2LIYA

Plant peptide hormone regulating stomatal density
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
45
structure length
45
Chain Sequence
b'IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPIDERMAL PATTERNING FACTOR-like protein 9
publication title The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hormone
total genus 3
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.390 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2liyA00
2LIYA
chains in the Genus database with same CATH superfamily
3S1QI 3CCU1 3CC2Z 2J6AA 3NFZA 3CQZI 1ML8A 2P3YA 3J80f 3M4OI 1KQSZ 4A3JI 1VQM1 2QRCB 1S72Z 1VQ4Z 3CC41 3S1RI 1KQSY 4NBGA 1PFTA 1YUKA 2VPZA 1RNIA 5FLXb 3IX0A 1Q862 1USPA 4X6AI 2JS4A 1VQ7Z 5A2Qf 3NH4A 4QTUA 3MZKB 4HGYA 1VQ81 2PM9A 1QF8A 3CCSZ 1QVGZ 2G2KA 3CCR1 1Q861 2R7ZI 4RVGA 3T4NB 5C4XI 3I4MI 1W2BZ 1FDOA 3CME1 1QVGY 1R9TI 4A93I 1W2BY 2BJOA 1YJWZ 3J80b 4A3EI 3G71Z 3OW2Z 5C4JI 3EERA 1K83I 2NVQI 2P28A 1VQK1 2R93I 2O4HA 2GU2A 3OW2Y 2PK7A 1JJ2Z 1ZH1A 5D1OB 3F3PC 2HU9A 3F3FC 1RO0A 1QVFZ 2JUBA 2VUMI 3Q87A 5A2Qb 1JJ2Y 3CCLZ 1QVFY 3MZLB 3VMHA 4A3MI 5IP9I 3J7A4 2JIMA 2E7ZA 1VQNZ 2JA5I 2GTIA 3NH5A 2M6NA 1DL6A 2M48A 4QTTA 2OOXB 2RBLA 3JAMf 3M3YI 3CCQ1 2F4OA 3KIHA 1YHQZ 2EGTA 4BXXI 3PO3I 3TDHB 2KI7B 4A3II 3CCJZ 3I56Z 3ESWA 2QA4Z 1Y1VS 2PMZA 5IP7I 1YIJZ 1TWFI 3IF8A 3CMAZ 3G4S1 5D1OA 3I07A 4A3GI 4TNUA 1N2FA 3CC21 3U50C 2DE7A 3D9XA 4E32A 3RZDI 2LEXA 3JAMb 1VQ51 1VQ6Z 3KIFA 4NBFA 1NUIA 1TWGI 4MXUA 4HGZA 4E2WA 1S721 4A3CI 1YI21 4E31A 3S1NI 4E2ZA 4DK1A 3NDJA 3MONA 4MD7A 1FDIA 2V45A 4MONA 2QEXZ 1RLYA 1L1OC 3CCMZ 4RVDA 2GTHA 1Y1VI 2NVXI 4HH4A 3I551 1YJNZ 3HKZA 3CPWZ 1K8A2 4MD9A 4RVHA 3S16I 4RVFA 1WW9A 1YJ91 5CM2M 1NJI2 2V8KA 3CCS1 1WZNA 2QRDB 2VUGA 3CPWY 1TWCI 4A3BI 1VQMZ 1YITZ 3GKQA 3G6EZ 3CCV1 2JMOA 1VQ91 1QYPA 1X3ZA 3GTGI 1K8A1 2RT9A 1YJW1 3RZOI 3PO3S 1NJI1 3G711 2E9HA 5IT9f 2OTL1 2VF1A 1Q812 2OTJZ 4NBAA 3CD6Z 2VPWA 5LL6f 4DQYB 3S2HI 2I3CA 4XX2A 2RPRA 1TWAI 3CCEZ 2JA6I 2Q4ZA 3S2DI 4NB8A 1Q811 2K5RA 2LIYA 3CCL1 1ZB8A 3CMEZ 1Y1WI 2V8IA 5FLMI 2E2II 2QKDA 1VQN1 4Y7NI 3VTNA 1M902 4NB9A 2YU9I 1VQKZ 4A3KI 3S1MI 3LUSA 2DE5A 1AA6A 4BBRI 4E33A 1Z01A 2R92I 2H85A 5IT9b 1VQLZ 1VQOZ 1VLAA 3EEDA 3CCJ1 2OZKA 2F4MA 1M901 3I561 5D1PA 1QXFA 3CC7Z 3P5JB 3GTMI 1TWHI 1N8R2 1WJ2A 5AN9F 1K9M2 4S1TA 2IZ4A 4NBEA 2E2JI 2B63I 4A3FI 2JR6A 4RS4A 3K7AI 4NBHA 1USPB 1I6HI 1N8R1 4AYBA 3NDIA 1K9M1 1YUAA 3QWUA 2R6MA 1VQ61 3VB9A 3J81f 2O53A 3S15I 2W03A 4NBCA 3IR7A 2VPYA 3IFUA 4NFRA 2JA7I 1RO4A 4A3LI 1VQ41 4E2YA 4NBBA 4BBSI 1VQPZ 3GTPI 2NAPA 2QEX1 4DGLA 1WCMI 2IZ3A 2QR1B 2YADA 1VQ71 1YJN1 1X0TA 2JIOA 2VPXA 3CCUZ 4CL1A 1VQ5Z 2AKLA 2NVTI 2W04A 4MH4A 4BY1I 3HOYI 3HOZI 2JIRA 2Y0SA 3S14I 2IV2X 1RO2A 1YIT1 3G6E1 1LQLA 1YI2Z 3CC4Z 4RV9A 1NP6A 3J81b 1I50I 3GTQI 2OTJ1 2JNYA 4MRIA 2LFUA 3CD61 5C3EI 3I55Z 2WB1A 3I4NI 3PO2I 2Q51A 3GTMS 1VQ8Z 3S17I 1YJ9Z 3HOVI 4Y52I 1X3WA 3BG0B 3CCE1 2JIPA 1M1K2 2DE6A 2V8JA 3CCRZ 3CCVZ 1VQ9Z 2WAQA 2KPIA 2E2HI 4NH1C 2JIQA 2QLVB 1P9NA 1M1K1 3VMGA 3NH8A 2OTLZ 3GTLI 2HF1A 1Q822 1SIWA 3D6WA 2JA8I 1KRLA 1WIIA 1KC82 3GTOI 1Z03A 3H0GI 1VQL1 1S7MA 1VQO1 1YHQ1 1RQFA 1Q821 1Q7Y2 3TE5B 2NVYI 1KC81 4NBDA 2QA41 3CC71 5C44I 2K3RA 2V3VA 1YIJ1 1I3QI 3VMIA 3CMA1 1KD12 5T64A 4MD8A 4A3DI 3BG1B 3H3VJ 1Q7Y1 1Q16A 2ZAEB 2RIQA 2QREB 3FKII 3CCQZ 4E2XA 1K732 1JWHC 3HOWI 2RHBA 1KD11 3HOUI 3GCFA 5T6BA 3GTJI 3HOXI 3CXCZ 4EWCA 1Z02A 3CXCY 5FLXf 1K731 4BY7I 2AYDA 3GTKI 2OOYB 3D2LA 3FQQA 3G4SZ 1VQP1 1SFOI 1Y8CA 1TFIA 4NOZA 1ZB9A 5T67A 3FQMA 3CCM1 4E30A
chains in the Genus database with same CATH topology
3S1QI 3CCU1 3CC2Z 2J6AA 3NFZA 3CQZI 1ML8A 2P3YA 3J80f 3M4OI 1KQSZ 4A3JI 1VQM1 2QRCB 1S72Z 1VQ4Z 3CC41 3S1RI 1KQSY 4NBGA 1PFTA 1YUKA 1RNIA 5FLXb 3IX0A 1Q862 1USPA 4X6AI 2JS4A 1VQ7Z 5A2Qf 3NH4A 4QTUA 3MZKB 4HGYA 1VQ81 2PM9A 1QF8A 3CCSZ 1QVGZ 2G2KA 3CCR1 1Q861 2R7ZI 4RVGA 3T4NB 5C4XI 3I4MI 1W2BZ 3CME1 1QVGY 1R9TI 4A93I 1W2BY 2BJOA 1YJWZ 3J80b 4A3EI 3G71Z 3OW2Z 5C4JI 3EERA 1K83I 2NVQI 2P28A 1VQK1 2R93I 2O4HA 2GU2A 3OW2Y 2PK7A 1JJ2Z 1ZH1A 5D1OB 3F3PC 2HU9A 3F3FC 1RO0A 1QVFZ 2JUBA 2VUMI 3Q87A 5A2Qb 1JJ2Y 3CCLZ 1QVFY 3MZLB 3VMHA 4A3MI 5IP9I 3J7A4 1VQNZ 2JA5I 2GTIA 3NH5A 2M6NA 1DL6A 2M48A 4QTTA 2OOXB 2RBLA 3JAMf 3M3YI 3CCQ1 2F4OA 3KIHA 1YHQZ 2EGTA 4BXXI 3PO3I 3TDHB 2KI7B 4A3II 3CCJZ 3I56Z 3ESWA 2QA4Z 1Y1VS 2PMZA 5IP7I 1YIJZ 1TWFI 3IF8A 3CMAZ 3G4S1 5D1OA 3I07A 4A3GI 4TNUA 1N2FA 3CC21 3U50C 2DE7A 3D9XA 4E32A 3RZDI 3JAMb 1VQ51 1VQ6Z 3KIFA 4NBFA 1NUIA 1TWGI 4MXUA 4HGZA 4E2WA 1S721 4A3CI 1YI21 4E31A 3S1NI 4E2ZA 4DK1A 3NDJA 3MONA 4MD7A 4MONA 2QEXZ 1RLYA 1L1OC 3CCMZ 4RVDA 2GTHA 1Y1VI 2NVXI 4HH4A 3I551 1YJNZ 3HKZA 3CPWZ 1K8A2 4MD9A 4RVHA 3S16I 4RVFA 1WW9A 1YJ91 5CM2M 1NJI2 2V8KA 3CCS1 2QRDB 2VUGA 3CPWY 1TWCI 4A3BI 1VQMZ 1YITZ 3GKQA 3G6EZ 3CCV1 2JMOA 1VQ91 1QYPA 1X3ZA 3GTGI 1K8A1 2RT9A 1YJW1 3RZOI 3PO3S 1NJI1 3G711 2E9HA 5IT9f 2OTL1 2VF1A 1Q812 2OTJZ 4NBAA 3CD6Z 5LL6f 4DQYB 3S2HI 2I3CA 4XX2A 2RPRA 1TWAI 3CCEZ 2JA6I 2Q4ZA 3S2DI 4NB8A 1Q811 2K5RA 2LIYA 3CCL1 1ZB8A 3CMEZ 1Y1WI 2V8IA 5FLMI 2E2II 2QKDA 1VQN1 4Y7NI 3VTNA 1M902 4NB9A 2YU9I 1VQKZ 4A3KI 3S1MI 3LUSA 2DE5A 4BBRI 4E33A 1Z01A 2R92I 2H85A 5IT9b 1VQLZ 1VQOZ 1VLAA 3EEDA 3CCJ1 2OZKA 2F4MA 1M901 3I561 5D1PA 3CC7Z 3P5JB 3GTMI 1TWHI 1N8R2 5AN9F 1K9M2 4S1TA 2IZ4A 4NBEA 2E2JI 2B63I 4A3FI 2JR6A 4RS4A 3K7AI 4NBHA 1USPB 1I6HI 1N8R1 4AYBA 3NDIA 1K9M1 1YUAA 3QWUA 2R6MA 1VQ61 3VB9A 3J81f 2O53A 3S15I 2W03A 4NBCA 2JA7I 3IFUA 4NFRA 1RO4A 4A3LI 1VQ41 4E2YA 4NBBA 4BBSI 1VQPZ 3GTPI 2QEX1 4DGLA 1WCMI 2IZ3A 2QR1B 2YADA 1VQ71 1YJN1 1X0TA 3CCUZ 4CL1A 1VQ5Z 2AKLA 2NVTI 2W04A 4MH4A 4BY1I 3HOYI 3HOZI 2Y0SA 3S14I 1RO2A 1YIT1 1LQLA 3G6E1 1YI2Z 3CC4Z 4RV9A 1NP6A 3J81b 1I50I 3GTQI 2OTJ1 2JNYA 4MRIA 2LFUA 3CD61 5C3EI 3I55Z 2WB1A 3I4NI 3PO2I 2Q51A 3GTMS 1VQ8Z 3S17I 1YJ9Z 3HOVI 4Y52I 1X3WA 3BG0B 3CCE1 1M1K2 2DE6A 2V8JA 3CCRZ 3CCVZ 1VQ9Z 2WAQA 2KPIA 2E2HI 4NH1C 2QLVB 1P9NA 1M1K1 3VMGA 3NH8A 2OTLZ 3GTLI 2HF1A 1Q822 3D6WA 2JA8I 1KRLA 1WIIA 1KC82 3GTOI 1Z03A 3H0GI 1VQL1 1S7MA 1VQO1 1YHQ1 1RQFA 1Q821 1Q7Y2 3TE5B 2NVYI 1KC81 4NBDA 2QA41 3CC71 5C44I 2K3RA 1YIJ1 1I3QI 3VMIA 3CMA1 1KD12 5T64A 4MD8A 4A3DI 3BG1B 3H3VJ 1Q7Y1 2ZAEB 2RIQA 2QREB 3FKII 3CCQZ 4E2XA 1K732 1JWHC 3HOWI 2RHBA 1KD11 3HOUI 3GCFA 5T6BA 3GTJI 3HOXI 3CXCZ 4EWCA 1Z02A 3CXCY 5FLXf 1K731 4BY7I 3GTKI 2OOYB 3FQQA 3G4SZ 1VQP1 1SFOI 1TFIA 4NOZA 1ZB9A 5T67A 3FQMA 3CCM1 4E30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIY A; 
#chains in the Genus database with same CATH topology
 3S1Q I;  3CCU 1;  3CC2 Z;  2J6A A;  3NFZ A;  3CQZ I;  1ML8 A;  2P3Y A;  3J80 f;  3M4O I;  1KQS Z;  4A3J I;  1VQM 1;  2QRC B;  1S72 Z;  1VQ4 Z;  3CC4 1;  3S1R I;  1KQS Y;  4NBG A;  1PFT A;  1YUK A;  2VPZ A;  1RNI A;  5FLX b;  3IX0 A;  1Q86 2;  1USP A;  4X6A I;  2JS4 A;  1VQ7 Z;  5A2Q f;  3NH4 A;  4QTU A;  3MZK B;  4HGY A;  1VQ8 1;  2PM9 A;  1QF8 A;  3CCS Z;  1QVG Z;  2G2K A;  3CCR 1;  1Q86 1;  2R7Z I;  4RVG A;  3T4N B;  5C4X I;  3I4M I;  1W2B Z;  1FDO A;  3CME 1;  1QVG Y;  1R9T I;  4A93 I;  1W2B Y;  2BJO A;  1YJW Z;  3J80 b;  4A3E I;  3G71 Z;  3OW2 Z;  5C4J I;  3EER A;  1K83 I;  2NVQ I;  2P28 A;  1VQK 1;  2R93 I;  2O4H A;  2GU2 A;  3OW2 Y;  2PK7 A;  1JJ2 Z;  1ZH1 A;  5D1O B;  3F3P C;  2HU9 A;  3F3F C;  1RO0 A;  1QVF Z;  2JUB A;  2VUM I;  3Q87 A;  5A2Q b;  1JJ2 Y;  3CCL Z;  1QVF Y;  3MZL B;  3VMH A;  4A3M I;  5IP9 I;  3J7A 4;  2JIM A;  2E7Z A;  1VQN Z;  2JA5 I;  2GTI A;  3NH5 A;  2M6N A;  1DL6 A;  2M48 A;  4QTT A;  2OOX B;  2RBL A;  3JAM f;  3M3Y I;  3CCQ 1;  2F4O A;  3KIH A;  1YHQ Z;  2EGT A;  4BXX I;  3PO3 I;  3TDH B;  2KI7 B;  4A3I I;  3CCJ Z;  3I56 Z;  3ESW A;  2QA4 Z;  1Y1V S;  2PMZ A;  5IP7 I;  1YIJ Z;  1TWF I;  3IF8 A;  3CMA Z;  3G4S 1;  5D1O A;  3I07 A;  4A3G I;  4TNU A;  1N2F A;  3CC2 1;  3U50 C;  2DE7 A;  3D9X A;  4E32 A;  3RZD I;  2LEX A;  3JAM b;  1VQ5 1;  1VQ6 Z;  3KIF A;  4NBF A;  1NUI A;  1TWG I;  4MXU A;  4HGZ A;  4E2W A;  1S72 1;  4A3C I;  1YI2 1;  4E31 A;  3S1N I;  4E2Z A;  4DK1 A;  3NDJ A;  3MON A;  4MD7 A;  1FDI A;  2V45 A;  4MON A;  2QEX Z;  1RLY A;  1L1O C;  3CCM Z;  4RVD A;  2GTH A;  1Y1V I;  2NVX I;  4HH4 A;  3I55 1;  1YJN Z;  3HKZ A;  3CPW Z;  1K8A 2;  4MD9 A;  4RVH A;  3S16 I;  4RVF A;  1WW9 A;  1YJ9 1;  5CM2 M;  1NJI 2;  2V8K A;  3CCS 1;  1WZN A;  2QRD B;  2VUG A;  3CPW Y;  1TWC I;  4A3B I;  1VQM Z;  1YIT Z;  3GKQ A;  3G6E Z;  3CCV 1;  2JMO A;  1VQ9 1;  1QYP A;  1X3Z A;  3GTG I;  1K8A 1;  2RT9 A;  1YJW 1;  3RZO I;  3PO3 S;  1NJI 1;  3G71 1;  2E9H A;  5IT9 f;  2OTL 1;  2VF1 A;  1Q81 2;  2OTJ Z;  4NBA A;  3CD6 Z;  2VPW A;  5LL6 f;  4DQY B;  3S2H I;  2I3C A;  4XX2 A;  2RPR A;  1TWA I;  3CCE Z;  2JA6 I;  2Q4Z A;  3S2D I;  4NB8 A;  1Q81 1;  2K5R A;  2LIY A;  3CCL 1;  1ZB8 A;  3CME Z;  1Y1W I;  2V8I A;  5FLM I;  2E2I I;  2QKD A;  1VQN 1;  4Y7N I;  3VTN A;  1M90 2;  4NB9 A;  2YU9 I;  1VQK Z;  4A3K I;  3S1M I;  3LUS A;  2DE5 A;  1AA6 A;  4BBR I;  4E33 A;  1Z01 A;  2R92 I;  2H85 A;  5IT9 b;  1VQL Z;  1VQO Z;  1VLA A;  3EED A;  3CCJ 1;  2OZK A;  2F4M A;  1M90 1;  3I56 1;  5D1P A;  1QXF A;  3CC7 Z;  3P5J B;  3GTM I;  1TWH I;  1N8R 2;  1WJ2 A;  5AN9 F;  1K9M 2;  4S1T A;  2IZ4 A;  4NBE A;  2E2J I;  2B63 I;  4A3F I;  2JR6 A;  4RS4 A;  3K7A I;  4NBH A;  1USP B;  1I6H I;  1N8R 1;  4AYB A;  3NDI A;  1K9M 1;  1YUA A;  3QWU A;  2R6M A;  1VQ6 1;  3VB9 A;  3J81 f;  2O53 A;  3S15 I;  2W03 A;  4NBC A;  3IR7 A;  2VPY A;  3IFU A;  4NFR A;  2JA7 I;  1RO4 A;  4A3L I;  1VQ4 1;  4E2Y A;  4NBB A;  4BBS I;  1VQP Z;  3GTP I;  2NAP A;  2QEX 1;  4DGL A;  1WCM I;  2IZ3 A;  2QR1 B;  2YAD A;  1VQ7 1;  1YJN 1;  1X0T A;  2JIO A;  2VPX A;  3CCU Z;  4CL1 A;  1VQ5 Z;  2AKL A;  2NVT I;  2W04 A;  4MH4 A;  4BY1 I;  3HOY I;  3HOZ I;  2JIR A;  2Y0S A;  3S14 I;  2IV2 X;  1RO2 A;  1YIT 1;  3G6E 1;  1LQL A;  1YI2 Z;  3CC4 Z;  4RV9 A;  1NP6 A;  3J81 b;  1I50 I;  3GTQ I;  2OTJ 1;  2JNY A;  4MRI A;  2LFU A;  3CD6 1;  5C3E I;  3I55 Z;  2WB1 A;  3I4N I;  3PO2 I;  2Q51 A;  3GTM S;  1VQ8 Z;  3S17 I;  1YJ9 Z;  3HOV I;  4Y52 I;  1X3W A;  3BG0 B;  3CCE 1;  2JIP A;  1M1K 2;  2DE6 A;  2V8J A;  3CCR Z;  3CCV Z;  1VQ9 Z;  2WAQ A;  2KPI A;  2E2H I;  4NH1 C;  2JIQ A;  2QLV B;  1P9N A;  1M1K 1;  3VMG A;  3NH8 A;  2OTL Z;  3GTL I;  2HF1 A;  1Q82 2;  1SIW A;  3D6W A;  2JA8 I;  1KRL A;  1WII A;  1KC8 2;  3GTO I;  1Z03 A;  3H0G I;  1VQL 1;  1S7M A;  1VQO 1;  1YHQ 1;  1RQF A;  1Q82 1;  1Q7Y 2;  3TE5 B;  2NVY I;  1KC8 1;  4NBD A;  2QA4 1;  3CC7 1;  5C44 I;  2K3R A;  2V3V A;  1YIJ 1;  1I3Q I;  3VMI A;  3CMA 1;  1KD1 2;  5T64 A;  4MD8 A;  4A3D I;  3BG1 B;  3H3V J;  1Q7Y 1;  1Q16 A;  2ZAE B;  2RIQ A;  2QRE B;  3FKI I;  3CCQ Z;  4E2X A;  1K73 2;  1JWH C;  3HOW I;  2RHB A;  1KD1 1;  3HOU I;  3GCF A;  5T6B A;  3GTJ I;  3HOX I;  3CXC Z;  4EWC A;  1Z02 A;  3CXC Y;  5FLX f;  1K73 1;  4BY7 I;  2AYD A;  3GTK I;  2OOY B;  3D2L A;  3FQQ A;  3G4S Z;  1VQP 1;  1SFO I;  1Y8C A;  1TFI A;  4NOZ A;  1ZB9 A;  5T67 A;  3FQM A;  3CCM 1;  4E30 A; 
#chains in the Genus database with same CATH homology
 3S1Q I;  3CCU 1;  3CC2 Z;  2J6A A;  3NFZ A;  3CQZ I;  1ML8 A;  2P3Y A;  3J80 f;  3M4O I;  1KQS Z;  4A3J I;  1VQM 1;  2QRC B;  1S72 Z;  1VQ4 Z;  3CC4 1;  3S1R I;  1KQS Y;  4NBG A;  1PFT A;  1YUK A;  1RNI A;  5FLX b;  3IX0 A;  1Q86 2;  1USP A;  4X6A I;  2JS4 A;  1VQ7 Z;  5A2Q f;  3NH4 A;  4QTU A;  3MZK B;  4HGY A;  1VQ8 1;  2PM9 A;  1QF8 A;  3CCS Z;  1QVG Z;  2G2K A;  3CCR 1;  1Q86 1;  2R7Z I;  4RVG A;  3T4N B;  5C4X I;  3I4M I;  1W2B Z;  3CME 1;  1QVG Y;  1R9T I;  4A93 I;  1W2B Y;  2BJO A;  1YJW Z;  3J80 b;  4A3E I;  3G71 Z;  3OW2 Z;  5C4J I;  3EER A;  1K83 I;  2NVQ I;  2P28 A;  1VQK 1;  2R93 I;  2O4H A;  2GU2 A;  3OW2 Y;  2PK7 A;  1JJ2 Z;  1ZH1 A;  5D1O B;  3F3P C;  2HU9 A;  3F3F C;  1RO0 A;  1QVF Z;  2JUB A;  2VUM I;  3Q87 A;  5A2Q b;  1JJ2 Y;  3CCL Z;  1QVF Y;  3MZL B;  3VMH A;  4A3M I;  5IP9 I;  3J7A 4;  1VQN Z;  2JA5 I;  2GTI A;  3NH5 A;  2M6N A;  1DL6 A;  2M48 A;  4QTT A;  2OOX B;  2RBL A;  3JAM f;  3M3Y I;  3CCQ 1;  2F4O A;  3KIH A;  1YHQ Z;  2EGT A;  4BXX I;  3PO3 I;  3TDH B;  2KI7 B;  4A3I I;  3CCJ Z;  3I56 Z;  3ESW A;  2QA4 Z;  1Y1V S;  2PMZ A;  5IP7 I;  1YIJ Z;  1TWF I;  3IF8 A;  3CMA Z;  3G4S 1;  5D1O A;  3I07 A;  4A3G I;  4TNU A;  1N2F A;  3CC2 1;  3U50 C;  2DE7 A;  3D9X A;  4E32 A;  3RZD I;  3JAM b;  1VQ5 1;  1VQ6 Z;  3KIF A;  4NBF A;  1NUI A;  1TWG I;  4MXU A;  4HGZ A;  4E2W A;  1S72 1;  4A3C I;  1YI2 1;  4E31 A;  3S1N I;  4E2Z A;  4DK1 A;  3NDJ A;  3MON A;  4MD7 A;  4MON A;  2QEX Z;  1RLY A;  1L1O C;  3CCM Z;  4RVD A;  2GTH A;  1Y1V I;  2NVX I;  4HH4 A;  3I55 1;  1YJN Z;  3HKZ A;  3CPW Z;  1K8A 2;  4MD9 A;  4RVH A;  3S16 I;  4RVF A;  1WW9 A;  1YJ9 1;  5CM2 M;  1NJI 2;  2V8K A;  3CCS 1;  2QRD B;  2VUG A;  3CPW Y;  1TWC I;  4A3B I;  1VQM Z;  1YIT Z;  3GKQ A;  3G6E Z;  3CCV 1;  2JMO A;  1VQ9 1;  1QYP A;  1X3Z A;  3GTG I;  1K8A 1;  2RT9 A;  1YJW 1;  3RZO I;  3PO3 S;  1NJI 1;  3G71 1;  2E9H A;  5IT9 f;  2OTL 1;  2VF1 A;  1Q81 2;  2OTJ Z;  4NBA A;  3CD6 Z;  5LL6 f;  4DQY B;  3S2H I;  2I3C A;  4XX2 A;  2RPR A;  1TWA I;  3CCE Z;  2JA6 I;  2Q4Z A;  3S2D I;  4NB8 A;  1Q81 1;  2K5R A;  2LIY A;  3CCL 1;  1ZB8 A;  3CME Z;  1Y1W I;  2V8I A;  5FLM I;  2E2I I;  2QKD A;  1VQN 1;  4Y7N I;  3VTN A;  1M90 2;  4NB9 A;  2YU9 I;  1VQK Z;  4A3K I;  3S1M I;  3LUS A;  2DE5 A;  4BBR I;  4E33 A;  1Z01 A;  2R92 I;  2H85 A;  5IT9 b;  1VQL Z;  1VQO Z;  1VLA A;  3EED A;  3CCJ 1;  2OZK A;  2F4M A;  1M90 1;  3I56 1;  5D1P A;  3CC7 Z;  3P5J B;  3GTM I;  1TWH I;  1N8R 2;  5AN9 F;  1K9M 2;  4S1T A;  2IZ4 A;  4NBE A;  2E2J I;  2B63 I;  4A3F I;  2JR6 A;  4RS4 A;  3K7A I;  4NBH A;  1USP B;  1I6H I;  1N8R 1;  4AYB A;  3NDI A;  1K9M 1;  1YUA A;  3QWU A;  2R6M A;  1VQ6 1;  3VB9 A;  3J81 f;  2O53 A;  3S15 I;  2W03 A;  4NBC A;  2JA7 I;  3IFU A;  4NFR A;  1RO4 A;  4A3L I;  1VQ4 1;  4E2Y A;  4NBB A;  4BBS I;  1VQP Z;  3GTP I;  2QEX 1;  4DGL A;  1WCM I;  2IZ3 A;  2QR1 B;  2YAD A;  1VQ7 1;  1YJN 1;  1X0T A;  3CCU Z;  4CL1 A;  1VQ5 Z;  2AKL A;  2NVT I;  2W04 A;  4MH4 A;  4BY1 I;  3HOY I;  3HOZ I;  2Y0S A;  3S14 I;  1RO2 A;  1YIT 1;  1LQL A;  3G6E 1;  1YI2 Z;  3CC4 Z;  4RV9 A;  1NP6 A;  3J81 b;  1I50 I;  3GTQ I;  2OTJ 1;  2JNY A;  4MRI A;  2LFU A;  3CD6 1;  5C3E I;  3I55 Z;  2WB1 A;  3I4N I;  3PO2 I;  2Q51 A;  3GTM S;  1VQ8 Z;  3S17 I;  1YJ9 Z;  3HOV I;  4Y52 I;  1X3W A;  3BG0 B;  3CCE 1;  1M1K 2;  2DE6 A;  2V8J A;  3CCR Z;  3CCV Z;  1VQ9 Z;  2WAQ A;  2KPI A;  2E2H I;  4NH1 C;  2QLV B;  1P9N A;  1M1K 1;  3VMG A;  3NH8 A;  2OTL Z;  3GTL I;  2HF1 A;  1Q82 2;  3D6W A;  2JA8 I;  1KRL A;  1WII A;  1KC8 2;  3GTO I;  1Z03 A;  3H0G I;  1VQL 1;  1S7M A;  1VQO 1;  1YHQ 1;  1RQF A;  1Q82 1;  1Q7Y 2;  3TE5 B;  2NVY I;  1KC8 1;  4NBD A;  2QA4 1;  3CC7 1;  5C44 I;  2K3R A;  1YIJ 1;  1I3Q I;  3VMI A;  3CMA 1;  1KD1 2;  5T64 A;  4MD8 A;  4A3D I;  3BG1 B;  3H3V J;  1Q7Y 1;  2ZAE B;  2RIQ A;  2QRE B;  3FKI I;  3CCQ Z;  4E2X A;  1K73 2;  1JWH C;  3HOW I;  2RHB A;  1KD1 1;  3HOU I;  3GCF A;  5T6B A;  3GTJ I;  3HOX I;  3CXC Z;  4EWC A;  1Z02 A;  3CXC Y;  5FLX f;  1K73 1;  4BY7 I;  3GTK I;  2OOY B;  3FQQ A;  3G4S Z;  1VQP 1;  1SFO I;  1TFI A;  4NOZ A;  1ZB9 A;  5T67 A;  3FQM A;  3CCM 1;  4E30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...