1VQ51

The structure of the transition state analogue "raa" bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq5100
1VQKZ 3G4SZ 3CME1 1NJI2 3G71Z 1KQSZ 3CCM1 1M1K2 2QA4Z 1YJNZ 3CCLZ 1YIT1 1Q822 1VQ61 3CCE1 3CMAZ 1W2BZ 1S72Z 3CXCY 3I55Z 1QVFY 3CCUZ 2OTJZ 1K8A1 1VQ5Z 1YJW1 3CCJZ 1NJI1 1VQO1 1K8A2 3G6EZ 1YIJ1 1Q821 1KC82 3CMEZ 3CCMZ 1Q861 3CC71 1VQ91 2OTL1 1YI21 1YITZ 1VQ6Z 3I561 3CCEZ 3CCV1 2QEX1 1QVGZ 1KQSY 1VQL1 1Q862 1VQP1 3OW2Z 1VQN1 3CCS1 1Q7Y2 1KC81 1W2BY 1VQM1 1KD12 1YJWZ 3CCRZ 3CC21 1VQOZ 1VQ81 3OW2Y 3CC41 1VQ41 1YIJZ 1K9M2 1YHQ1 3CCU1 1K731 3CCQ1 1N8R1 1VQ71 1YJ91 3CC7Z 1VQ9Z 1Q7Y1 2OTLZ 1YI2Z 3CD61 3CPWZ 3I56Z 3CCVZ 1KD11 1K732 2QEXZ 1N8R2 1VQLZ 1VQPZ 1M902 3G4S1 1VQK1 1VQNZ 3CCSZ 3G711 1K9M1 2QA41 3CXCZ 1YJN1 1Q811 3CCL1 1QVFZ 3CPWY 1VQMZ 1QVGY 3CC2Z 3CMA1 1VQ8Z 1Q812 1VQ4Z 1S721 3CC4Z 3I551 1JJ2Z 1YHQZ 2OTJ1 1VQ51 3CCQZ 1M901 1VQ7Z 3CCJ1 1YJ9Z 3CCR1 3CD6Z 1JJ2Y 3G6E1 1M1K1
chains in the Genus database with same CATH superfamily
2NVQI 1VQKZ 3CME1 1NJI2 2VUMI 1M1K2 4CL1A 3NH8A 4RS4A 2E9HA 1NP6A 2VPWA 1RNIA 1W2BZ 2GTHA 4E31A 2V3VA 1S72Z 2DE5A 3CXCY 3LUSA 3PO3S 1Z02A 2OTJZ 1VQ5Z 4Y52I 1YJW1 2JA8I 2LEXA 1NJI1 4RVGA 1K8A2 3GTPI 5IP9I 1KC82 2JA6I 4BXXI 2AYDA 3PO2I 2E2JI 5IT9b 5C4XI 4A3BI 4MD9A 2IZ4A 5IT9f 1Y1VI 1Q861 1KRLA 3S1RI 1YI21 1YITZ 3MONA 3VTNA 2I3CA 2QEX1 3OW2Z 1TWGI 2DE6A 1KC81 1W2BY 2JIRA 2PM9A 3MZKB 1WZNA 2OOXB 2WB1A 1USPA 2YADA 2OZKA 3IF8A 4RV9A 4TNUA 4NBHA 3RZDI 3HOVI 2Q4ZA 3F3FC 2V8JA 3S1QI 1N8R1 2W03A 5D1OA 4HH4A 4AYBA 3CPWZ 2VPZA 3EEDA 3HOYI 1VQLZ 2LFUA 1VQPZ 1M902 3FQMA 3G4S1 2VPYA 3CCSZ 3G711 3HOXI 3S1MI 1YJN1 1QVFZ 1ZB8A 2GTIA 4NBCA 5FLXb 1K83I 5C4JI 3GTMS 1SIWA 4MH4A 4HGYA 1LQLA 5C3EI 1JJ2Z 1TWCI 1YHQZ 1TWHI 1WIIA 3NFZA 1WJ2A 3CCQZ 1M901 2W04A 1YJ9Z 3HOZI 2WAQA 3G6E1 3KIHA 3NH5A 3GTJI 4NOZA 3VB9A 2R92I 2PMZA 1KQSZ 2QA4Z 2RBLA 3CCLZ 1VQ61 4QTTA 4A3II 1FDIA 2IZ3A 1QVFY 3CCUZ 2V8IA 2QLVB 1ZB9A 4XX2A 1VQO1 5FLMI 2VF1A 1YIJ1 3MZLB 4A3LI 2P3YA 2G2KA 3VMHA 2DE7A 3CCMZ 1TWFI 3CC71 3I561 3CCEZ 3CCV1 1I50I 2RPRA 2JIQA 4A3EI 1KQSY 1Q862 1RQFA 4Y7NI 3GTMI 3H0GI 1WCMI 2RHBA 3D9XA 3GTOI 1Q7Y2 2HF1A 1RO4A 1USPB 3NDIA 3CCRZ 2E7ZA 3NH4A 2M48A 1VQ81 4X6AI 4NB8A 1YUKA 1VQ41 2JMOA 1K9M2 2ZAEB 1TFIA 3CCU1 5LL6f 3S2HI 1VQ71 2E2HI 2NVYI 1VQ9Z 1Q7Y1 2OTLZ 1N8R2 4NBAA 1VQK1 1QF8A 2F4OA 4A3FI 1VQNZ 1K9M1 1Q811 2JS4A 1VQMZ 1Q16A 2J6AA 2BJOA 3CC2Z 4RVHA 5D1PA 3HKZA 3CC4Z 1S721 4DK1A 3GTGI 2KPIA 4NBFA 2OTJ1 1VQ51 4NBBA 2JIOA 2QREB 1NUIA 1N2FA 3J81b 3CCR1 2QKDA 3CD6Z 2B63I 3RZOI 3J81f 4RVDA 5AN9F 4RVFA 3GTQI 2JA5I 3PO3I 1RLYA 3K7AI 1RO2A 4BBRI 1YIT1 3TDHB 3CMAZ 2JIPA 3JAMb 2LIYA 4E32A 3I55Z 2EGTA 2JA7I 2Q51A 3JAMf 3F3PC 2QR1B 2PK7A 2V45A 2K3RA 3CCJZ 2NVTI 1X0TA 4E2XA 5A2Qb 4A3JI 1R9TI 5A2Qf 3CMEZ 4A93I 2RT9A 2V8KA 2R6MA 4NBGA 1QVGZ 1VQL1 2H85A 3Q87A 2KI7B 1VQP1 1PFTA 3H3VJ 3CCS1 2AKLA 3CQZI 4A3DI 4A3MI 1Y1VS 3GKQA 1KD12 2JNYA 1YJWZ 3VMGA 4QTUA 3HOWI 2JUBA 1QYPA 1YHQ1 3I07A 4HGZA 4A3CI 1K731 5T67A 3CCQ1 3M4OI 4DQYB 1YJ91 4NFRA 4E2WA 1YI2Z 2JIMA 1KD11 2VUGA 3GCFA 3S1NI 3EERA 2QEXZ 1YUAA 2R93I 2QRDB 3FKII 1TWAI 1QXFA 4MONA 2QA41 3CCL1 1AA6A 4E33A 1QVGY 2NAPA 3HOUI 3ESWA 1ML8A 4MD8A 1Q812 1WW9A 5C44I 1Y8CA 3D2LA 5D1OB 1M1K1 4E30A 1Y1WI 4E2ZA 1I6HI 4EWCA 3G4SZ 2VPXA 3G71Z 2IV2X 3CCM1 1YJNZ 4BY7I 1DL6A 1JWHC 3GTKI 1Q822 3J80b 1P9NA 3CCE1 2YU9I 1L1OC 1ZH1A 3J80f 3GTLI 4A3KI 2NVXI 1K8A1 2RIQA 3IFUA 1Z01A 2GU2A 3G6EZ 1Q821 3BG1B 3IX0A 4MD7A 2R7ZI 4A3GI 5CM2M 3S17I 3M3YI 3S2DI 1S7MA 1VQ91 1I3QI 2OTL1 3S14I 3IR7A 1VQ6Z 3D6WA 4DGLA 3FQQA 1VQN1 1SFOI 4BY1I 2OOYB 3S16I 3I4MI 2K5RA 1VQM1 3CC21 1X3ZA 1VQOZ 2Y0SA 3CC41 3OW2Y 4S1TA 1YIJZ 3BG0B 5FLXf 5IP7I 1X3WA 2QRCB 4MRIA 3CC7Z 2E2II 3CD61 3T4NB 3I56Z 3CCVZ 3NDJA 1K732 4MXUA 3VMIA 4E2YA 3U50C 3CXCZ 4NB9A 3J7A4 3I4NI 2O4HA 3CPWY 2M6NA 3CMA1 1Z03A 5T64A 1VQ8Z 2HU9A 1VQ4Z 3TE5B 3I551 4NBEA 1RO0A 2P28A 1VLAA 4NBDA 4BBSI 3S15I 1FDOA 2F4MA 1VQ7Z 3CCJ1 2JR6A 2O53A 3P5JB 5T6BA 1JJ2Y 3KIFA 3QWUA 4NH1C
chains in the Genus database with same CATH topology
2NVQI 1VQKZ 3CME1 1NJI2 2VUMI 1M1K2 4CL1A 3NH8A 4RS4A 2E9HA 1NP6A 1RNIA 1W2BZ 2GTHA 4E31A 1S72Z 2DE5A 3CXCY 3LUSA 3PO3S 1Z02A 2OTJZ 1VQ5Z 4Y52I 1YJW1 2JA8I 1NJI1 4RVGA 1K8A2 3GTPI 5IP9I 1KC82 2JA6I 4BXXI 3PO2I 2E2JI 5IT9b 5C4XI 4A3BI 4MD9A 2IZ4A 5IT9f 1Y1VI 1Q861 1KRLA 3S1RI 1YI21 1YITZ 3MONA 3VTNA 2I3CA 2QEX1 3OW2Z 1TWGI 2DE6A 1KC81 1W2BY 2PM9A 3MZKB 2WB1A 2OOXB 2YADA 1USPA 2OZKA 3IF8A 4RV9A 4TNUA 4NBHA 3RZDI 3HOVI 2Q4ZA 3F3FC 2V8JA 3S1QI 1N8R1 2W03A 5D1OA 4HH4A 4AYBA 3CPWZ 3EEDA 3HOYI 1VQLZ 2LFUA 1VQPZ 1M902 3FQMA 3G4S1 3CCSZ 3G711 3HOXI 3S1MI 1YJN1 1QVFZ 1ZB8A 2GTIA 4NBCA 5FLXb 1K83I 5C4JI 3GTMS 4MH4A 1JJ2Z 4HGYA 1LQLA 5C3EI 1TWCI 1YHQZ 1TWHI 1WIIA 3NFZA 3CCQZ 1M901 2W04A 1YJ9Z 3HOZI 2WAQA 3G6E1 3KIHA 3NH5A 3GTJI 4NOZA 3VB9A 2R92I 2PMZA 1KQSZ 2QA4Z 2RBLA 3CCLZ 1VQ61 4QTTA 4A3II 2IZ3A 1QVFY 3CCUZ 2V8IA 2QLVB 1ZB9A 4XX2A 1VQO1 5FLMI 2VF1A 1YIJ1 3MZLB 4A3LI 2P3YA 2G2KA 3VMHA 2DE7A 3CCMZ 1TWFI 3CC71 3I561 3CCEZ 3CCV1 1I50I 2RPRA 4A3EI 1KQSY 1Q862 1RQFA 4Y7NI 3GTMI 3H0GI 1WCMI 2RHBA 3D9XA 3GTOI 1Q7Y2 2HF1A 1RO4A 1USPB 3NDIA 3CCRZ 3NH4A 2M48A 1VQ81 4X6AI 4NB8A 1YUKA 1VQ41 2JMOA 1K9M2 2ZAEB 1TFIA 3CCU1 5LL6f 3S2HI 1VQ71 2E2HI 2NVYI 1VQ9Z 1Q7Y1 2OTLZ 1N8R2 4NBAA 1VQK1 1QF8A 2F4OA 4A3FI 1VQNZ 1K9M1 1Q811 2JS4A 1VQMZ 2J6AA 2BJOA 3CC2Z 4RVHA 5D1PA 3HKZA 3CC4Z 1S721 4DK1A 3GTGI 2KPIA 4NBFA 2OTJ1 1VQ51 4NBBA 2QREB 1NUIA 1N2FA 3J81b 3CCR1 2QKDA 3CD6Z 2B63I 3RZOI 3J81f 4RVDA 5AN9F 4RVFA 3GTQI 2JA5I 3PO3I 1RLYA 3K7AI 1RO2A 4BBRI 1YIT1 3TDHB 3CMAZ 3JAMb 2LIYA 4E32A 3I55Z 2EGTA 2JA7I 2Q51A 3JAMf 3F3PC 2QR1B 2PK7A 2K3RA 3CCJZ 2NVTI 1X0TA 4E2XA 5A2Qb 4A3JI 1R9TI 5A2Qf 3CMEZ 4A93I 2RT9A 2V8KA 2R6MA 4NBGA 1QVGZ 1VQL1 2H85A 3Q87A 2KI7B 1VQP1 1PFTA 3H3VJ 3CCS1 2AKLA 3CQZI 4A3DI 4A3MI 1Y1VS 3GKQA 1KD12 2JNYA 1YJWZ 3VMGA 4QTUA 3HOWI 2JUBA 1QYPA 1YHQ1 3I07A 4HGZA 4A3CI 1K731 5T67A 3CCQ1 3M4OI 4DQYB 1YJ91 4NFRA 4E2WA 1YI2Z 1KD11 2VUGA 3GCFA 3S1NI 3EERA 2QEXZ 1YUAA 2R93I 2QRDB 3FKII 1TWAI 2QA41 4MONA 3CCL1 4E33A 1QVGY 3HOUI 3ESWA 1ML8A 4MD8A 1Q812 1WW9A 5C44I 5D1OB 1M1K1 4E30A 1Y1WI 4E2ZA 1I6HI 4EWCA 3G4SZ 3G71Z 3CCM1 1YJNZ 4BY7I 1DL6A 1JWHC 3GTKI 1Q822 3J80b 1P9NA 3CCE1 2YU9I 1L1OC 1ZH1A 3J80f 3GTLI 4A3KI 2NVXI 1K8A1 2RIQA 3IFUA 1Z01A 2GU2A 3G6EZ 1Q821 3BG1B 3IX0A 4MD7A 2R7ZI 4A3GI 5CM2M 3S17I 3M3YI 3S2DI 1S7MA 1VQ91 1I3QI 2OTL1 3S14I 1VQ6Z 3D6WA 4DGLA 3FQQA 1VQN1 1SFOI 4BY1I 2OOYB 3S16I 3I4MI 2K5RA 1VQM1 3CC21 1X3ZA 1VQOZ 2Y0SA 3CC41 3OW2Y 4S1TA 1YIJZ 3BG0B 5FLXf 5IP7I 1X3WA 2QRCB 4MRIA 3CC7Z 2E2II 3CD61 3T4NB 3I56Z 3CCVZ 3NDJA 1K732 4MXUA 3VMIA 4E2YA 3U50C 3CXCZ 4NB9A 3J7A4 3I4NI 2O4HA 3CPWY 2M6NA 3CMA1 1Z03A 5T64A 1VQ8Z 2HU9A 1VQ4Z 3TE5B 3I551 4NBEA 1RO0A 2P28A 1VLAA 4NBDA 4BBSI 3S15I 2F4MA 1VQ7Z 3CCJ1 2JR6A 2O53A 3P5JB 5T6BA 1JJ2Y 3KIFA 3QWUA 4NH1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQK Z;  3G4S Z;  3CME 1;  1NJI 2;  3G71 Z;  1KQS Z;  3CCM 1;  1M1K 2;  2QA4 Z;  1YJN Z;  3CCL Z;  1YIT 1;  1Q82 2;  1VQ6 1;  3CCE 1;  3CMA Z;  1W2B Z;  1S72 Z;  3CXC Y;  3I55 Z;  1QVF Y;  3CCU Z;  2OTJ Z;  1K8A 1;  1VQ5 Z;  1YJW 1;  3CCJ Z;  1NJI 1;  1VQO 1;  1K8A 2;  3G6E Z;  1YIJ 1;  1Q82 1;  1KC8 2;  3CME Z;  3CCM Z;  1Q86 1;  3CC7 1;  1VQ9 1;  2OTL 1;  1YI2 1;  1YIT Z;  1VQ6 Z;  3I56 1;  3CCE Z;  3CCV 1;  2QEX 1;  1QVG Z;  1KQS Y;  1VQL 1;  1Q86 2;  1VQP 1;  3OW2 Z;  1VQN 1;  3CCS 1;  1Q7Y 2;  1KC8 1;  1W2B Y;  1VQM 1;  1KD1 2;  1YJW Z;  3CCR Z;  3CC2 1;  1VQO Z;  1VQ8 1;  3OW2 Y;  3CC4 1;  1VQ4 1;  1YIJ Z;  1K9M 2;  1YHQ 1;  3CCU 1;  1K73 1;  3CCQ 1;  1N8R 1;  1VQ7 1;  1YJ9 1;  3CC7 Z;  1VQ9 Z;  1Q7Y 1;  2OTL Z;  1YI2 Z;  3CD6 1;  3CPW Z;  3I56 Z;  3CCV Z;  1KD1 1;  1K73 2;  2QEX Z;  1N8R 2;  1VQL Z;  1VQP Z;  1M90 2;  3G4S 1;  1VQK 1;  1VQN Z;  3CCS Z;  3G71 1;  1K9M 1;  2QA4 1;  3CXC Z;  1YJN 1;  1Q81 1;  3CCL 1;  1QVF Z;  3CPW Y;  1VQM Z;  1QVG Y;  3CC2 Z;  3CMA 1;  1VQ8 Z;  1Q81 2;  1VQ4 Z;  1S72 1;  3CC4 Z;  3I55 1;  1JJ2 Z;  1YHQ Z;  2OTJ 1;  1VQ5 1;  3CCQ Z;  1M90 1;  1VQ7 Z;  3CCJ 1;  1YJ9 Z;  3CCR 1;  3CD6 Z;  1JJ2 Y;  3G6E 1;  1M1K 1; 
#chains in the Genus database with same CATH topology
 2NVQ I;  1VQK Z;  3CME 1;  1NJI 2;  2VUM I;  1M1K 2;  4CL1 A;  3NH8 A;  4RS4 A;  2E9H A;  1NP6 A;  2VPW A;  1RNI A;  1W2B Z;  2GTH A;  4E31 A;  2V3V A;  1S72 Z;  2DE5 A;  3CXC Y;  3LUS A;  3PO3 S;  1Z02 A;  2OTJ Z;  1VQ5 Z;  4Y52 I;  1YJW 1;  2JA8 I;  2LEX A;  1NJI 1;  4RVG A;  1K8A 2;  3GTP I;  5IP9 I;  1KC8 2;  2JA6 I;  4BXX I;  2AYD A;  3PO2 I;  2E2J I;  5IT9 b;  5C4X I;  4A3B I;  4MD9 A;  2IZ4 A;  5IT9 f;  1Y1V I;  1Q86 1;  1KRL A;  3S1R I;  1YI2 1;  1YIT Z;  3MON A;  3VTN A;  2I3C A;  2QEX 1;  3OW2 Z;  1TWG I;  2DE6 A;  1KC8 1;  1W2B Y;  2JIR A;  2PM9 A;  3MZK B;  1WZN A;  2OOX B;  2WB1 A;  1USP A;  2YAD A;  2OZK A;  3IF8 A;  4RV9 A;  4TNU A;  4NBH A;  3RZD I;  3HOV I;  2Q4Z A;  3F3F C;  2V8J A;  3S1Q I;  1N8R 1;  2W03 A;  5D1O A;  4HH4 A;  4AYB A;  3CPW Z;  2VPZ A;  3EED A;  3HOY I;  1VQL Z;  2LFU A;  1VQP Z;  1M90 2;  3FQM A;  3G4S 1;  2VPY A;  3CCS Z;  3G71 1;  3HOX I;  3S1M I;  1YJN 1;  1QVF Z;  1ZB8 A;  2GTI A;  4NBC A;  5FLX b;  1K83 I;  5C4J I;  3GTM S;  1SIW A;  4MH4 A;  4HGY A;  1LQL A;  5C3E I;  1JJ2 Z;  1TWC I;  1YHQ Z;  1TWH I;  1WII A;  3NFZ A;  1WJ2 A;  3CCQ Z;  1M90 1;  2W04 A;  1YJ9 Z;  3HOZ I;  2WAQ A;  3G6E 1;  3KIH A;  3NH5 A;  3GTJ I;  4NOZ A;  3VB9 A;  2R92 I;  2PMZ A;  1KQS Z;  2QA4 Z;  2RBL A;  3CCL Z;  1VQ6 1;  4QTT A;  4A3I I;  1FDI A;  2IZ3 A;  1QVF Y;  3CCU Z;  2V8I A;  2QLV B;  1ZB9 A;  4XX2 A;  1VQO 1;  5FLM I;  2VF1 A;  1YIJ 1;  3MZL B;  4A3L I;  2P3Y A;  2G2K A;  3VMH A;  2DE7 A;  3CCM Z;  1TWF I;  3CC7 1;  3I56 1;  3CCE Z;  3CCV 1;  1I50 I;  2RPR A;  2JIQ A;  4A3E I;  1KQS Y;  1Q86 2;  1RQF A;  4Y7N I;  3GTM I;  3H0G I;  1WCM I;  2RHB A;  3D9X A;  3GTO I;  1Q7Y 2;  2HF1 A;  1RO4 A;  1USP B;  3NDI A;  3CCR Z;  2E7Z A;  3NH4 A;  2M48 A;  1VQ8 1;  4X6A I;  4NB8 A;  1YUK A;  1VQ4 1;  2JMO A;  1K9M 2;  2ZAE B;  1TFI A;  3CCU 1;  5LL6 f;  3S2H I;  1VQ7 1;  2E2H I;  2NVY I;  1VQ9 Z;  1Q7Y 1;  2OTL Z;  1N8R 2;  4NBA A;  1VQK 1;  1QF8 A;  2F4O A;  4A3F I;  1VQN Z;  1K9M 1;  1Q81 1;  2JS4 A;  1VQM Z;  1Q16 A;  2J6A A;  2BJO A;  3CC2 Z;  4RVH A;  5D1P A;  3HKZ A;  3CC4 Z;  1S72 1;  4DK1 A;  3GTG I;  2KPI A;  4NBF A;  2OTJ 1;  1VQ5 1;  4NBB A;  2JIO A;  2QRE B;  1NUI A;  1N2F A;  3J81 b;  3CCR 1;  2QKD A;  3CD6 Z;  2B63 I;  3RZO I;  3J81 f;  4RVD A;  5AN9 F;  4RVF A;  3GTQ I;  2JA5 I;  3PO3 I;  1RLY A;  3K7A I;  1RO2 A;  4BBR I;  1YIT 1;  3TDH B;  3CMA Z;  2JIP A;  3JAM b;  2LIY A;  4E32 A;  3I55 Z;  2EGT A;  2JA7 I;  2Q51 A;  3JAM f;  3F3P C;  2QR1 B;  2PK7 A;  2V45 A;  2K3R A;  3CCJ Z;  2NVT I;  1X0T A;  4E2X A;  5A2Q b;  4A3J I;  1R9T I;  5A2Q f;  3CME Z;  4A93 I;  2RT9 A;  2V8K A;  2R6M A;  4NBG A;  1QVG Z;  1VQL 1;  2H85 A;  3Q87 A;  2KI7 B;  1VQP 1;  1PFT A;  3H3V J;  3CCS 1;  2AKL A;  3CQZ I;  4A3D I;  4A3M I;  1Y1V S;  3GKQ A;  1KD1 2;  2JNY A;  1YJW Z;  3VMG A;  4QTU A;  3HOW I;  2JUB A;  1QYP A;  1YHQ 1;  3I07 A;  4HGZ A;  4A3C I;  1K73 1;  5T67 A;  3CCQ 1;  3M4O I;  4DQY B;  1YJ9 1;  4NFR A;  4E2W A;  1YI2 Z;  2JIM A;  1KD1 1;  2VUG A;  3GCF A;  3S1N I;  3EER A;  2QEX Z;  1YUA A;  2R93 I;  2QRD B;  3FKI I;  1TWA I;  1QXF A;  4MON A;  2QA4 1;  3CCL 1;  1AA6 A;  4E33 A;  1QVG Y;  2NAP A;  3HOU I;  3ESW A;  1ML8 A;  4MD8 A;  1Q81 2;  1WW9 A;  5C44 I;  1Y8C A;  3D2L A;  5D1O B;  1M1K 1;  4E30 A;  1Y1W I;  4E2Z A;  1I6H I;  4EWC A;  3G4S Z;  2VPX A;  3G71 Z;  2IV2 X;  3CCM 1;  1YJN Z;  4BY7 I;  1DL6 A;  1JWH C;  3GTK I;  1Q82 2;  3J80 b;  1P9N A;  3CCE 1;  2YU9 I;  1L1O C;  1ZH1 A;  3J80 f;  3GTL I;  4A3K I;  2NVX I;  1K8A 1;  2RIQ A;  3IFU A;  1Z01 A;  2GU2 A;  3G6E Z;  1Q82 1;  3BG1 B;  3IX0 A;  4MD7 A;  2R7Z I;  4A3G I;  5CM2 M;  3S17 I;  3M3Y I;  3S2D I;  1S7M A;  1VQ9 1;  1I3Q I;  2OTL 1;  3S14 I;  3IR7 A;  1VQ6 Z;  3D6W A;  4DGL A;  3FQQ A;  1VQN 1;  1SFO I;  4BY1 I;  2OOY B;  3S16 I;  3I4M I;  2K5R A;  1VQM 1;  3CC2 1;  1X3Z A;  1VQO Z;  2Y0S A;  3CC4 1;  3OW2 Y;  4S1T A;  1YIJ Z;  3BG0 B;  5FLX f;  5IP7 I;  1X3W A;  2QRC B;  4MRI A;  3CC7 Z;  2E2I I;  3CD6 1;  3T4N B;  3I56 Z;  3CCV Z;  3NDJ A;  1K73 2;  4MXU A;  3VMI A;  4E2Y A;  3U50 C;  3CXC Z;  4NB9 A;  3J7A 4;  3I4N I;  2O4H A;  3CPW Y;  2M6N A;  3CMA 1;  1Z03 A;  5T64 A;  1VQ8 Z;  2HU9 A;  1VQ4 Z;  3TE5 B;  3I55 1;  4NBE A;  1RO0 A;  2P28 A;  1VLA A;  4NBD A;  4BBS I;  3S15 I;  1FDO A;  2F4M A;  1VQ7 Z;  3CCJ 1;  2JR6 A;  2O53 A;  3P5J B;  5T6B A;  1JJ2 Y;  3KIF A;  3QWU A;  4NH1 C; 
#chains in the Genus database with same CATH homology
 2NVQ I;  1VQK Z;  3CME 1;  1NJI 2;  2VUM I;  1M1K 2;  4CL1 A;  3NH8 A;  4RS4 A;  2E9H A;  1NP6 A;  1RNI A;  1W2B Z;  2GTH A;  4E31 A;  1S72 Z;  2DE5 A;  3CXC Y;  3LUS A;  3PO3 S;  1Z02 A;  2OTJ Z;  1VQ5 Z;  4Y52 I;  1YJW 1;  2JA8 I;  1NJI 1;  4RVG A;  1K8A 2;  3GTP I;  5IP9 I;  1KC8 2;  2JA6 I;  4BXX I;  3PO2 I;  2E2J I;  5IT9 b;  5C4X I;  4A3B I;  4MD9 A;  2IZ4 A;  5IT9 f;  1Y1V I;  1Q86 1;  1KRL A;  3S1R I;  1YI2 1;  1YIT Z;  3MON A;  3VTN A;  2I3C A;  2QEX 1;  3OW2 Z;  1TWG I;  2DE6 A;  1KC8 1;  1W2B Y;  2PM9 A;  3MZK B;  2WB1 A;  2OOX B;  2YAD A;  1USP A;  2OZK A;  3IF8 A;  4RV9 A;  4TNU A;  4NBH A;  3RZD I;  3HOV I;  2Q4Z A;  3F3F C;  2V8J A;  3S1Q I;  1N8R 1;  2W03 A;  5D1O A;  4HH4 A;  4AYB A;  3CPW Z;  3EED A;  3HOY I;  1VQL Z;  2LFU A;  1VQP Z;  1M90 2;  3FQM A;  3G4S 1;  3CCS Z;  3G71 1;  3HOX I;  3S1M I;  1YJN 1;  1QVF Z;  1ZB8 A;  2GTI A;  4NBC A;  5FLX b;  1K83 I;  5C4J I;  3GTM S;  4MH4 A;  1JJ2 Z;  4HGY A;  1LQL A;  5C3E I;  1TWC I;  1YHQ Z;  1TWH I;  1WII A;  3NFZ A;  3CCQ Z;  1M90 1;  2W04 A;  1YJ9 Z;  3HOZ I;  2WAQ A;  3G6E 1;  3KIH A;  3NH5 A;  3GTJ I;  4NOZ A;  3VB9 A;  2R92 I;  2PMZ A;  1KQS Z;  2QA4 Z;  2RBL A;  3CCL Z;  1VQ6 1;  4QTT A;  4A3I I;  2IZ3 A;  1QVF Y;  3CCU Z;  2V8I A;  2QLV B;  1ZB9 A;  4XX2 A;  1VQO 1;  5FLM I;  2VF1 A;  1YIJ 1;  3MZL B;  4A3L I;  2P3Y A;  2G2K A;  3VMH A;  2DE7 A;  3CCM Z;  1TWF I;  3CC7 1;  3I56 1;  3CCE Z;  3CCV 1;  1I50 I;  2RPR A;  4A3E I;  1KQS Y;  1Q86 2;  1RQF A;  4Y7N I;  3GTM I;  3H0G I;  1WCM I;  2RHB A;  3D9X A;  3GTO I;  1Q7Y 2;  2HF1 A;  1RO4 A;  1USP B;  3NDI A;  3CCR Z;  3NH4 A;  2M48 A;  1VQ8 1;  4X6A I;  4NB8 A;  1YUK A;  1VQ4 1;  2JMO A;  1K9M 2;  2ZAE B;  1TFI A;  3CCU 1;  5LL6 f;  3S2H I;  1VQ7 1;  2E2H I;  2NVY I;  1VQ9 Z;  1Q7Y 1;  2OTL Z;  1N8R 2;  4NBA A;  1VQK 1;  1QF8 A;  2F4O A;  4A3F I;  1VQN Z;  1K9M 1;  1Q81 1;  2JS4 A;  1VQM Z;  2J6A A;  2BJO A;  3CC2 Z;  4RVH A;  5D1P A;  3HKZ A;  3CC4 Z;  1S72 1;  4DK1 A;  3GTG I;  2KPI A;  4NBF A;  2OTJ 1;  1VQ5 1;  4NBB A;  2QRE B;  1NUI A;  1N2F A;  3J81 b;  3CCR 1;  2QKD A;  3CD6 Z;  2B63 I;  3RZO I;  3J81 f;  4RVD A;  5AN9 F;  4RVF A;  3GTQ I;  2JA5 I;  3PO3 I;  1RLY A;  3K7A I;  1RO2 A;  4BBR I;  1YIT 1;  3TDH B;  3CMA Z;  3JAM b;  2LIY A;  4E32 A;  3I55 Z;  2EGT A;  2JA7 I;  2Q51 A;  3JAM f;  3F3P C;  2QR1 B;  2PK7 A;  2K3R A;  3CCJ Z;  2NVT I;  1X0T A;  4E2X A;  5A2Q b;  4A3J I;  1R9T I;  5A2Q f;  3CME Z;  4A93 I;  2RT9 A;  2V8K A;  2R6M A;  4NBG A;  1QVG Z;  1VQL 1;  2H85 A;  3Q87 A;  2KI7 B;  1VQP 1;  1PFT A;  3H3V J;  3CCS 1;  2AKL A;  3CQZ I;  4A3D I;  4A3M I;  1Y1V S;  3GKQ A;  1KD1 2;  2JNY A;  1YJW Z;  3VMG A;  4QTU A;  3HOW I;  2JUB A;  1QYP A;  1YHQ 1;  3I07 A;  4HGZ A;  4A3C I;  1K73 1;  5T67 A;  3CCQ 1;  3M4O I;  4DQY B;  1YJ9 1;  4NFR A;  4E2W A;  1YI2 Z;  1KD1 1;  2VUG A;  3GCF A;  3S1N I;  3EER A;  2QEX Z;  1YUA A;  2R93 I;  2QRD B;  3FKI I;  1TWA I;  2QA4 1;  4MON A;  3CCL 1;  4E33 A;  1QVG Y;  3HOU I;  3ESW A;  1ML8 A;  4MD8 A;  1Q81 2;  1WW9 A;  5C44 I;  5D1O B;  1M1K 1;  4E30 A;  1Y1W I;  4E2Z A;  1I6H I;  4EWC A;  3G4S Z;  3G71 Z;  3CCM 1;  1YJN Z;  4BY7 I;  1DL6 A;  1JWH C;  3GTK I;  1Q82 2;  3J80 b;  1P9N A;  3CCE 1;  2YU9 I;  1L1O C;  1ZH1 A;  3J80 f;  3GTL I;  4A3K I;  2NVX I;  1K8A 1;  2RIQ A;  3IFU A;  1Z01 A;  2GU2 A;  3G6E Z;  1Q82 1;  3BG1 B;  3IX0 A;  4MD7 A;  2R7Z I;  4A3G I;  5CM2 M;  3S17 I;  3M3Y I;  3S2D I;  1S7M A;  1VQ9 1;  1I3Q I;  2OTL 1;  3S14 I;  1VQ6 Z;  3D6W A;  4DGL A;  3FQQ A;  1VQN 1;  1SFO I;  4BY1 I;  2OOY B;  3S16 I;  3I4M I;  2K5R A;  1VQM 1;  3CC2 1;  1X3Z A;  1VQO Z;  2Y0S A;  3CC4 1;  3OW2 Y;  4S1T A;  1YIJ Z;  3BG0 B;  5FLX f;  5IP7 I;  1X3W A;  2QRC B;  4MRI A;  3CC7 Z;  2E2I I;  3CD6 1;  3T4N B;  3I56 Z;  3CCV Z;  3NDJ A;  1K73 2;  4MXU A;  3VMI A;  4E2Y A;  3U50 C;  3CXC Z;  4NB9 A;  3J7A 4;  3I4N I;  2O4H A;  3CPW Y;  2M6N A;  3CMA 1;  1Z03 A;  5T64 A;  1VQ8 Z;  2HU9 A;  1VQ4 Z;  3TE5 B;  3I55 1;  4NBE A;  1RO0 A;  2P28 A;  1VLA A;  4NBD A;  4BBS I;  3S15 I;  2F4M A;  1VQ7 Z;  3CCJ 1;  2JR6 A;  2O53 A;  3P5J B;  5T6B A;  1JJ2 Y;  3KIF A;  3QWU A;  4NH1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...