2LIYA

Plant peptide hormone regulating stomatal density
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
45
structure length
45
Chain Sequence
IGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone
molecule keywords EPIDERMAL PATTERNING FACTOR-like protein 9
publication title The NMR structure of stomagen reveals the basis of stomatal density regulation by plant peptide hormones
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 3
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.390 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2liyA00
2LIYA
chains in the Genus database with same CATH superfamily
2QKDA 4EWCA 2V8JA 4NFRA 4RS4A 2P28A 2QA41 1Q822 3J81f 1Y1VI 2DE6A 3CQZI 3CMEZ 3KIHA 2GTHA 3S16I 4RVDA 1SIWA 3U50C 1QF8A 2NVXI 2YU9I 1ZB8A 2JA6I 2R93I 1YIJZ 1WW9A 1R9TI 2E7ZA 3CCUZ 2HF1A 3D6WA 3PO3S 1N8R1 2VPWA 1VQ6Z 2IZ4A 2OTL1 3FKII 3D9XA 4TNUA 1Y8CA 1RO4A 5AN9F 1VQ5Z 2P3YA 1S72Z 3GTPI 3HOUI 2KI7B 1K732 1NP6A 2JIQA 2RIQA 3D2LA 1NJI1 3T4NB 1YJNZ 1Z01A 3CCSZ 4DGLA 3GTMS 1KRLA 2V45A 1WCMI 1USPB 2M48A 1YI2Z 3J80b 3S2DI 3IX0A 5CM2M 3CD6Z 4MXUA 5T64A 4HGYA 1I50I 1VQN1 3CCQ1 1ZH1A 3TDHB 3S1QI 2NVQI 3RZOI 2VUMI 3CMAZ 3IFUA 3VB9A 4BBRI 1VQ7Z 4MD7A 2NAPA 4NBEA 5C4XI 2Q4ZA 2J6AA 2I3CA 2QA4Z 4E33A 4A3FI 1VQLZ 2IZ3A 1N8R2 1RO2A 2F4MA 3OW2Y 3TE5B 3CCJZ 4E32A 1S721 3FQQA 1QYPA 3S15I 3NDJA 3CPWY 3NDIA 2QEX1 2R7ZI 1P9NA 1Q861 3NH5A 3CCS1 1QXFA 1I3QI 2WB1A 2ZAEB 3PO2I 3I4NI 3IR7A 4RV9A 1JJ2Z 2W04A 2VF1A 1NJI2 5IP9I 1YI21 1KD12 3CCV1 3M3YI 1DL6A 2OTLZ 4MD9A 3CD61 2G2KA 1ML8A 1Y1VS 1X3ZA 3ESWA 4NB8A 1PFTA 2QREB 3QWUA 3CMA1 3VMHA 3J80f 2LEXA 1VQ71 4MONA 3CXCZ 2JIMA 2IV2X 2QRDB 1YITZ 2OOXB 1Y1WI 1Z03A 1VQL1 1Q811 3H0GI 3CCJ1 4MRIA 3CCRZ 4RVGA 4DQYB 2BJOA 1VQ8Z 2E9HA 3CCL1 2OZKA 3RZDI 5C3EI 1VQNZ 2VPXA 3CCQZ 1QVFY 4BY7I 2JA8I 2RPRA 4AYBA 1VQKZ 3GTOI 1WJ2A 5IT9b 2VPZA 3Q87A 3P5JB 2K5RA 3S1MI 3CC71 1Q862 1I6HI 1WZNA 2DE5A 1RO0A 1TWFI 4RVFA 4E2ZA 1YJ91 1FDIA 2JR6A 5T6BA 2R92I 2DE7A 1Q7Y1 2QEXZ 4Y52I 4Y7NI 3S1NI 1KC81 1VQP1 1YIT1 2M6NA 4MH4A 1YUKA 2F4OA 3MZLB 3GTJI 4E2YA 2NVYI 1TWAI 3GTLI 2YADA 2R6MA 3VMIA 3CCR1 3CCVZ 2E2II 1VQ81 3I56Z 5D1OA 1Q812 2JA5I 3HOVI 2JUBA 3G6EZ 1VQK1 5FLMI 3JAMb 3CC2Z 4BY1I 3J7A4 2OTJ1 3CCEZ 3I551 3S2HI 2EGTA 1TFIA 3F3PC 4NOZA 2JMOA 3CCMZ 3HOZI 3NH8A 5IT9f 2JIPA 1TWGI 2W03A 4X6AI 3HOYI 3OW2Z 3BG0B 3CCLZ 1KQSZ 4A3BI 3VMGA 2JIRA 4NBAA 3CC41 3EERA 3IF8A 3GKQA 1Q7Y2 1SFOI 4A3LI 1FDOA 3CC7Z 1KC82 3NH4A 1W2BY 3I561 4NBHA 4A3KI 1Z02A 4A3CI 4A3MI 3G6E1 1VLAA 2PM9A 3VTNA 1YJ9Z 2NVTI 1X3WA 3S14I 5LL6f 3GTKI 1AA6A 4NBDA 2LFUA 3CC21 1VQM1 3CCE1 1VQPZ 3M4OI 1YHQ1 1VQOZ 3GCFA 3CCM1 1QVGY 3JAMf 2GU2A 3S1RI 2OOYB 5A2Qb 2K3RA 2GTIA 1VQ4Z 1YUAA 2V8IA 2E2JI 4A3II 1USPA 2AKLA 4E2XA 2V8KA 1M901 1QVFZ 5C44I 5FLXb 1K8A1 2OTJZ 2HU9A 3I55Z 3F3FC 2V3VA 3BG1B 1M1K1 3I4MI 2JS4A 3MONA 4HH4A 2KPIA 3EEDA 1RLYA 1L1OC 4E30A 5T67A 3GTQI 2VUGA 3CC4Z 4RVHA 3G711 4NBFA 2B63I 1TWCI 1K9M1 2JA7I 2VPYA 1VQO1 1RQFA 2JIOA 4S1TA 3K7AI 4NH1C 1VQ41 5D1PA 3G4S1 3PO3I 1NUIA 2RBLA 3LUSA 2QLVB 1KD11 2Y0SA 4E2WA 5A2Qf 1VQMZ 2O4HA 3CME1 1JWHC 1M902 1YJWZ 3I07A 4A3JI 2O53A 1YHQZ 2JNYA 1YIJ1 3NFZA 5FLXf 1K83I 1ZB9A 1K8A2 3KIFA 2AYDA 1Q16A 1VQ9Z 2H85A 3CCU1 1N2FA 3J81b 2PMZA 2QRCB 3GTMI 3H3VJ 1Q821 2LIYA 1M1K2 2RHBA 4QTTA 3CPWZ 3GTGI 1VQ61 4A93I 1S7MA 2Q51A 4NBBA 3HKZA 3HOWI 2QR1B 4A3GI 4XX2A 3MZKB 1KQSY 4CL1A 1VQ51 4BBSI 1K9M2 4BXXI 4MD8A 3S17I 1W2BZ 4NBGA 2RT9A 4A3EI 2E2HI 2PK7A 4HGZA 1YJN1 4NBCA 1JJ2Y 5D1OB 5IP7I 4QTUA 3G71Z 5C4JI 1YJW1 1TWHI 1K731 4DK1A 3FQMA 1RNIA 3HOXI 1QVGZ 1VQ91 4NB9A 2WAQA 1X0TA 1LQLA 4E31A 4A3DI 1WIIA 3G4SZ 3CXCY
chains in the Genus database with same CATH topology
2QKDA 4EWCA 2V8JA 4NFRA 4RS4A 2P28A 2QA41 1Q822 3J81f 1Y1VI 2DE6A 3CQZI 3CMEZ 3KIHA 2GTHA 3S16I 4RVDA 3U50C 1QF8A 2NVXI 2YU9I 1ZB8A 2JA6I 2R93I 1YIJZ 1WW9A 1R9TI 3CCUZ 2HF1A 3D6WA 3PO3S 1N8R1 1VQ6Z 2IZ4A 2OTL1 3FKII 3D9XA 4TNUA 1RO4A 5AN9F 1VQ5Z 2P3YA 1S72Z 3GTPI 3HOUI 2KI7B 1K732 1NP6A 2RIQA 1NJI1 3T4NB 1YJNZ 1Z01A 3CCSZ 4DGLA 3GTMS 1KRLA 1WCMI 1USPB 2M48A 1YI2Z 3J80b 3S2DI 3IX0A 5CM2M 3CD6Z 4MXUA 5T64A 4HGYA 1I50I 1VQN1 3CCQ1 1ZH1A 3TDHB 3S1QI 2NVQI 3RZOI 2VUMI 3CMAZ 3IFUA 3VB9A 4BBRI 1VQ7Z 4MD7A 4NBEA 5C4XI 2Q4ZA 2J6AA 2I3CA 2QA4Z 4E33A 4A3FI 1VQLZ 2IZ3A 1N8R2 1RO2A 2F4MA 3OW2Y 3TE5B 3CCJZ 4E32A 1S721 3FQQA 1QYPA 3S15I 3NDJA 3CPWY 3NDIA 2QEX1 2R7ZI 1P9NA 1Q861 3NH5A 3CCS1 1I3QI 2WB1A 2ZAEB 3PO2I 3I4NI 4RV9A 1JJ2Z 2W04A 2VF1A 1NJI2 5IP9I 1YI21 1KD12 3CCV1 3M3YI 1DL6A 2OTLZ 4MD9A 3CD61 2G2KA 1ML8A 1Y1VS 1X3ZA 3ESWA 4NB8A 1PFTA 2QREB 3QWUA 3CMA1 3VMHA 3J80f 1VQ71 4MONA 3CXCZ 2QRDB 1YITZ 2OOXB 1Y1WI 1Z03A 1VQL1 1Q811 3H0GI 3CCJ1 4MRIA 3CCRZ 4RVGA 4DQYB 2BJOA 1VQ8Z 2E9HA 3CCL1 2OZKA 3RZDI 5C3EI 1VQNZ 3CCQZ 1QVFY 4BY7I 2JA8I 2RPRA 4AYBA 1VQKZ 3GTOI 5IT9b 3Q87A 3P5JB 2K5RA 3S1MI 3CC71 1Q862 1I6HI 2DE5A 1RO0A 1TWFI 4RVFA 4E2ZA 1YJ91 2JR6A 5T6BA 2R92I 2DE7A 1Q7Y1 2QEXZ 4Y52I 4Y7NI 3S1NI 1KC81 1VQP1 1YIT1 2M6NA 4MH4A 1YUKA 2F4OA 3MZLB 3GTJI 4E2YA 2NVYI 1TWAI 3GTLI 2YADA 2R6MA 3VMIA 3CCR1 3CCVZ 2E2II 1VQ81 3I56Z 5D1OA 1Q812 2JA5I 3HOVI 2JUBA 3G6EZ 1VQK1 5FLMI 3JAMb 3CC2Z 4BY1I 3J7A4 2OTJ1 3CCEZ 3I551 3S2HI 2EGTA 1TFIA 3F3PC 4NOZA 2JMOA 3CCMZ 3HOZI 3NH8A 5IT9f 1TWGI 2W03A 4X6AI 3HOYI 3OW2Z 3BG0B 3CCLZ 1KQSZ 4A3BI 3VMGA 4NBAA 3CC41 3EERA 3IF8A 3GKQA 1Q7Y2 1SFOI 4A3LI 3CC7Z 1KC82 3NH4A 1W2BY 3I561 4NBHA 4A3KI 1Z02A 4A3CI 4A3MI 3G6E1 1VLAA 2PM9A 3VTNA 1YJ9Z 2NVTI 1X3WA 3S14I 5LL6f 3GTKI 4NBDA 2LFUA 3CC21 1VQM1 3CCE1 1VQPZ 3M4OI 1YHQ1 1VQOZ 3GCFA 3CCM1 1QVGY 3JAMf 2GU2A 3S1RI 2OOYB 5A2Qb 2K3RA 2GTIA 1VQ4Z 1YUAA 2V8IA 2E2JI 4A3II 1USPA 2AKLA 4E2XA 2V8KA 1M901 1QVFZ 5C44I 5FLXb 1K8A1 2OTJZ 2HU9A 3I55Z 3F3FC 3BG1B 1M1K1 3I4MI 2JS4A 3MONA 4HH4A 2KPIA 3EEDA 1RLYA 1L1OC 4E30A 5T67A 3GTQI 2VUGA 3CC4Z 4RVHA 3G711 4NBFA 2B63I 1TWCI 1K9M1 2JA7I 1VQO1 1RQFA 4S1TA 3K7AI 4NH1C 1VQ41 5D1PA 3G4S1 3PO3I 1NUIA 2RBLA 3LUSA 2QLVB 1KD11 2Y0SA 4E2WA 5A2Qf 1VQMZ 2O4HA 3CME1 1JWHC 1M902 1YJWZ 3I07A 4A3JI 2O53A 1YHQZ 2JNYA 1YIJ1 3NFZA 5FLXf 1K83I 1ZB9A 1K8A2 3KIFA 1VQ9Z 2H85A 3CCU1 1N2FA 3J81b 2PMZA 2QRCB 3GTMI 3H3VJ 1Q821 2LIYA 1M1K2 2RHBA 4QTTA 3CPWZ 3GTGI 1VQ61 4A93I 1S7MA 2Q51A 4NBBA 3HKZA 3HOWI 2QR1B 4A3GI 4XX2A 3MZKB 1KQSY 4CL1A 1VQ51 4BBSI 1K9M2 4BXXI 4MD8A 3S17I 1W2BZ 4NBGA 2RT9A 4A3EI 2E2HI 2PK7A 4HGZA 1YJN1 4NBCA 1JJ2Y 5D1OB 5IP7I 4QTUA 3G71Z 5C4JI 1YJW1 1TWHI 1K731 4DK1A 3FQMA 1RNIA 3HOXI 1QVGZ 1VQ91 4NB9A 2WAQA 1X0TA 1LQLA 4E31A 4A3DI 1WIIA 3G4SZ 3CXCY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIY A; 
#chains in the Genus database with same CATH topology
 2QKD A;  4EWC A;  2V8J A;  4NFR A;  4RS4 A;  2P28 A;  2QA4 1;  1Q82 2;  3J81 f;  1Y1V I;  2DE6 A;  3CQZ I;  3CME Z;  3KIH A;  2GTH A;  3S16 I;  4RVD A;  1SIW A;  3U50 C;  1QF8 A;  2NVX I;  2YU9 I;  1ZB8 A;  2JA6 I;  2R93 I;  1YIJ Z;  1WW9 A;  1R9T I;  2E7Z A;  3CCU Z;  2HF1 A;  3D6W A;  3PO3 S;  1N8R 1;  2VPW A;  1VQ6 Z;  2IZ4 A;  2OTL 1;  3FKI I;  3D9X A;  4TNU A;  1Y8C A;  1RO4 A;  5AN9 F;  1VQ5 Z;  2P3Y A;  1S72 Z;  3GTP I;  3HOU I;  2KI7 B;  1K73 2;  1NP6 A;  2JIQ A;  2RIQ A;  3D2L A;  1NJI 1;  3T4N B;  1YJN Z;  1Z01 A;  3CCS Z;  4DGL A;  3GTM S;  1KRL A;  2V45 A;  1WCM I;  1USP B;  2M48 A;  1YI2 Z;  3J80 b;  3S2D I;  3IX0 A;  5CM2 M;  3CD6 Z;  4MXU A;  5T64 A;  4HGY A;  1I50 I;  1VQN 1;  3CCQ 1;  1ZH1 A;  3TDH B;  3S1Q I;  2NVQ I;  3RZO I;  2VUM I;  3CMA Z;  3IFU A;  3VB9 A;  4BBR I;  1VQ7 Z;  4MD7 A;  2NAP A;  4NBE A;  5C4X I;  2Q4Z A;  2J6A A;  2I3C A;  2QA4 Z;  4E33 A;  4A3F I;  1VQL Z;  2IZ3 A;  1N8R 2;  1RO2 A;  2F4M A;  3OW2 Y;  3TE5 B;  3CCJ Z;  4E32 A;  1S72 1;  3FQQ A;  1QYP A;  3S15 I;  3NDJ A;  3CPW Y;  3NDI A;  2QEX 1;  2R7Z I;  1P9N A;  1Q86 1;  3NH5 A;  3CCS 1;  1QXF A;  1I3Q I;  2WB1 A;  2ZAE B;  3PO2 I;  3I4N I;  3IR7 A;  4RV9 A;  1JJ2 Z;  2W04 A;  2VF1 A;  1NJI 2;  5IP9 I;  1YI2 1;  1KD1 2;  3CCV 1;  3M3Y I;  1DL6 A;  2OTL Z;  4MD9 A;  3CD6 1;  2G2K A;  1ML8 A;  1Y1V S;  1X3Z A;  3ESW A;  4NB8 A;  1PFT A;  2QRE B;  3QWU A;  3CMA 1;  3VMH A;  3J80 f;  2LEX A;  1VQ7 1;  4MON A;  3CXC Z;  2JIM A;  2IV2 X;  2QRD B;  1YIT Z;  2OOX B;  1Y1W I;  1Z03 A;  1VQL 1;  1Q81 1;  3H0G I;  3CCJ 1;  4MRI A;  3CCR Z;  4RVG A;  4DQY B;  2BJO A;  1VQ8 Z;  2E9H A;  3CCL 1;  2OZK A;  3RZD I;  5C3E I;  1VQN Z;  2VPX A;  3CCQ Z;  1QVF Y;  4BY7 I;  2JA8 I;  2RPR A;  4AYB A;  1VQK Z;  3GTO I;  1WJ2 A;  5IT9 b;  2VPZ A;  3Q87 A;  3P5J B;  2K5R A;  3S1M I;  3CC7 1;  1Q86 2;  1I6H I;  1WZN A;  2DE5 A;  1RO0 A;  1TWF I;  4RVF A;  4E2Z A;  1YJ9 1;  1FDI A;  2JR6 A;  5T6B A;  2R92 I;  2DE7 A;  1Q7Y 1;  2QEX Z;  4Y52 I;  4Y7N I;  3S1N I;  1KC8 1;  1VQP 1;  1YIT 1;  2M6N A;  4MH4 A;  1YUK A;  2F4O A;  3MZL B;  3GTJ I;  4E2Y A;  2NVY I;  1TWA I;  3GTL I;  2YAD A;  2R6M A;  3VMI A;  3CCR 1;  3CCV Z;  2E2I I;  1VQ8 1;  3I56 Z;  5D1O A;  1Q81 2;  2JA5 I;  3HOV I;  2JUB A;  3G6E Z;  1VQK 1;  5FLM I;  3JAM b;  3CC2 Z;  4BY1 I;  3J7A 4;  2OTJ 1;  3CCE Z;  3I55 1;  3S2H I;  2EGT A;  1TFI A;  3F3P C;  4NOZ A;  2JMO A;  3CCM Z;  3HOZ I;  3NH8 A;  5IT9 f;  2JIP A;  1TWG I;  2W03 A;  4X6A I;  3HOY I;  3OW2 Z;  3BG0 B;  3CCL Z;  1KQS Z;  4A3B I;  3VMG A;  2JIR A;  4NBA A;  3CC4 1;  3EER A;  3IF8 A;  3GKQ A;  1Q7Y 2;  1SFO I;  4A3L I;  1FDO A;  3CC7 Z;  1KC8 2;  3NH4 A;  1W2B Y;  3I56 1;  4NBH A;  4A3K I;  1Z02 A;  4A3C I;  4A3M I;  3G6E 1;  1VLA A;  2PM9 A;  3VTN A;  1YJ9 Z;  2NVT I;  1X3W A;  3S14 I;  5LL6 f;  3GTK I;  1AA6 A;  4NBD A;  2LFU A;  3CC2 1;  1VQM 1;  3CCE 1;  1VQP Z;  3M4O I;  1YHQ 1;  1VQO Z;  3GCF A;  3CCM 1;  1QVG Y;  3JAM f;  2GU2 A;  3S1R I;  2OOY B;  5A2Q b;  2K3R A;  2GTI A;  1VQ4 Z;  1YUA A;  2V8I A;  2E2J I;  4A3I I;  1USP A;  2AKL A;  4E2X A;  2V8K A;  1M90 1;  1QVF Z;  5C44 I;  5FLX b;  1K8A 1;  2OTJ Z;  2HU9 A;  3I55 Z;  3F3F C;  2V3V A;  3BG1 B;  1M1K 1;  3I4M I;  2JS4 A;  3MON A;  4HH4 A;  2KPI A;  3EED A;  1RLY A;  1L1O C;  4E30 A;  5T67 A;  3GTQ I;  2VUG A;  3CC4 Z;  4RVH A;  3G71 1;  4NBF A;  2B63 I;  1TWC I;  1K9M 1;  2JA7 I;  2VPY A;  1VQO 1;  1RQF A;  2JIO A;  4S1T A;  3K7A I;  4NH1 C;  1VQ4 1;  5D1P A;  3G4S 1;  3PO3 I;  1NUI A;  2RBL A;  3LUS A;  2QLV B;  1KD1 1;  2Y0S A;  4E2W A;  5A2Q f;  1VQM Z;  2O4H A;  3CME 1;  1JWH C;  1M90 2;  1YJW Z;  3I07 A;  4A3J I;  2O53 A;  1YHQ Z;  2JNY A;  1YIJ 1;  3NFZ A;  5FLX f;  1K83 I;  1ZB9 A;  1K8A 2;  3KIF A;  2AYD A;  1Q16 A;  1VQ9 Z;  2H85 A;  3CCU 1;  1N2F A;  3J81 b;  2PMZ A;  2QRC B;  3GTM I;  3H3V J;  1Q82 1;  2LIY A;  1M1K 2;  2RHB A;  4QTT A;  3CPW Z;  3GTG I;  1VQ6 1;  4A93 I;  1S7M A;  2Q51 A;  4NBB A;  3HKZ A;  3HOW I;  2QR1 B;  4A3G I;  4XX2 A;  3MZK B;  1KQS Y;  4CL1 A;  1VQ5 1;  4BBS I;  1K9M 2;  4BXX I;  4MD8 A;  3S17 I;  1W2B Z;  4NBG A;  2RT9 A;  4A3E I;  2E2H I;  2PK7 A;  4HGZ A;  1YJN 1;  4NBC A;  1JJ2 Y;  5D1O B;  5IP7 I;  4QTU A;  3G71 Z;  5C4J I;  1YJW 1;  1TWH I;  1K73 1;  4DK1 A;  3FQM A;  1RNI A;  3HOX I;  1QVG Z;  1VQ9 1;  4NB9 A;  2WAQ A;  1X0T A;  1LQL A;  4E31 A;  4A3D I;  1WII A;  3G4S Z;  3CXC Y; 
#chains in the Genus database with same CATH homology
 2QKD A;  4EWC A;  2V8J A;  4NFR A;  4RS4 A;  2P28 A;  2QA4 1;  1Q82 2;  3J81 f;  1Y1V I;  2DE6 A;  3CQZ I;  3CME Z;  3KIH A;  2GTH A;  3S16 I;  4RVD A;  3U50 C;  1QF8 A;  2NVX I;  2YU9 I;  1ZB8 A;  2JA6 I;  2R93 I;  1YIJ Z;  1WW9 A;  1R9T I;  3CCU Z;  2HF1 A;  3D6W A;  3PO3 S;  1N8R 1;  1VQ6 Z;  2IZ4 A;  2OTL 1;  3FKI I;  3D9X A;  4TNU A;  1RO4 A;  5AN9 F;  1VQ5 Z;  2P3Y A;  1S72 Z;  3GTP I;  3HOU I;  2KI7 B;  1K73 2;  1NP6 A;  2RIQ A;  1NJI 1;  3T4N B;  1YJN Z;  1Z01 A;  3CCS Z;  4DGL A;  3GTM S;  1KRL A;  1WCM I;  1USP B;  2M48 A;  1YI2 Z;  3J80 b;  3S2D I;  3IX0 A;  5CM2 M;  3CD6 Z;  4MXU A;  5T64 A;  4HGY A;  1I50 I;  1VQN 1;  3CCQ 1;  1ZH1 A;  3TDH B;  3S1Q I;  2NVQ I;  3RZO I;  2VUM I;  3CMA Z;  3IFU A;  3VB9 A;  4BBR I;  1VQ7 Z;  4MD7 A;  4NBE A;  5C4X I;  2Q4Z A;  2J6A A;  2I3C A;  2QA4 Z;  4E33 A;  4A3F I;  1VQL Z;  2IZ3 A;  1N8R 2;  1RO2 A;  2F4M A;  3OW2 Y;  3TE5 B;  3CCJ Z;  4E32 A;  1S72 1;  3FQQ A;  1QYP A;  3S15 I;  3NDJ A;  3CPW Y;  3NDI A;  2QEX 1;  2R7Z I;  1P9N A;  1Q86 1;  3NH5 A;  3CCS 1;  1I3Q I;  2WB1 A;  2ZAE B;  3PO2 I;  3I4N I;  4RV9 A;  1JJ2 Z;  2W04 A;  2VF1 A;  1NJI 2;  5IP9 I;  1YI2 1;  1KD1 2;  3CCV 1;  3M3Y I;  1DL6 A;  2OTL Z;  4MD9 A;  3CD6 1;  2G2K A;  1ML8 A;  1Y1V S;  1X3Z A;  3ESW A;  4NB8 A;  1PFT A;  2QRE B;  3QWU A;  3CMA 1;  3VMH A;  3J80 f;  1VQ7 1;  4MON A;  3CXC Z;  2QRD B;  1YIT Z;  2OOX B;  1Y1W I;  1Z03 A;  1VQL 1;  1Q81 1;  3H0G I;  3CCJ 1;  4MRI A;  3CCR Z;  4RVG A;  4DQY B;  2BJO A;  1VQ8 Z;  2E9H A;  3CCL 1;  2OZK A;  3RZD I;  5C3E I;  1VQN Z;  3CCQ Z;  1QVF Y;  4BY7 I;  2JA8 I;  2RPR A;  4AYB A;  1VQK Z;  3GTO I;  5IT9 b;  3Q87 A;  3P5J B;  2K5R A;  3S1M I;  3CC7 1;  1Q86 2;  1I6H I;  2DE5 A;  1RO0 A;  1TWF I;  4RVF A;  4E2Z A;  1YJ9 1;  2JR6 A;  5T6B A;  2R92 I;  2DE7 A;  1Q7Y 1;  2QEX Z;  4Y52 I;  4Y7N I;  3S1N I;  1KC8 1;  1VQP 1;  1YIT 1;  2M6N A;  4MH4 A;  1YUK A;  2F4O A;  3MZL B;  3GTJ I;  4E2Y A;  2NVY I;  1TWA I;  3GTL I;  2YAD A;  2R6M A;  3VMI A;  3CCR 1;  3CCV Z;  2E2I I;  1VQ8 1;  3I56 Z;  5D1O A;  1Q81 2;  2JA5 I;  3HOV I;  2JUB A;  3G6E Z;  1VQK 1;  5FLM I;  3JAM b;  3CC2 Z;  4BY1 I;  3J7A 4;  2OTJ 1;  3CCE Z;  3I55 1;  3S2H I;  2EGT A;  1TFI A;  3F3P C;  4NOZ A;  2JMO A;  3CCM Z;  3HOZ I;  3NH8 A;  5IT9 f;  1TWG I;  2W03 A;  4X6A I;  3HOY I;  3OW2 Z;  3BG0 B;  3CCL Z;  1KQS Z;  4A3B I;  3VMG A;  4NBA A;  3CC4 1;  3EER A;  3IF8 A;  3GKQ A;  1Q7Y 2;  1SFO I;  4A3L I;  3CC7 Z;  1KC8 2;  3NH4 A;  1W2B Y;  3I56 1;  4NBH A;  4A3K I;  1Z02 A;  4A3C I;  4A3M I;  3G6E 1;  1VLA A;  2PM9 A;  3VTN A;  1YJ9 Z;  2NVT I;  1X3W A;  3S14 I;  5LL6 f;  3GTK I;  4NBD A;  2LFU A;  3CC2 1;  1VQM 1;  3CCE 1;  1VQP Z;  3M4O I;  1YHQ 1;  1VQO Z;  3GCF A;  3CCM 1;  1QVG Y;  3JAM f;  2GU2 A;  3S1R I;  2OOY B;  5A2Q b;  2K3R A;  2GTI A;  1VQ4 Z;  1YUA A;  2V8I A;  2E2J I;  4A3I I;  1USP A;  2AKL A;  4E2X A;  2V8K A;  1M90 1;  1QVF Z;  5C44 I;  5FLX b;  1K8A 1;  2OTJ Z;  2HU9 A;  3I55 Z;  3F3F C;  3BG1 B;  1M1K 1;  3I4M I;  2JS4 A;  3MON A;  4HH4 A;  2KPI A;  3EED A;  1RLY A;  1L1O C;  4E30 A;  5T67 A;  3GTQ I;  2VUG A;  3CC4 Z;  4RVH A;  3G71 1;  4NBF A;  2B63 I;  1TWC I;  1K9M 1;  2JA7 I;  1VQO 1;  1RQF A;  4S1T A;  3K7A I;  4NH1 C;  1VQ4 1;  5D1P A;  3G4S 1;  3PO3 I;  1NUI A;  2RBL A;  3LUS A;  2QLV B;  1KD1 1;  2Y0S A;  4E2W A;  5A2Q f;  1VQM Z;  2O4H A;  3CME 1;  1JWH C;  1M90 2;  1YJW Z;  3I07 A;  4A3J I;  2O53 A;  1YHQ Z;  2JNY A;  1YIJ 1;  3NFZ A;  5FLX f;  1K83 I;  1ZB9 A;  1K8A 2;  3KIF A;  1VQ9 Z;  2H85 A;  3CCU 1;  1N2F A;  3J81 b;  2PMZ A;  2QRC B;  3GTM I;  3H3V J;  1Q82 1;  2LIY A;  1M1K 2;  2RHB A;  4QTT A;  3CPW Z;  3GTG I;  1VQ6 1;  4A93 I;  1S7M A;  2Q51 A;  4NBB A;  3HKZ A;  3HOW I;  2QR1 B;  4A3G I;  4XX2 A;  3MZK B;  1KQS Y;  4CL1 A;  1VQ5 1;  4BBS I;  1K9M 2;  4BXX I;  4MD8 A;  3S17 I;  1W2B Z;  4NBG A;  2RT9 A;  4A3E I;  2E2H I;  2PK7 A;  4HGZ A;  1YJN 1;  4NBC A;  1JJ2 Y;  5D1O B;  5IP7 I;  4QTU A;  3G71 Z;  5C4J I;  1YJW 1;  1TWH I;  1K73 1;  4DK1 A;  3FQM A;  1RNI A;  3HOX I;  1QVG Z;  1VQ9 1;  4NB9 A;  2WAQ A;  1X0T A;  1LQL A;  4E31 A;  4A3D I;  1WII A;  3G4S Z;  3CXC Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...