CMA1 2M48A 2EGTA 4E2XA 2DE6A 2H85A 3G4S1 1YI2Z 2JMOA 2NVTI 3I55Z 2JR6A 3S2HI 3PO3S 3Q87A 1TWGI 1VQ91 1TWAI 1K9M2 3CD61 3CCV1 2GTHA 2QEXZ 1VQ4Z 3I4MI 4MH4A 1YI21 1VQ7Z 3ESWA 1S7MA 4X6AI 1VQK1 3QWUA 4E30A 3EERA 3CMEZ 4RVFA 2P28A 2VUMI 4CL1A 5AN9F 3NDIA 2QEX1 1K732 3TE5B 1M902 3PO2I 1YUKA 1VQ71 3CQZI 1Q821 5T6BA 3CME1 3J81f 3S15I 4A3MI 3VTNA 3NH4A 1S72Z 2F4OA 3OW2Y 4MD7A 4NBEA 4A3FI 1QVFY 2F4MA 3CCU1 5FLMI 3CCS1 3GTOI 1YITZ 2JUBA 4BBRI 3CCMZ 1I3QI 4NBBA 1VQ51 1RO2A 2JA5I 3NH5A 2RHBA 2PMZA 5D1OB 3NFZA 4E2ZA 2RT9A 3OW2Z 1DL6A 1YIT1 1YJ91 1KQSZ 3GTGI 1QVFZ 1VQN1 2GU2A 1VQ61 4E33A 1Q822 1N8R1 2R92I 2V8IA 3IF8A 2Y0SA 3F3PC 4A3JI 3BG0B 1W2BY 3K7AI 2NVXI 3JAMb 1VLAA 4S1TA 3CCL1 4E32A 1YIJZ 1R9TI 3GTJI 1RQFA 4AYBA 1LQLA 1ZB9A 5CM2M 1K8A2 2JA6I 1P9NA 3KIHA 2K5RA 1PFTA 3CC21 2RBLA 3H3VJ 1W2BZ 1ZB8A 2OOXB 1M901 2I3CA 2JNYA 1TWFI 1QVGY 3IX0A 2DE7A 5IP7I 4A93I 2OTJ1 4HGYA 5C44I 2LIYA 3F3FC 2M6NA 1N8R2 1ZH1A 4A3DI 2W04A 3VMGA 3HOYI 3S17I 1VQO1 1Q7Y2 1JWHC 1VQPZ 4XX2A 3G6EZ 3G71Z 4A3II 4A3EI 2OOYB 1YUAA 1YJNZ 1X3WA 2QR1B 2BJOA 4MXUA 3D9XA 3I551 3JAMf 3PO3I 4NBGA 1KD12 1K83I 2YU9I 3S1RI 2E2HI 3J80b 4QTTA 3S16I 1VQ41 1VQ8Z 1Y1VS 3VMIA 1VQLZ 2V8JA 3GTKI 2R7ZI 4MRIA 1Z01A 2QRCB 3GTLI 2OTLZ 1RO0A 3RZDI 3S1QI 1TWHI 5A2Qf 2E9HA 2KI7B 1Q812 1Y1VI 2JA7I 2GTIA 3I56Z 3IFUA 1SFOI 3VMHA 3CCQZ 3M3YI 4A3KI 1K8A1 1S721 4A3BI 2PM9A 1Q862 1KRLA 1ML8A 1Z02A 3KIFA 4BY7I 2QRDB 3P5JB 3CCM1 1RNIA 2Q51A 1RO4A 1NP6A 3J80f 5IP9I 4A3GI 1Q7Y1 2P3YA 3CC4Z 3NH8A 3HOUI 3BG1B 3CCRZ 4MD8A 1N2FA 2E2JI 4RVGA 4NOZA 5C4JI 3CCEZ 4Y52I 2V8KA 4E31A 1KD11 2NVYI 3FKII 1M1K2 1YIJ1 3GCFA 3FQMA 2DE5A 5D1PA 4NFRA 4RVHA 2IZ4A 1I6HI 3MZLB 5C4XI 4HGZA 1YHQZ 3CMAZ 1NJI2 4HH4A 2NVQI 5IT9b 2W03A 4NBDA 3G4SZ 1NUIA 3TDHB 1Q811 4A3CI 3EEDA 4E2YA 2OZKA 4MONA 1X3ZA 4TNUA 4NBFA 2WB1A 1X0TA 1TFIA 3CD6Z 3CCVZ 1KC82 3CPWY 1QVGZ 2HF1A 1VQP1 3G6E1 3G711 1Q861 1VQKZ 3H0GI 1I50I 3MZKB 1YJN1 4EWCA 3D6WA 5T64A 3S1NI 2KPIA 4NBCA 4NB9A 2HU9A 3CPWZ 2JA8I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIY A; 
#chains in the Genus database with same CATH topology
 4A3L I;  3HOX I;  2IZ3 A;  2WAQ A;  3LUS A;  4E2W A;  1USP A;  2IV2 X;  3GTP I;  3J7A 4;  1VQ8 1;  4QTU A;  1VQL 1;  2YAD A;  2RPR A;  4DQY B;  5IT9 f;  2OTL 1;  3CCU Z;  3CCS Z;  4NBH A;  4NB8 A;  2QRE B;  3T4N B;  1QYP A;  4NBA A;  3CXC Y;  3I07 A;  3HOZ I;  3RZO I;  1VQ5 Z;  3HOV I;  1M1K 1;  3I56 1;  4BXX I;  5FLX b;  3U50 C;  3S2D I;  1KQS Y;  3S14 I;  2VUG A;  5C3E I;  3CCQ 1;  1QF8 A;  5T67 A;  1YJ9 Z;  4BBS I;  1VQM Z;  3GKQ A;  3GTM S;  1VQN Z;  1NJI 1;  1L1O C;  1VQ6 Z;  2J6A A;  2Q4Z A;  5LL6 f;  3I4N I;  3CXC Z;  3VB9 A;  2R6M A;  2QLV B;  1WCM I;  3GTQ I;  2K3R A;  4RV9 A;  1Z03 A;  2E2I I;  3HKZ A;  2G2K A;  1VQM 1;  3GTM I;  1KC8 1;  3CCJ Z;  3CCL Z;  3MON A;  2RIQ A;  1JJ2 Y;  2B63 I;  4RVD A;  3HOW I;  2JIO A;  2VPZ A;  3CC4 1;  1Y1W I;  1WW9 A;  1RLY A;  2VF1 A;  3CCR 1;  3CC2 Z;  1K9M 1;  4MD9 A;  4RS4 A;  2QA4 Z;  3CCJ 1;  2LFU A;  2JS4 A;  1YJW Z;  1SIW A;  3CC7 Z;  3CCE 1;  3S1M I;  2LEX A;  4Y7N I;  1USP B;  2V3V A;  2PK7 A;  2R93 I;  5FLX f;  1TWC I;  1JJ2 Z;  3NDJ A;  4NH1 C;  4DGL A;  2OTJ Z;  2O53 A;  1WII A;  3FQQ A;  2QA4 1;  2QKD A;  4DK1 A;  3M4O I;  1VQO Z;  3J81 b;  4BY1 I;  1K73 1;  2ZAE B;  1YJW 1;  3CC7 1;  2O4H A;  1VQ9 Z;  2AKL A;  5A2Q b;  1YHQ 1;  5D1O A;  3CMA 1;  2M48 A;  2EGT A;  2JIQ A;  4E2X A;  2DE6 A;  2H85 A;  3G4S 1;  1YI2 Z;  2JMO A;  2NVT I;  3I55 Z;  2JR6 A;  3S2H I;  3PO3 S;  3Q87 A;  1TWG I;  1VQ9 1;  1TWA I;  1K9M 2;  3CD6 1;  3CCV 1;  2GTH A;  2QEX Z;  1VQ4 Z;  3I4M I;  4MH4 A;  1YI2 1;  1VQ7 Z;  3ESW A;  1S7M A;  4X6A I;  1VQK 1;  3QWU A;  4E30 A;  3EER A;  3CME Z;  4RVF A;  2P28 A;  2VUM I;  4CL1 A;  5AN9 F;  2JIP A;  3NDI A;  2QEX 1;  1K73 2;  3TE5 B;  1M90 2;  3PO2 I;  1YUK A;  1VQ7 1;  3CQZ I;  1Q82 1;  5T6B A;  3CME 1;  2JIM A;  3J81 f;  3S15 I;  4A3M I;  3VTN A;  3NH4 A;  1S72 Z;  2F4O A;  3OW2 Y;  4MD7 A;  4NBE A;  4A3F I;  1QVF Y;  2F4M A;  3CCU 1;  5FLM I;  3CCS 1;  3GTO I;  1YIT Z;  2JUB A;  4BBR I;  3CCM Z;  1I3Q I;  4NBB A;  1VQ5 1;  1RO2 A;  2JA5 I;  3NH5 A;  2RHB A;  2PMZ A;  5D1O B;  3NFZ A;  4E2Z A;  2RT9 A;  3OW2 Z;  1DL6 A;  1YIT 1;  1Y8C A;  1YJ9 1;  1KQS Z;  3GTG I;  1QVF Z;  1VQN 1;  2GU2 A;  1VQ6 1;  4E33 A;  1Q82 2;  1FDO A;  2E7Z A;  1N8R 1;  2R92 I;  2V8I A;  3IF8 A;  2Y0S A;  3F3P C;  4A3J I;  3BG0 B;  1W2B Y;  3K7A I;  2NVX I;  3JAM b;  1VLA A;  4S1T A;  3CCL 1;  4E32 A;  1YIJ Z;  1R9T I;  3GTJ I;  1RQF A;  4AYB A;  1LQL A;  1ZB9 A;  5CM2 M;  1K8A 2;  2JA6 I;  1P9N A;  3KIH A;  2K5R A;  1PFT A;  3CC2 1;  2RBL A;  3H3V J;  1W2B Z;  1ZB8 A;  2OOX B;  1AA6 A;  1M90 1;  2I3C A;  2JNY A;  1TWF I;  1QVG Y;  3IX0 A;  2DE7 A;  5IP7 I;  4A93 I;  2OTJ 1;  4HGY A;  5C44 I;  2LIY A;  3F3F C;  2M6N A;  1N8R 2;  1ZH1 A;  4A3D I;  2W04 A;  3VMG A;  1WJ2 A;  3HOY I;  1VQO 1;  3S17 I;  1Q7Y 2;  1JWH C;  1VQP Z;  4XX2 A;  3G6E Z;  3G71 Z;  4A3I I;  4A3E I;  2OOY B;  1YUA A;  1YJN Z;  1X3W A;  2QR1 B;  2BJO A;  4MXU A;  3D9X A;  3I55 1;  3JAM f;  3PO3 I;  4NBG A;  1KD1 2;  1K83 I;  2YU9 I;  1Q16 A;  3S1R I;  2AYD A;  2E2H I;  3J80 b;  4QTT A;  3S16 I;  1VQ4 1;  1VQ8 Z;  1Y1V S;  3VMI A;  3D2L A;  1VQL Z;  2V8J A;  3GTK I;  2R7Z I;  4MRI A;  1Z01 A;  2QRC B;  3GTL I;  2OTL Z;  2VPW A;  1RO0 A;  3RZD I;  3S1Q I;  1TWH I;  5A2Q f;  2E9H A;  2KI7 B;  2V45 A;  1Q81 2;  1Y1V I;  2JA7 I;  2GTI A;  3I56 Z;  3IFU A;  1SFO I;  3VMH A;  3CCQ Z;  3M3Y I;  4A3K I;  1K8A 1;  1S72 1;  1FDI A;  2PM9 A;  4A3B I;  1Q86 2;  1KRL A;  2NAP A;  1ML8 A;  1Z02 A;  3KIF A;  4BY7 I;  2QRD B;  3P5J B;  3CCM 1;  1RNI A;  2Q51 A;  1RO4 A;  1NP6 A;  3J80 f;  5IP9 I;  3IR7 A;  4A3G I;  2JIR A;  1Q7Y 1;  2P3Y A;  3CC4 Z;  3NH8 A;  2VPY A;  3HOU I;  3BG1 B;  3CCR Z;  4MD8 A;  1N2F A;  2E2J I;  4RVG A;  4NOZ A;  5C4J I;  3CCE Z;  4Y52 I;  2V8K A;  4E31 A;  1KD1 1;  2NVY I;  3FKI I;  1M1K 2;  1YIJ 1;  3GCF A;  3FQM A;  2DE5 A;  5D1P A;  4NFR A;  4RVH A;  2IZ4 A;  1I6H I;  3MZL B;  5C4X I;  4HGZ A;  1YHQ Z;  3CMA Z;  1NJI 2;  1WZN A;  4HH4 A;  2NVQ I;  5IT9 b;  2W03 A;  4NBD A;  3G4S Z;  1NUI A;  3TDH B;  1Q81 1;  4A3C I;  3EED A;  4E2Y A;  2OZK A;  4MON A;  1X3Z A;  4TNU A;  4NBF A;  2WB1 A;  1X0T A;  1TFI A;  3CD6 Z;  3CCV Z;  1KC8 2;  3CPW Y;  1QVG Z;  2HF1 A;  2VPX A;  1VQP 1;  3G6E 1;  3G71 1;  1Q86 1;  1VQK Z;  1QXF A;  3H0G I;  1I50 I;  3MZK B;  1YJN 1;  4EWC A;  3D6W A;  5T64 A;  3S1N I;  2KPI A;  4NBC A;  4NB9 A;  2HU9 A;  3CPW Z;  2JA8 I; 
#chains in the Genus database with same CATH homology
 4A3L I;  3HOX I;  2IZ3 A;  2WAQ A;  3LUS A;  4E2W A;  1USP A;  3GTP I;  3J7A 4;  1VQ8 1;  4QTU A;  1VQL 1;  2YAD A;  2RPR A;  4DQY B;  5IT9 f;  2OTL 1;  3CCU Z;  3CCS Z;  4NBH A;  4NB8 A;  2QRE B;  3T4N B;  1QYP A;  4NBA A;  3CXC Y;  3I07 A;  3HOZ I;  3RZO I;  1VQ5 Z;  3HOV I;  1M1K 1;  3I56 1;  4BXX I;  5FLX b;  3U50 C;  3S2D I;  1KQS Y;  3S14 I;  2VUG A;  5C3E I;  3CCQ 1;  1QF8 A;  5T67 A;  1YJ9 Z;  4BBS I;  1VQM Z;  3GKQ A;  3GTM S;  1VQN Z;  1NJI 1;  1L1O C;  1VQ6 Z;  2J6A A;  2Q4Z A;  5LL6 f;  3I4N I;  3CXC Z;  3VB9 A;  2R6M A;  2QLV B;  1WCM I;  3GTQ I;  2K3R A;  4RV9 A;  1Z03 A;  2E2I I;  3HKZ A;  2G2K A;  1VQM 1;  3GTM I;  1KC8 1;  3CCJ Z;  3CCL Z;  3MON A;  2RIQ A;  1JJ2 Y;  2B63 I;  4RVD A;  3HOW I;  3CC4 1;  1Y1W I;  1WW9 A;  1RLY A;  2VF1 A;  3CCR 1;  3CC2 Z;  1K9M 1;  4MD9 A;  4RS4 A;  2QA4 Z;  3CCJ 1;  2LFU A;  2JS4 A;  1YJW Z;  3CC7 Z;  3CCE 1;  3S1M I;  4Y7N I;  1USP B;  2PK7 A;  2R93 I;  5FLX f;  1TWC I;  1JJ2 Z;  3NDJ A;  4NH1 C;  4DGL A;  2OTJ Z;  2O53 A;  1WII A;  3FQQ A;  2QA4 1;  2QKD A;  4DK1 A;  3M4O I;  1VQO Z;  3J81 b;  4BY1 I;  1K73 1;  2ZAE B;  1YJW 1;  3CC7 1;  2O4H A;  1VQ9 Z;  2AKL A;  5A2Q b;  1YHQ 1;  5D1O A;  3CMA 1;  2M48 A;  2EGT A;  4E2X A;  2DE6 A;  2H85 A;  3G4S 1;  1YI2 Z;  2JMO A;  2NVT I;  3I55 Z;  2JR6 A;  3S2H I;  3PO3 S;  3Q87 A;  1TWG I;  1VQ9 1;  1TWA I;  1K9M 2;  3CD6 1;  3CCV 1;  2GTH A;  2QEX Z;  1VQ4 Z;  3I4M I;  4MH4 A;  1YI2 1;  1VQ7 Z;  3ESW A;  1S7M A;  4X6A I;  1VQK 1;  3QWU A;  4E30 A;  3EER A;  3CME Z;  4RVF A;  2P28 A;  2VUM I;  4CL1 A;  5AN9 F;  3NDI A;  2QEX 1;  1K73 2;  3TE5 B;  1M90 2;  3PO2 I;  1YUK A;  1VQ7 1;  3CQZ I;  1Q82 1;  5T6B A;  3CME 1;  3J81 f;  3S15 I;  4A3M I;  3VTN A;  3NH4 A;  1S72 Z;  2F4O A;  3OW2 Y;  4MD7 A;  4NBE A;  4A3F I;  1QVF Y;  2F4M A;  3CCU 1;  5FLM I;  3CCS 1;  3GTO I;  1YIT Z;  2JUB A;  4BBR I;  3CCM Z;  1I3Q I;  4NBB A;  1VQ5 1;  1RO2 A;  2JA5 I;  3NH5 A;  2RHB A;  2PMZ A;  5D1O B;  3NFZ A;  4E2Z A;  2RT9 A;  3OW2 Z;  1DL6 A;  1YIT 1;  1YJ9 1;  1KQS Z;  3GTG I;  1QVF Z;  1VQN 1;  2GU2 A;  1VQ6 1;  4E33 A;  1Q82 2;  1N8R 1;  2R92 I;  2V8I A;  3IF8 A;  2Y0S A;  3F3P C;  4A3J I;  3BG0 B;  1W2B Y;  3K7A I;  2NVX I;  3JAM b;  1VLA A;  4S1T A;  3CCL 1;  4E32 A;  1YIJ Z;  1R9T I;  3GTJ I;  1RQF A;  4AYB A;  1LQL A;  1ZB9 A;  5CM2 M;  1K8A 2;  2JA6 I;  1P9N A;  3KIH A;  2K5R A;  1PFT A;  3CC2 1;  2RBL A;  3H3V J;  1W2B Z;  1ZB8 A;  2OOX B;  1M90 1;  2I3C A;  2JNY A;  1TWF I;  1QVG Y;  3IX0 A;  2DE7 A;  5IP7 I;  4A93 I;  2OTJ 1;  4HGY A;  5C44 I;  2LIY A;  3F3F C;  2M6N A;  1N8R 2;  1ZH1 A;  4A3D I;  2W04 A;  3VMG A;  3HOY I;  3S17 I;  1VQO 1;  1Q7Y 2;  1JWH C;  1VQP Z;  4XX2 A;  3G6E Z;  3G71 Z;  4A3I I;  4A3E I;  2OOY B;  1YUA A;  1YJN Z;  1X3W A;  2QR1 B;  2BJO A;  4MXU A;  3D9X A;  3I55 1;  3JAM f;  3PO3 I;  4NBG A;  1KD1 2;  1K83 I;  2YU9 I;  3S1R I;  2E2H I;  3J80 b;  4QTT A;  3S16 I;  1VQ4 1;  1VQ8 Z;  1Y1V S;  3VMI A;  1VQL Z;  2V8J A;  3GTK I;  2R7Z I;  4MRI A;  1Z01 A;  2QRC B;  3GTL I;  2OTL Z;  1RO0 A;  3RZD I;  3S1Q I;  1TWH I;  5A2Q f;  2E9H A;  2KI7 B;  1Q81 2;  1Y1V I;  2JA7 I;  2GTI A;  3I56 Z;  3IFU A;  1SFO I;  3VMH A;  3CCQ Z;  3M3Y I;  4A3K I;  1K8A 1;  1S72 1;  4A3B I;  2PM9 A;  1Q86 2;  1KRL A;  1ML8 A;  1Z02 A;  3KIF A;  4BY7 I;  2QRD B;  3P5J B;  3CCM 1;  1RNI A;  2Q51 A;  1RO4 A;  1NP6 A;  3J80 f;  5IP9 I;  4A3G I;  1Q7Y 1;  2P3Y A;  3CC4 Z;  3NH8 A;  3HOU I;  3BG1 B;  3CCR Z;  4MD8 A;  1N2F A;  2E2J I;  4RVG A;  4NOZ A;  5C4J I;  3CCE Z;  4Y52 I;  2V8K A;  4E31 A;  1KD1 1;  2NVY I;  3FKI I;  1M1K 2;  1YIJ 1;  3GCF A;  3FQM A;  2DE5 A;  5D1P A;  4NFR A;  4RVH A;  2IZ4 A;  1I6H I;  3MZL B;  5C4X I;  4HGZ A;  1YHQ Z;  3CMA Z;  1NJI 2;  4HH4 A;  2NVQ I;  5IT9 b;  2W03 A;  4NBD A;  3G4S Z;  1NUI A;  3TDH B;  1Q81 1;  4A3C I;  3EED A;  4E2Y A;  2OZK A;  4MON A;  1X3Z A;  4TNU A;  4NBF A;  2WB1 A;  1X0T A;  1TFI A;  3CD6 Z;  3CCV Z;  1KC8 2;  3CPW Y;  1QVG Z;  2HF1 A;  1VQP 1;  3G6E 1;  3G71 1;  1Q86 1;  1VQK Z;  3H0G I;  1I50 I;  3MZK B;  1YJN 1;  4EWC A;  3D6W A;  5T64 A;  3S1N I;  2KPI A;  4NBC A;  4NB9 A;  2HU9 A;  3CPW Z;  2JA8 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...