4MXUA

Human brain aspartoacylase mutant k213e complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGEEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mxuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mxuA01
2PE3A 4DJLA 4OC0A 5LYFA 2IMOA 1R43A 2PJ9A 4EMEA 3V7ZA 4PXCA 4MCPA 4FUUA 4B6ZA 1AMPA 2WYRA 2O53A 5K8OA 2PJCA 2PJ0A 1CX8A 4MHZA 2PJ3A 3LWUA 2EK9A 2BOAA 2V8HA 2HB6A 2ZOGA 1F57A 2VL1A 1Y7EA 1BAVA 1VHEA 4F9UA 2ZEMA 3IJ3A 3MRUA 4MMOA 3GUXA 1ELLP 2WZNA 1TKJA 1TXRA 2G9DA 1TKFA 2ANPA 4K3NA 1YLOA 3IWWA 5JGFA 4WWVA 2EK8A 4BD9A 5CPAA 3D7FA 2ZEPA 2PJ4A 1NSAA 2ZELA 3KGQA 3TC8A 1ZG8A 4P4EA 2QVPA 3FF3A 3SI1A 3WC5A 3PB7X 3WC6A 4NJQA 3PB9X 2J9AA 1CG2A 2IQ6A 1CP6A 5HVGA 2AFMA 3D68A 2NYQA 5THWA 1PYTB 4WJBA 4ZY0A 2V8VA 4NGTA 3VATA 2O4HA 4P4FA 4ZYQA 3IIBA 1JQGA 2XEIA 3IFEA 3FX6A 3TX8A 3KQZA 3D7DA 3RBUA 4YU9A 4ONWA 2JEWA 5DS0A 4F8ZA 5LYLA 4MCQA 5JM6A 4MHPA 1LANA 1ZLHA 3QNVA 1YW6A 2QYVA 5K8NA 4JZ0A 2PJ8A 4EFDA 4W9YA 5ELYA 5CBMA 1FNOA 1BPNA 4Z65A 2AFXA 4MHNA 4IK2A 4X3RA 4OKOA 2ZEDA 1DTDA 2ZEHA 1FT7A 1XMBA 4IHMA 3PB6X 3CPAA 4R76A 3WABA 3B3CA 3H8GA 3PB4X 2GLFA 3PEIA 4P45A 4OC2A 3SJGA 4MXUA 3ISXA 3GB0A 2OOTA 4F9VA 2ZOFA 1F2PA 4NGSA 3PFOA 4UEFA 2PJ2A 2POKA 4KSIA 3IO1A 4MHYA 3PBBA 2Q51A 1GYTA 3B35A 2PJ5A 4OMEA 3PFEA 3B3TA 1YMEA 4CPAA 4NGPA 4OIWA 1H8LA 6CPAA 4RUHA 3S9NA 2AFSA 4NGRA 1ELMP 3SI2A 2PJ6A 2BO9A 2JBKA 3B3SA 3WT4A 4OP4A 3CPXA 3ISZA 1HEEA 3K2KA 4ZX9A 1BLLE 3D4UA 3S9LA 1RTQA 3SJXA 3CDXA 1ZG7A 1VIXA 4A94A 4PXEA 5F09A 4ZY1A 3SJFA 4IAVA 2C6PA 3B7IA 1EE3P 4OC1A 4P4IA 2GREA 4MCSA 4JYWA 4PXBA 4ZX8A 5D8NA 2F7VA 2V8DA 1XRYA 4OC3A 3BHXA 4R6TA 3NH5A 2AFOA 1VHOA 3L2NA 5LRGA 2CTBA 4MCRA 5IB9A 2QJ8A 3K9TA 4R7MA 3BXMA 4O23A 5D29A 4LQGA 3N5FA 1Y0RA 2ZEEA 3FH4A 3NH4A 1YW4A 1LFWA 3S9MA 3IEHA 5LRJA 4X2TA 2CF4A 3NH8A 2ZEFA 4P10A 2EWBA 1YSJA 3FEDA 4AXVA 3CT9A 3KHXA 4PQAA 2XEFA 2AFUA 1DE4C 2PIZA 5LYDA 4P44A 4R8FA 2PVVA 1VGYA 4FWUA 5K8MA 1XBUA 3GLJA 1QMUA 3FJUA 3SI0A 3PBEA 2V77A 1CP7A 3KR4A 4UEEA 2I3CA 1PCAA 4ZI6A 4DUKA 1TF9A 2GU2A 1IGBA 3WC7A 3B3WA 1CPXA 3FEEA 1Z2LA 1XFOA 4A39A 3B2YA 1LAMA 4X8IA 2PIYA 4TWEA 2PJ7A 2C6CA 3HUVA 3KI9A 2ZEGA 3LMSA 3KR5A 2RB7A 3PRTA 2XEJA 3VH9A 1BPMA 8CPAA 4OIDA 2CIJA 1ARLA 2IJZA 5HVHA 4A37A 1OBRA 1LCPA 4PXDA 5I4MA 3JRUA 4H2KA 2RFHA 3V38A 1AYEA 2V8GA 4TNUA 3H8FA 1F2OA 1TKHA 2PCUA 3RZAA 5J1QA 2BCOA 4PPZA 3D67A 1HDUA 2C6GA 3RAMA 2AFWA 4NJRA 2OR4A 4NFRA 3KASA 3MN8A 2PRQA 4UIBA 4NGMA 4G1PA 2XEGA 2GLJA 2HC9A 3FMCA 2Q43A 2AFZA 2ZEOA 5HXDA 3FECA 1CBXA 3H8EA 4MRIA 3HLPA 4Q7AA 1LOKA 4EWTA 2PJ1A 2FVGA 3KZWA 3PB8X 2Q4ZA 4FBEA 1M4LA 4P4DA 2JBJA 4P4BA 3FVLA 2NSMA 1Y0YA 4NGNA 3KQXA 5K8PA 4UEZA 5JH9A 3D66A 2ABZA 2C1CA 3SJEA 3NFZA 1Z8LA 2F8HA 3B3VA 1R3NA 2PVWA 3I1UA 1QQ9A 1KWMA 4P6YA 4FAIA 3T8WA 1CPSA 4DYOA 2PJAA 3DGVA 4GM5A 2PJBA 1ZLIA 4OC5A 4NGQA 1ZG9A 3D7HA 3KL9A 1UWYA 1Q7LA 2CTCA 5LRKA 4OC4A 3D7GA 3KHZA 5LYIA 1TF8A 3BI0A 2ZENA 4ZY2A 1XJOA 3VARA 3NA6A 2DEAA 7CPAA 4A38A 4P4JA 1ARMA 4UF4A 3IC1A 3BI1A 1HDQA 3DLJA 4UIAA 1Z5RA 1LAPA 1IY7A 5HVFA 4YWYA
chains in the Genus database with same CATH superfamily
1K9M1 3J80b 2JA5I 2PE3A 4DJLA 1VQ5Z 4QTUA 3RO0A 3N7ZA 4PXCA 4B14A 4FUUA 4KS9A 2C27A 4M85A 1QSRA 2O53A 2M48A 2PJ0A 1CX8A 4KLVA 1R9TI 3K9UA 2EK9A 3LACA 3GTPI 2V8HA 4JD6A 1BAVA 3JAMf 1Z02A 1SIWA 3BJ8A 1Q812 3S16I 4DNCA 1MJ9A 3F8KA 2WZNA 2B58A 3EEDA 1TKJA 1TXRA 2G9DA 2ANPA 4MFQA 1N8R1 1M1K1 2EK8A 1XF8A 4A3KI 2VUGA 3BG0B 2ZEPA 3R1KA 1YJW1 3CCQZ 3VMHA 2R7ZI 4H6UA 2AE6A 2B63I 4ZGYB 1VQMZ 3S1RI 4QC6A 2DPSA 1XMTA 1YLEA 3PB7X 4KOSA 4A2ZA 3PB9X 2NAPA 4QTTA 2JIOA 1KD11 1KC81 3D68A 4WJBA 1QVGY 1TIQA 4RVFA 4KUBA 1VQ6Z 2FIWA 4HGZA 3I4MI 1KUXA 3FRMA 5LYLA 3IR7A 3VB9A 1Y1VI 4UCPA 5IT9f 3M4OI 3VMIA 2V8IA 2OTJ1 4MHPA 1M4GA 4A3DI 2O28A 2J8RA 4NBGA 3M3YI 2Q7BA 2PJ8A 4CAFA 5ELYA 5CBMA 1FNOA 1BPNA 2R1IA 2AFXA 3W6SA 4CAXA 2VBQA 3G3SA 1DTDA 1VQ41 2ZW6A 3OW2Z 5ISVA 2OOYB 4MY0A 2Q7SA 4IHMA 4R3KA 4E0AA 3ZJ0A 3CCJ1 2GLFA 4YRHA 1QSNA 3SJGA 3CC7Z 1YK3A 3QWUA 2OZHA 3UY5A 3NE8A 1LRZA 4NBBA 3T9YA 3G6E1 1VQ71 3PFOA 3F5BA 2PJ2A 2IV2X 1VQLZ 1TWFI 4OMEA 4CPAA 5CM2M 3S6GA 2HQYA 1H8LA 4KOTA 1RLYA 1R57A 4NGRA 3SI2A 5IX3A 4A3FI 3IF8A 1KQSZ 3CPXA 4NF1A 3ISZA 1HEEA 2DE6A 3GCFA 1PUAA 2PR1A 1TWCI 4HGYA 1VIXA 1RO0A 1Q861 2X7BA 3EO4A 3D8PA 4OLLA 4P4IA 2GREA 3LD2A 2E7ZA 2BSWA 4PXBA 5EBVA 3S6FA 4UWJA 5D8NA 3OW2Y 2E2JI 4KLWA 4RV9A 2Q44A 3GTKI 5D29A 2BUEA 3PGPA 2V3VA 2OZKA 4A3EI 2NVTI 3FH4A 1Q811 3VMGA 4NB9A 3GTMI 3IEHA 1L1OC 4X2TA 4KOUA 1YIJZ 3NH8A 5A2Qf 1YSJA 4NBEA 5D1PA 4MD7A 3CT9A 3KHXA 4PQAA 4ZBGA 1QVFY 2AFUA 1DE4C 1Z8TA 1VGYA 5K8MA 1XBUA 3FJUA 1PCAA 1YUAA 1Y9WA 1Z8XA 5G20A 3SXOA 4A39A 2VZYA 1LAMA 4C7HA 2C6CA 3HUVA 2ZPAA 2P3YA 4CGPA 3KR5A 2RB7A 3PRTA 1M902 2XEJA 4KOYA 1TWAI 4M6HA 4HPSA 2IJZA 3ESWA 4E32A 2EBJA 5HVHA 1USPB 5AG5A 3JRUA 2RFHA 4UCMA 1S3ZA 4PK3A 5I0CA 4TNUA 3H8FA 4B11A 4H6ZA 2Z11A 5J1QA 3CCV1 3KKWA 3D67A 2C6GA 2AFWA 2QA4Z 1Z4EA 4PSWA 4E2XA 5C4XI 4NGMA 4CRZB 3FMCA 1YVOA 1FDOA 2RHBA 2IL4A 5F49A 3PO3I 4EWTA 2FVGA 1YIT1 1M4LA 3CCS1 2BJOA 2V45A 1WK4A 2M6NA 3KQXA 3D66A 2NVQI 3QAYA 3SHPA 3NFZA 1Z8LA 2QLVB 2F8HA 3B3VA 2KCWA 2PVWA 3I1UA 1XE4A 2NVYI 4B5PB 5FVJA 2AYDA 1YUKA 3LODA 4FD7A 4OC5A 4FD4A 1VQNZ 3GTGI 4M3SA 1K8A2 1OZPA 3FQMA 5LYIA 5H86A 3TCVA 4ZY2A 1RO5A 3VARA 4A38A 4E8OA 4CGOA 3GKRA 1I21A 3IC1A 3B8GA 4QB9A 5HVFA 2YNCC 1QSTA 4OC0A 1VQK1 2PJ9A 1R43A 4EMEA 4R57A 3CMA1 4A3CI 2QREB 3SXNA 4MCPA 4NB8A 1KZFA 3IWGA 1AMPA 3KIFA 4NCZA 3CCE1 4CGMA 2Z3OA 3G711 1NUIA 1F57A 3Q87A 2JNYA 4GXHA 1MJAA 5HH1A 2P28A 3I56Z 5J8CA 1IICA 4MFPA 2F5IA 3CME1 3P2FA 3S14I 4KSAA 1USPA 5JGFA 3TTHA 4A32A 5CPAA 1M4DA 1NMTA 4QUSA 2PJ4A 4BBHA 3QAHA 1TFIA 4UFXA 3EFAA 2IZ4A 3KIHA 1I6HI 3KGQA 3G4S1 3TO9A 5J8FA 1RO4A 1Z8WA 3FF3A 4BBSI 3SI1A 4U5YA 4CAVA 4PV6A 4BY1I 3GTLI 1SFOI 3WC6A 3CCLZ 4NJQA 4CAWA 4MHDA 1CP6A 5HVGA 2AFMA 2R6MA 4E2WA 2NYQA 1M901 2O4HA 4ZYQA 3IIBA 1YJN1 2K5TA 1W2BZ 4DQYB 3TX8A 4HNXB 4Y49C 2WAQA 1XOVA 2VPYA 4AG7A 1YI2Z 5G22A 4A3JI 3FYNA 3BG1B 2CNTA 1BOBA 3NE7A 2QEXZ 3QNVA 1U6MA 2QYVA 4JWPA 5K8NA 2G0BA 4B5PA 2YNDA 1Y1WI 2P6FA 4BXXI 1YHQZ 1QVGZ 1J4JA 4IK2A 3IGRA 3TE4A 2ZEDA 2F4MA 1FT7A 2D4OA 5GCNA 3HKZA 4PSXA 3P5JB 3JTKA 3S6HA 3CPAA 3VWEA 1MJBA 3B3CA 1JJ2Z 3PB4X 3H4QA 3R9EA 4OC2A 4A33A 3I9SA 4RVDA 3ISXA 3TFYA 2OOTA 2JDDA 3C26A 4F9VA 2R98A 3J80f 1WCMI 1X12A 3CQZI 2ZOFA 4K30A 1RXTA 1F2PA 4Q36A 4CL1A 4UEFA 5D1OB 2ZW4A 3IO1A 4A93I 4CYQA 2RT9A 5A28A 3PBBA 4DGLA 3CCQ1 2LIYA 3DR8A 2NVXI 4JXQA 3B3TA 1VQM1 1YMEA 2BEIA 3T4NB 2CXAA 2I00A 2OB0A 1YR0A 4RUHA 1S7KA 3OWCA 3CCR1 1W2BY 1ELMP 2FL4A 1K8A1 2YU9I 2OTLZ 2JBKA 3B3SA 3WT4A 4HNYB 1FY7A 3FBUA 4JJXA 5C44I 2B3UA 1VQ61 1WZNA 4KOXA 2ATRA 2P6GA 4A94A 5F48A 3F3FC 4PXEA 1L0CA 4ZY1A 3IFUA 2PQ8A 2C6PA 4E33A 4KOVA 1WJ2A 3P2HA 5AG7A 1V0CA 3V8IA 4MCSA 4JYWA 1XRYA 4MFJA 4CGLA 4A3GI 4R6TA 3NH5A 3I3GA 2AFOA 4BY7I 2CTBA 4MCRA 3I4NI 2YNEA 4R7MA 1JJ2Y 4O23A 4LQGA 2RC4A 2FS5A 3N5FA 4M6GA 4CGNA 2OZGA 2ZEEA 3F0AA 2Q04A 4GS4A 3BLNA 2VPZA 5F47A 2ZEFA 2Y0SA 1KUYA 5A27A 2XEFA 1Y9KA 2PIZA 5HMNA 5LYDA 1VQ8Z 4F6AA 3CC71 2B5GB 2JR6A 2Z0ZA 2Z3KA 3PBEA 1CP7A 2GE3A 4FD6A 2Z3LA 4A30A 1TF9A 2H5MA 2GU2A 1K4JA 3B3WA 3FIXA 1CPXA 3FEEA 1Z2LA 2D4PA 3B2YA 3S2HI 2J8MA 4X8IA 3A9LA 2PJ7A 4AG9A 3KI9A 2OTJZ 4LQ6A 1FDIA 2HF1A 3HOWI 3CC4Z 1QVFZ 1ARLA 1PU9A 1AA6A 1YJ9Z 4A37A 1Q2CA 1OBRA 3K7AI 4PXDA 2J8NA 2OH1A 4MFLA 1F2OA 2PCUA 2PR8A 4NH1C 3VWDA 5E96A 2B4DB 4PPZA 3RAMA 2AKLA 3EY5A 4NFRA 5D1OA 2QKDA 3IU2A 4UIBA 4AVAA 1M4IA 1DL6A 4G1PA 2XEGA 1S60A 3HOXI 3TOBA 1VQ7Z 3FECA 3H8EA 4DK1A 1LOKA 1YREA 4B13A 4NXYA 2VF1A 3D2PA 3DR6A 3IX0A 3PO2I 2B3VA 3J7A4 3S6KA 4P4BA 3FVLA 2NSMA 4XNHC 1I3QI 5K8PA 4R87A 2JUBA 1YIJ1 2C1CA 3GY9A 1R3NA 2CNMA 3DNSA 1KWMA 2FIAA 3RZDI 2LEXA 1CPSA 1X10A 3E0KA 3CCMZ 4NGQA 3GTJI 1ZG9A 2ODFA 4UBRA 2DF5A 4MY3A 1Q7LA 1LQLA 2AJ6A 4M6IA 1Y7RA 3S1MI 1IIDA 2WUUA 1ZB9A 4XX2A 2ZENA 1XJOA 3NA6A 2RBLA 4JLYA 1YX0A 4P4JA 4MJ8A 1LAPA 1MK4A 1IY7A 3VTNA 4X5KA 4X6AI 2DXQA 5LYFA 2IMOA 3CCUZ 2B5GA 3V7ZA 4AB7A 4CRYB 2Z10A 3S15I 5T64A 4QVTA 1X0TA 2PJCA 2PMZA 2F4OA 4A3MI 3LWUA 2V8JA 4YFJA 4RS4A 3FKII 2ZOGA 1M44A 4F9UA 2ZEMA 4A3II 4QBJA 3GUXA 1Q16A 2JMOA 4HH4A 2DPTA 2EUIA 3EERA 2YGWA 4Q38A 3U50C 2ZW7A 5C3EI 1K732 4WWVA 4BD9A 2H85A 3D7FA 1CM0A 1P9NA 2ZELA 1TWHI 1WW9A 4A31A 4Y7NI 4IUSA 1CJWA 2B4DA 1Z9UA 4P4EA 2QVPA 3MGDA 1YQEA 4CYNA 3JUWA 4RVGA 1AUGA 1S72Z 4Y52I 2KPIA 2VPWA 3I55Z 2REFA 4C68A 4AYBA 5FLMI 1PYTB 2V8VA 5KTAA 1QSMA 2EO8A 4NGTA 1VKCA 1JQGA 2J6AA 1S7NA 4BBRI 3KQZA 4J3GA 4YU9A 4XPDC 4ONWA 4NEXA 4F8ZA 4MH4A 4HKFA 3W6XA 2WSAA 3H3VJ 1UFHA 5KTDA 1Z01A 3D2LA 4JZ0A 3TDHB 2JA8I 4KSFA 4JXRA 1KUVA 4KVOE 3S17I 4Z65A 1IYKA 5AG6A 2DE5A 4RS2A 2W04A 2ZEHA 3CD6Z 4FD5A 2VQYA 3PB6X 1I12A 3WABA 3H8GA 3J81b 4MXUA 3HOUI 1X3WA 3NDJA 5CNPA 2GTHA 2FXFA 3I07A 1RO2A 2QMLA 5BWAB 4LUAA 1VQOZ 4KOWA 5IB0A 2E2HI 2Q51A 2B4BA 4CYPA 3PFEA 1KRLA 4NGPA 3HOVI 1VQKZ 2PJ6A 3CCL1 1ML8A 4NBFA 4OP4A 1Q7Y2 3K2KA 3CPWZ 1BLLE 3D4UA 2FE7A 3SJXA 3CDXA 1ZG7A 4C2YA 4UFVA 4IAVA 5IV0A 3B7IA 2GTIA 1YI21 4OC1A 1NP6A 5F46A 1IU8A 1ZO0A 4CS0B 1IB1E 2VPXA 4ZX8A 2Z3NA 4MD8A 1B6BA 3S1QI 3BHXA 2JIMA 1VHOA 4NOZA 2QECA 5IB9A 2QJ8A 1N71A 1YHQ1 3BXMA 5G1ZA 2LFUA 3CC2Z 4UA3A 1Y0RA 2PSWA 2JIRA 2VI7A 1YW4A 1VQ51 4E2AA 2PM9A 5LRJA 2CF4A 1QSOA 2EWBA 3FEDA 4AXVA 4MBUA 4RVHA 1K731 4P44A 4MD9A 2PVVA 4CAEA 4FWUA 1ZH1A 1QMUA 1YJNZ 3SI0A 1S7MA 1VQ9Z 2V77A 2ARHA 2I3CA 4ZI6A 3WC7A 1VQPZ 2R7HA 3CPWY 3HOYI 4TWEA 1NSLA 4XPLA 3TE5B 3LMSA 2JA7I 2FSRA 2W03A 1PFTA 2OTL1 2JA6I 3JAMb 3VH9A 1BO4A 1BPMA 8CPAA 4OIDA 4NBHA 4II9A 2P6EA 3ZZIA 5IP9I 2HV2A 2OOXB 4AVCA 3V38A 4BINA 1AYEA 2P0WA 4H89A 2V8GA 4C2XA 1YGHA 1RQFA 3RZAA 5AG4A 2FCKA 5IP7I 1HDUA 3CZXA 4NJRA 3NDIA 2OR4A 3KASA 4Y49B 5C82A 5JQ4A 2YADA 2GLJA 2JEVA 2PDOA 2AFZA 3RZOI 4ONUA 5HXDA 4MONA 3HLPA 4MFZA 4Q7AA 2JBJA 5KTCA 3CCRZ 4UEZA 4C2ZA 4IF5A 1M1DA 2ABZA 4E2YA 2PC1A 3LUSA 4OADA 3SJEA 4KVME 1YJWZ 1VQ81 2E9HA 5IT9b 2EVNA 3CXQA 1QQ9A 1N2FA 4FAIA 3T8WA 1B87A 2PJAA 3W91A 4GM5A 1ZLIA 4B10A 5H84A 3TT2A 1NE9A 1UWYA 1Q821 1K83I 1IOIA 1S7LA 4KUAA 3KHZA 2YNCA 3T90A 2PRBA 3BJ7A 1Q7Y1 2R92I 5LL6f 2DEAA 7CPAA 3CC41 2JLMA 2QRDB 1VQL1 3R9GA 4A3LI 4UF4A 3FQQA 3BI1A 5AGEA 1YJ91 4OAEA 3DLJA 3CXCZ 1Z5RA 5DWNA 2BL1A 4LX9A 4BMHA 1P4NA 4B6ZA 3H0GI 3R95A 4R3LA 3MZLB 2WYRA 3DDDA 5K8OA 1JWHC 2JIPA 4E31A 4MHZA 1VQ4Z 2ZXVA 1NJI2 2PJ3A 3RNZA 1JWQA 3MZKB 2BOAA 1S7FA 5EMIA 2HB6A 2VL1A 3FXTA 3GTOI 1Y7EA 1VHEA 2QR1B 3IJ3A 2VUMI 3MRUA 1Y8CA 4MMOA 5T6BA 4I49A 3CCJZ 1ELLP 2VXKA 1TKFA 3D6WA 3D9XA 4K3NA 1YLOA 3IWWA 4MI4A 2Z3MA 4KZTA 3GIUA 3G6EZ 1NSAA 4U9ZA 4YGOA 2CNSA 3TC8A 1ZG8A 2IZ3A 4EVYA 3WC5A 3CCM1 4L89A 1QXFA 2J9AA 1CG2A 2IQ6A 1ZB8A 4U9YA 4F0YA 4CYOA 5THWA 4ZY0A 3CXCY 2OU2A 3VATA 2NMTA 4P4FA 3EXNA 2XEIA 2G2KA 3IFEA 3FX6A 3D7DA 3RBUA 5A2Qb 2JEWA 5DS0A 4ORFA 3TO7A 1TWGI 3TO6A 2JS4A 4MCQA 5JM6A 4RN7A 2RPRA 2WPWA 2QIRA 5C88A 3IU1A 1LANA 3CCU1 1ZLHA 1QF8A 1YW6A 1YVKA 2GANA 4EFDA 1I1DA 2GIVA 4W9YA 3FB3A 2R93I 3H5ZA 4MHNA 5AN9F 4X3RA 1I50I 4OKOA 3PP9A 1WWZA 1XMBA 4R9MA 4R76A 5G21A 1VHSA 1KQSY 3PEIA 2QA41 2E2II 4P45A 5JPHA 1Q2DA 3GB0A 2REEA 2HUZA 2Y0MA 2GFQA 3MONA 4NGSA 2OZUA 1Y1VS 2V8KA 2CY2A 2POKA 4KSIA 2PK7A 4KVXA 4MHYA 2QRCB 4XNHB 1A2ZA 1GYTA 3B35A 2PJ5A 4AVBA 4OIWA 6CPAA 3S9NA 2AFSA 4UCNA 1P0HA 2BO9A 3DSBA 1S721 3I551 4B5OA 3G8WA 4ZX9A 2G3TA 4B12A 4KORA 3S9LA 1RTQA 2KI7B 2Q4VA 5F09A 3CXPA 5DWMA 3SJFA 4RI1A 3WR7A 1RNIA 1EE3P 1VQN1 3GKQA 1K9M2 1X3ZA 3CCVZ 2VZZA 4S1TA 2F7VA 2V8DA 1IOFA 4OC3A 3F3PC 4NBCA 4E2ZA 3L2NA 5LRGA 3D3SA 3K9TA 1NJI1 2G3AA 2FT0A 4L8AA 2R8VA 1YITZ 2ZW5A 3NH4A 3CD61 3CCSZ 1LFWA 3S9MA 3RYOA 4P10A 2Q4YA 3D2MA 1N8R2 3HOZI 1XEBA 1M1K2 4R8FA 1IYLA 3GLJA 4XPKA 1QYPA 4NSQA 1VQO1 3KR4A 4UEEA 1Z03A 3PZJA 4DUKA 1IGBA 2Q0YA 1XFOA 3I561 2VEZA 2PIYA 2ZEGA 1KD12 1KC82 1SQHA 3EC4A 3IWEA 1Z4RA 1GHEA 4NBDA 4PK2A 5EC4A 2CIJA 1S5KA 3GTMS 2A4NA 4HNWB 3J81f 3QB8A 1LCPA 5I4MA 4H2KA 1WIIA 1Q2YA 3GTQI 1Q822 3CMAZ 1TKHA 2BCOA 2ZAEB 4C7IA 3S2DI 2DE7A 5C4JI 4XPDB 3MN8A 2PRQA 3CCEZ 3G71Z 2HC9A 2Q43A 2ZEOA 4NBAA 1CBXA 4MRIA 4F0XA 3GYAA 3CC21 2PJ1A 3KZWA 1ON0A 2Q4ZA 3PB8X 4UFWA 4FBEA 2JIQA 1VLAA 4P4DA 2K3RA 2QEX1 2JDCA 3S1NI 1XIXA 3CMEZ 1Y0YA 4NGNA 5JH9A 4A95A 2K5RA 4MFKA 2I79A 2EGTA 4P6YA 3G4SZ 2Z3PA 4EWCA 1VQ91 4DYOA 3DGVA 2PJBA 3D7HA 1VQP1 4UWIA 3KL9A 3TOAA 3R96A 5FLXb 4A3BI 2CTCA 2WB1A 5LRKA 4OC4A 3D7GA 3JVNA 4E30A 1TF8A 3BI0A 3R9FA 5T67A 3CXSA 3PO3S 2RIQA 1ARMA 2WPXA 1HDQA 4UIAA 5FLXf 1Q862 3FNCA 4YWYA 2HU9A
chains in the Genus database with same CATH topology
1K9M1 3J80b 2JA5I 2PE3A 4DJLA 4OC0A 1VQK1 5LYFA 1VQ5Z 1R43A 2IMOA 2PJ9A 4QTUA 3CCUZ 4EMEA 3CMA1 3V7ZA 4A3CI 4PXCA 2QREB 4MCPA 4FUUA 4B6ZA 4NB8A 3H0GI 1AMPA 3S15I 3MZLB 5T64A 2WYRA 1X0TA 3KIFA 2O53A 2M48A 5K8OA 2PJCA 1JWHC 2PJ0A 2PMZA 3CCE1 1CX8A 2F4OA 1R9TI 4E31A 4MHZA 1VQ4Z 3G711 1NJI2 2PJ3A 4A3MI 3LWUA 3MZKB 2EK9A 2V8JA 2BOAA 3GTPI 2V8HA 1NUIA 2HB6A 4RS4A 3FKII 2ZOGA 1F57A 2VL1A 3GTOI 1Y7EA 1BAVA 3JAMf 1Z02A 1VHEA 2QR1B 4F9UA 3Q87A 1Q812 2ZEMA 2JNYA 2VUMI 3IJ3A 3MRUA 4A3II 3S16I 4MMOA 5T6BA 3GUXA 3CCJZ 1ELLP 2WZNA 3EEDA 2P28A 2JMOA 3I56Z 1TKJA 1TXRA 4HH4A 2G9DA 1TKFA 3CME1 3D6WA 2ANPA 3D9XA 1N8R1 4K3NA 3S14I 3EERA 3U50C 1M1K1 1YLOA 1USPA 3IWWA 5C3EI 1K732 4WWVA 5JGFA 2EK8A 4BD9A 4A3KI 2H85A 5CPAA 2VUGA 3D7FA 3BG0B 3G6EZ 2ZEPA 2PJ4A 1NSAA 1P9NA 2ZELA 1TWHI 1YJW1 1TFIA 1WW9A 2IZ4A 3CCQZ 3VMHA 3KIHA 4Y7NI 1I6HI 2R7ZI 3KGQA 2B63I 3TC8A 1VQMZ 3S1RI 3G4S1 1ZG8A 4P4EA 1RO4A 2QVPA 3FF3A 2IZ3A 4BBSI 3SI1A 3WC5A 3PB7X 4BY1I 3GTLI 3CCM1 1SFOI 3WC6A 3CCLZ 4NJQA 3PB9X 2J9AA 1CG2A 2IQ6A 1CP6A 4QTTA 4RVGA 2AFMA 5HVGA 2R6MA 1S72Z 1KC81 1KD11 1ZB8A 4Y52I 2KPIA 3I55Z 4E2WA 4AYBA 3D68A 2NYQA 5THWA 1M901 5FLMI 1PYTB 4WJBA 1QVGY 4ZY0A 3CXCY 2V8VA 4NGTA 3VATA 2O4HA 4P4FA 4RVFA 4ZYQA 3IIBA 1YJN1 1VQ6Z 1JQGA 2J6AA 2XEIA 2G2KA 4DQYB 1W2BZ 3IFEA 3FX6A 4BBRI 3TX8A 3KQZA 3D7DA 4HGZA 3RBUA 3I4MI 5A2Qb 4YU9A 2WAQA 4ONWA 2JEWA 5DS0A 4F8ZA 4MH4A 1YI2Z 4A3JI 5LYLA 1TWGI 3VB9A 3BG1B 2JS4A 3H3VJ 4MCQA 1Y1VI 5JM6A 5IT9f 3M4OI 2RPRA 2V8IA 3VMIA 2OTJ1 4MHPA 2QEXZ 1Z01A 4A3DI 1LANA 3CCU1 1ZLHA 1QF8A 3QNVA 4NBGA 1YW6A 3M3YI 2QYVA 5K8NA 4JZ0A 3TDHB 2PJ8A 4EFDA 2JA8I 4W9YA 5ELYA 1Y1WI 5CBMA 2R93I 3S17I 1FNOA 1BPNA 4BXXI 1YHQZ 2AFXA 4Z65A 1QVGZ 4MHNA 4IK2A 5AN9F 4X3RA 2DE5A 1I50I 2W04A 4OKOA 2ZEDA 2F4MA 1DTDA 1VQ41 2ZEHA 3OW2Z 1FT7A 3CD6Z 2OOYB 3HKZA 3P5JB 1XMBA 4IHMA 3PB6X 3CPAA 4R76A 3WABA 3B3CA 3H8GA 1KQSY 1JJ2Z 3PB4X 3CCJ1 2GLFA 2QA41 2E2II 3PEIA 4P45A 4OC2A 3SJGA 3J81b 4MXUA 3CC7Z 4RVDA 3HOUI 1X3WA 3NDJA 3ISXA 3GB0A 2GTHA 2OOTA 3QWUA 4F9VA 3I07A 3J80f 1WCMI 1RO2A 4NBBA 3CQZI 2ZOFA 3MONA 1VQOZ 3G6E1 1F2PA 4NGSA 1Y1VS 2V8KA 1VQ71 3PFOA 4CL1A 4UEFA 5D1OB 2PJ2A 2POKA 4KSIA 3IO1A 4A93I 2PK7A 2RT9A 1VQLZ 2E2HI 3PBBA 2QRCB 2Q51A 4MHYA 4DGLA 3CCQ1 2LIYA 1GYTA 3B35A 1TWFI 2PJ5A 4OMEA 3PFEA 2NVXI 3B3TA 1VQM1 1YMEA 5CM2M 4CPAA 1KRLA 4NGPA 3T4NB 4OIWA 1H8LA 6CPAA 1RLYA 4RUHA 3HOVI 3S9NA 2AFSA 3CCR1 1W2BY 4NGRA 1ELMP 1VQKZ 3SI2A 1K8A1 2PJ6A 1ML8A 3CCL1 2BO9A 2YU9I 2OTLZ 2JBKA 3B3SA 4A3FI 4NBFA 3WT4A 4OP4A 1S721 3IF8A 3I551 1KQSZ 3CPXA 3ISZA 1HEEA 2DE6A 1Q7Y2 3K2KA 4ZX9A 3CPWZ 3GCFA 5C44I 1BLLE 3D4UA 1VQ61 3S9LA 1RTQA 3SJXA 3CDXA 2KI7B 1ZG7A 1TWCI 4HGYA 1VIXA 4A94A 1RO0A 3F3FC 4PXEA 5F09A 1Q861 4ZY1A 3IFUA 4IAVA 3SJFA 2C6PA 3B7IA 1RNIA 1EE3P 2GTIA 1YI21 1VQN1 4OC1A 3GKQA 4E33A 1K9M2 4P4IA 1NP6A 1X3ZA 2GREA 3CCVZ 4MCSA 4JYWA 4PXBA 4S1TA 4ZX8A 5D8NA 3OW2Y 2F7VA 2E2JI 2V8DA 1XRYA 4MD8A 4OC3A 3S1QI 3BHXA 4A3GI 4R6TA 3F3PC 3NH5A 4NBCA 2AFOA 1VHOA 4E2ZA 4NOZA 3L2NA 5LRGA 4BY7I 2CTBA 4MCRA 3I4NI 4RV9A 5IB9A 2QJ8A 3K9TA 1NJI1 3GTKI 1JJ2Y 4R7MA 1YHQ1 3BXMA 4O23A 5D29A 4LQGA 2LFUA 3CC2Z 2OZKA 4A3EI 3N5FA 1Y0RA 2NVTI 1YITZ 2ZEEA 3FH4A 1Q811 3NH4A 4NB9A 3VMGA 3CCSZ 3CD61 1LFWA 1YW4A 1VQ51 2PM9A 3GTMI 3S9MA 3IEHA 5LRJA 1L1OC 4X2TA 2CF4A 1YIJZ 3NH8A 5A2Qf 2ZEFA 4P10A 2Y0SA 2EWBA 1YSJA 4NBEA 5D1PA 3FEDA 4MD7A 3CT9A 4AXVA 3KHXA 4PQAA 1QVFY 2XEFA 2AFUA 1N8R2 3HOZI 1DE4C 2PIZA 5LYDA 1VQ8Z 1M1K2 4RVHA 3CC71 1K731 4MD9A 2PVVA 4P44A 1VGYA 4R8FA 2JR6A 4FWUA 1ZH1A 5K8MA 1XBUA 3GLJA 1QMUA 1YJNZ 3FJUA 3SI0A 1S7MA 1QYPA 3PBEA 1VQ9Z 2V77A 1CP7A 1VQO1 3KR4A 4UEEA 2I3CA 1PCAA 4ZI6A 1Z03A 1YUAA 4DUKA 1TF9A 2GU2A 1IGBA 3WC7A 1VQPZ 3B3WA 1CPXA 3FEEA 1Z2LA 1XFOA 4A39A 3CPWY 3I561 3B2YA 3S2HI 3HOYI 1LAMA 4X8IA 2PIYA 4TWEA 2PJ7A 2C6CA 3HUVA 3TE5B 3KI9A 2P3YA 2ZEGA 1KD12 1KC82 2OTJZ 3LMSA 3KR5A 2JA7I 2RB7A 3PRTA 2W03A 1M902 2XEJA 1PFTA 2OTL1 2JA6I 2HF1A 3JAMb 1TWAI 3HOWI 3CC4Z 3VH9A 1BPMA 4NBDA 4OIDA 8CPAA 4NBHA 1QVFZ 2CIJA 1ARLA 2IJZA 3ESWA 4E32A 5HVHA 3GTMS 1YJ9Z 4A37A 5IP9I 1USPB 1OBRA 3J81f 3K7AI 1LCPA 2OOXB 4PXDA 5I4MA 3JRUA 4H2KA 1WIIA 2RFHA 3V38A 3GTQI 1AYEA 1Q822 2V8GA 4TNUA 3H8FA 3CMAZ 1F2OA 1TKHA 2PCUA 4NH1C 1RQFA 3RZAA 5J1QA 2BCOA 3CCV1 2ZAEB 4PPZA 3D67A 5IP7I 1HDUA 2C6GA 3S2DI 3RAMA 2DE7A 2AFWA 2QA4Z 4NJRA 2AKLA 3NDIA 2OR4A 4NFRA 3KASA 5D1OA 2QKDA 5C4JI 3MN8A 2PRQA 4UIBA 4E2XA 3CCEZ 5C4XI 4NGMA 1DL6A 4G1PA 3G71Z 2XEGA 2YADA 2GLJA 2HC9A 3FMCA 2Q43A 3HOXI 2AFZA 3RZOI 1VQ7Z 2RHBA 2ZEOA 5HXDA 4NBAA 3FECA 4MONA 1CBXA 4MRIA 4DK1A 3H8EA 3HLPA 4Q7AA 1LOKA 3CC21 3PO3I 2PJ1A 2FVGA 2VF1A 4EWTA 3KZWA 3PB8X 2Q4ZA 1YIT1 4FBEA 1M4LA 3IX0A 1VLAA 4P4DA 3PO2I 2K3RA 3CCS1 2JBJA 3J7A4 2QEX1 4P4BA 3FVLA 3S1NI 2BJOA 2NSMA 3CMEZ 1Y0YA 1I3QI 3CCRZ 2M6NA 3KQXA 4NGNA 5K8PA 4UEZA 5JH9A 2JUBA 3D66A 2ABZA 1YIJ1 2C1CA 2NVQI 4E2YA 2K5RA 3LUSA 3SJEA 1YJWZ 1VQ81 3NFZA 1Z8LA 2QLVB 2F8HA 3B3VA 2E9HA 5IT9b 1R3NA 2PVWA 3I1UA 1QQ9A 1KWMA 1N2FA 2EGTA 4P6YA 3RZDI 4FAIA 2NVYI 3G4SZ 3T8WA 4EWCA 1VQ91 1CPSA 4DYOA 2PJAA 3DGVA 1YUKA 4GM5A 2PJBA 1ZLIA 3CCMZ 4OC5A 4NGQA 3GTJI 1ZG9A 3D7HA 1VQP1 1VQNZ 3GTGI 3KL9A 1UWYA 1Q821 1K83I 1Q7LA 5FLXb 4A3BI 2CTCA 1LQLA 2WB1A 1K8A2 4OC4A 3D7GA 3KHZA 5LRKA 3FQMA 3S1MI 5LYIA 4E30A 1ZB9A 1TF8A 4XX2A 3BI0A 2ZENA 1Q7Y1 5T67A 1XJOA 4ZY2A 3VARA 3NA6A 2RBLA 2R92I 5LL6f 2DEAA 7CPAA 3CC41 3PO3S 4A38A 2QRDB 4P4JA 2RIQA 1ARMA 1VQL1 4A3LI 4UF4A 3IC1A 3FQQA 3BI1A 1YJ91 1HDQA 3DLJA 3CXCZ 4UIAA 1Z5RA 5FLXf 1Q862 1LAPA 1IY7A 5HVFA 3VTNA 4YWYA 4X6AI 2HU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PE3 A;  4DJL A;  4OC0 A;  5LYF A;  2IMO A;  1R43 A;  2PJ9 A;  4EME A;  3V7Z A;  4PXC A;  4MCP A;  4FUU A;  4B6Z A;  1AMP A;  2WYR A;  2O53 A;  5K8O A;  2PJC A;  2PJ0 A;  1CX8 A;  4MHZ A;  2PJ3 A;  3LWU A;  2EK9 A;  2BOA A;  2V8H A;  2HB6 A;  2ZOG A;  1F57 A;  2VL1 A;  1Y7E A;  1BAV A;  1VHE A;  4F9U A;  2ZEM A;  3IJ3 A;  3MRU A;  4MMO A;  3GUX A;  1ELL P;  2WZN A;  1TKJ A;  1TXR A;  2G9D A;  1TKF A;  2ANP A;  4K3N A;  1YLO A;  3IWW A;  5JGF A;  4WWV A;  2EK8 A;  4BD9 A;  5CPA A;  3D7F A;  2ZEP A;  2PJ4 A;  1NSA A;  2ZEL A;  3KGQ A;  3TC8 A;  1ZG8 A;  4P4E A;  2QVP A;  3FF3 A;  3SI1 A;  3WC5 A;  3PB7 X;  3WC6 A;  4NJQ A;  3PB9 X;  2J9A A;  1CG2 A;  2IQ6 A;  1CP6 A;  5HVG A;  2AFM A;  3D68 A;  2NYQ A;  5THW A;  1PYT B;  4WJB A;  4ZY0 A;  2V8V A;  4NGT A;  3VAT A;  2O4H A;  4P4F A;  4ZYQ A;  3IIB A;  1JQG A;  2XEI A;  3IFE A;  3FX6 A;  3TX8 A;  3KQZ A;  3D7D A;  3RBU A;  4YU9 A;  4ONW A;  2JEW A;  5DS0 A;  4F8Z A;  5LYL A;  4MCQ A;  5JM6 A;  4MHP A;  1LAN A;  1ZLH A;  3QNV A;  1YW6 A;  2QYV A;  5K8N A;  4JZ0 A;  2PJ8 A;  4EFD A;  4W9Y A;  5ELY A;  5CBM A;  1FNO A;  1BPN A;  4Z65 A;  2AFX A;  4MHN A;  4IK2 A;  4X3R A;  4OKO A;  2ZED A;  1DTD A;  2ZEH A;  1FT7 A;  1XMB A;  4IHM A;  3PB6 X;  3CPA A;  4R76 A;  3WAB A;  3B3C A;  3H8G A;  3PB4 X;  2GLF A;  3PEI A;  4P45 A;  4OC2 A;  3SJG A;  4MXU A;  3ISX A;  3GB0 A;  2OOT A;  4F9V A;  2ZOF A;  1F2P A;  4NGS A;  3PFO A;  4UEF A;  2PJ2 A;  2POK A;  4KSI A;  3IO1 A;  4MHY A;  3PBB A;  2Q51 A;  1GYT A;  3B35 A;  2PJ5 A;  4OME A;  3PFE A;  3B3T A;  1YME A;  4CPA A;  4NGP A;  4OIW A;  1H8L A;  6CPA A;  4RUH A;  3S9N A;  2AFS A;  4NGR A;  1ELM P;  3SI2 A;  2PJ6 A;  2BO9 A;  2JBK A;  3B3S A;  3WT4 A;  4OP4 A;  3CPX A;  3ISZ A;  1HEE A;  3K2K A;  4ZX9 A;  1BLL E;  3D4U A;  3S9L A;  1RTQ A;  3SJX A;  3CDX A;  1ZG7 A;  1VIX A;  4A94 A;  4PXE A;  5F09 A;  4ZY1 A;  3SJF A;  4IAV A;  2C6P A;  3B7I A;  1EE3 P;  4OC1 A;  4P4I A;  2GRE A;  4MCS A;  4JYW A;  4PXB A;  4ZX8 A;  5D8N A;  2F7V A;  2V8D A;  1XRY A;  4OC3 A;  3BHX A;  4R6T A;  3NH5 A;  2AFO A;  1VHO A;  3L2N A;  5LRG A;  2CTB A;  4MCR A;  5IB9 A;  2QJ8 A;  3K9T A;  4R7M A;  3BXM A;  4O23 A;  5D29 A;  4LQG A;  3N5F A;  1Y0R A;  2ZEE A;  3FH4 A;  3NH4 A;  1YW4 A;  1LFW A;  3S9M A;  3IEH A;  5LRJ A;  4X2T A;  2CF4 A;  3NH8 A;  2ZEF A;  4P10 A;  2EWB A;  1YSJ A;  3FED A;  4AXV A;  3CT9 A;  3KHX A;  4PQA A;  2XEF A;  2AFU A;  1DE4 C;  2PIZ A;  5LYD A;  4P44 A;  4R8F A;  2PVV A;  1VGY A;  4FWU A;  5K8M A;  1XBU A;  3GLJ A;  1QMU A;  3FJU A;  3SI0 A;  3PBE A;  2V77 A;  1CP7 A;  3KR4 A;  4UEE A;  2I3C A;  1PCA A;  4ZI6 A;  4DUK A;  1TF9 A;  2GU2 A;  1IGB A;  3WC7 A;  3B3W A;  1CPX A;  3FEE A;  1Z2L A;  1XFO A;  4A39 A;  3B2Y A;  1LAM A;  4X8I A;  2PIY A;  4TWE A;  2PJ7 A;  2C6C A;  3HUV A;  3KI9 A;  2ZEG A;  3LMS A;  3KR5 A;  2RB7 A;  3PRT A;  2XEJ A;  3VH9 A;  1BPM A;  8CPA A;  4OID A;  2CIJ A;  1ARL A;  2IJZ A;  5HVH A;  4A37 A;  1OBR A;  1LCP A;  4PXD A;  5I4M A;  3JRU A;  4H2K A;  2RFH A;  3V38 A;  1AYE A;  2V8G A;  4TNU A;  3H8F A;  1F2O A;  1TKH A;  2PCU A;  3RZA A;  5J1Q A;  2BCO A;  4PPZ A;  3D67 A;  1HDU A;  2C6G A;  3RAM A;  2AFW A;  4NJR A;  2OR4 A;  4NFR A;  3KAS A;  3MN8 A;  2PRQ A;  4UIB A;  4NGM A;  4G1P A;  2XEG A;  2GLJ A;  2HC9 A;  3FMC A;  2Q43 A;  2AFZ A;  2ZEO A;  5HXD A;  3FEC A;  1CBX A;  3H8E A;  4MRI A;  3HLP A;  4Q7A A;  1LOK A;  4EWT A;  2PJ1 A;  2FVG A;  3KZW A;  3PB8 X;  2Q4Z A;  4FBE A;  1M4L A;  4P4D A;  2JBJ A;  4P4B A;  3FVL A;  2NSM A;  1Y0Y A;  4NGN A;  3KQX A;  5K8P A;  4UEZ A;  5JH9 A;  3D66 A;  2ABZ A;  2C1C A;  3SJE A;  3NFZ A;  1Z8L A;  2F8H A;  3B3V A;  1R3N A;  2PVW A;  3I1U A;  1QQ9 A;  1KWM A;  4P6Y A;  4FAI A;  3T8W A;  1CPS A;  4DYO A;  2PJA A;  3DGV A;  4GM5 A;  2PJB A;  1ZLI A;  4OC5 A;  4NGQ A;  1ZG9 A;  3D7H A;  3KL9 A;  1UWY A;  1Q7L A;  2CTC A;  5LRK A;  4OC4 A;  3D7G A;  3KHZ A;  5LYI A;  1TF8 A;  3BI0 A;  2ZEN A;  4ZY2 A;  1XJO A;  3VAR A;  3NA6 A;  2DEA A;  7CPA A;  4A38 A;  4P4J A;  1ARM A;  4UF4 A;  3IC1 A;  3BI1 A;  1HDQ A;  3DLJ A;  4UIA A;  1Z5R A;  1LAP A;  1IY7 A;  5HVF A;  4YWY A; 
#chains in the Genus database with same CATH topology
 1K9M 1;  3J80 b;  2JA5 I;  2PE3 A;  4DJL A;  1VQ5 Z;  4QTU A;  3RO0 A;  3N7Z A;  4PXC A;  4B14 A;  4FUU A;  4KS9 A;  2C27 A;  4M85 A;  1QSR A;  2O53 A;  2M48 A;  2PJ0 A;  1CX8 A;  4KLV A;  1R9T I;  3K9U A;  2EK9 A;  3LAC A;  3GTP I;  2V8H A;  4JD6 A;  1BAV A;  3JAM f;  1Z02 A;  1SIW A;  3BJ8 A;  1Q81 2;  3S16 I;  4DNC A;  1MJ9 A;  3F8K A;  2WZN A;  2B58 A;  3EED A;  1TKJ A;  1TXR A;  2G9D A;  2ANP A;  4MFQ A;  1N8R 1;  1M1K 1;  2EK8 A;  1XF8 A;  4A3K I;  2VUG A;  3BG0 B;  2ZEP A;  3R1K A;  1YJW 1;  3CCQ Z;  3VMH A;  2R7Z I;  4H6U A;  2AE6 A;  2B63 I;  4ZGY B;  1VQM Z;  3S1R I;  4QC6 A;  2DPS A;  1XMT A;  1YLE A;  3PB7 X;  4KOS A;  4A2Z A;  3PB9 X;  2NAP A;  4QTT A;  2JIO A;  1KD1 1;  1KC8 1;  3D68 A;  4WJB A;  1QVG Y;  1TIQ A;  4RVF A;  4KUB A;  1VQ6 Z;  2FIW A;  4HGZ A;  3I4M I;  1KUX A;  3FRM A;  5LYL A;  3IR7 A;  3VB9 A;  1Y1V I;  4UCP A;  5IT9 f;  3M4O I;  3VMI A;  2V8I A;  2OTJ 1;  4MHP A;  1M4G A;  4A3D I;  2O28 A;  2J8R A;  4NBG A;  3M3Y I;  2Q7B A;  2PJ8 A;  4CAF A;  5ELY A;  5CBM A;  1FNO A;  1BPN A;  2R1I A;  2AFX A;  3W6S A;  4CAX A;  2VBQ A;  3G3S A;  1DTD A;  1VQ4 1;  2ZW6 A;  3OW2 Z;  5ISV A;  2OOY B;  4MY0 A;  2Q7S A;  4IHM A;  4R3K A;  4E0A A;  3ZJ0 A;  3CCJ 1;  2GLF A;  4YRH A;  1QSN A;  3SJG A;  3CC7 Z;  1YK3 A;  3QWU A;  2OZH A;  3UY5 A;  3NE8 A;  1LRZ A;  4NBB A;  3T9Y A;  3G6E 1;  1VQ7 1;  3PFO A;  3F5B A;  2PJ2 A;  2IV2 X;  1VQL Z;  1TWF I;  4OME A;  4CPA A;  5CM2 M;  3S6G A;  2HQY A;  1H8L A;  4KOT A;  1RLY A;  1R57 A;  4NGR A;  3SI2 A;  5IX3 A;  4A3F I;  3IF8 A;  1KQS Z;  3CPX A;  4NF1 A;  3ISZ A;  1HEE A;  2DE6 A;  3GCF A;  1PUA A;  2PR1 A;  1TWC I;  4HGY A;  1VIX A;  1RO0 A;  1Q86 1;  2X7B A;  3EO4 A;  3D8P A;  4OLL A;  4P4I A;  2GRE A;  3LD2 A;  2E7Z A;  2BSW A;  4PXB A;  5EBV A;  3S6F A;  4UWJ A;  5D8N A;  3OW2 Y;  2E2J I;  4KLW A;  4RV9 A;  2Q44 A;  3GTK I;  5D29 A;  2BUE A;  3PGP A;  2V3V A;  2OZK A;  4A3E I;  2NVT I;  3FH4 A;  1Q81 1;  3VMG A;  4NB9 A;  3GTM I;  3IEH A;  1L1O C;  4X2T A;  4KOU A;  1YIJ Z;  3NH8 A;  5A2Q f;  1YSJ A;  4NBE A;  5D1P A;  4MD7 A;  3CT9 A;  3KHX A;  4PQA A;  4ZBG A;  1QVF Y;  2AFU A;  1DE4 C;  1Z8T A;  1VGY A;  5K8M A;  1XBU A;  3FJU A;  1PCA A;  1YUA A;  1Y9W A;  1Z8X A;  5G20 A;  3SXO A;  4A39 A;  2VZY A;  1LAM A;  4C7H A;  2C6C A;  3HUV A;  2ZPA A;  2P3Y A;  4CGP A;  3KR5 A;  2RB7 A;  3PRT A;  1M90 2;  2XEJ A;  4KOY A;  1TWA I;  4M6H A;  4HPS A;  2IJZ A;  3ESW A;  4E32 A;  2EBJ A;  5HVH A;  1USP B;  5AG5 A;  3JRU A;  2RFH A;  4UCM A;  1S3Z A;  4PK3 A;  5I0C A;  4TNU A;  3H8F A;  4B11 A;  4H6Z A;  2Z11 A;  5J1Q A;  3CCV 1;  3KKW A;  3D67 A;  2C6G A;  2AFW A;  2QA4 Z;  1Z4E A;  4PSW A;  4E2X A;  5C4X I;  4NGM A;  4CRZ B;  3FMC A;  1YVO A;  1FDO A;  2RHB A;  2IL4 A;  5F49 A;  3PO3 I;  4EWT A;  2FVG A;  1YIT 1;  1M4L A;  3CCS 1;  2BJO A;  2V45 A;  1WK4 A;  2M6N A;  3KQX A;  3D66 A;  2NVQ I;  3QAY A;  3SHP A;  3NFZ A;  1Z8L A;  2QLV B;  2F8H A;  3B3V A;  2KCW A;  2PVW A;  3I1U A;  1XE4 A;  2NVY I;  4B5P B;  5FVJ A;  2AYD A;  1YUK A;  3LOD A;  4FD7 A;  4OC5 A;  4FD4 A;  1VQN Z;  3GTG I;  4M3S A;  1K8A 2;  1OZP A;  3FQM A;  5LYI A;  5H86 A;  3TCV A;  4ZY2 A;  1RO5 A;  3VAR A;  4A38 A;  4E8O A;  4CGO A;  3GKR A;  1I21 A;  3IC1 A;  3B8G A;  4QB9 A;  5HVF A;  2YNC C;  1QST A;  4OC0 A;  1VQK 1;  2PJ9 A;  1R43 A;  4EME A;  4R57 A;  3CMA 1;  4A3C I;  2QRE B;  3SXN A;  4MCP A;  4NB8 A;  1KZF A;  3IWG A;  1AMP A;  3KIF A;  4NCZ A;  3CCE 1;  4CGM A;  2Z3O A;  3G71 1;  1NUI A;  1F57 A;  3Q87 A;  2JNY A;  4GXH A;  1MJA A;  5HH1 A;  2P28 A;  3I56 Z;  5J8C A;  1IIC A;  4MFP A;  2F5I A;  3CME 1;  3P2F A;  3S14 I;  4KSA A;  1USP A;  5JGF A;  3TTH A;  4A32 A;  5CPA A;  1M4D A;  1NMT A;  4QUS A;  2PJ4 A;  4BBH A;  3QAH A;  1TFI A;  4UFX A;  3EFA A;  2IZ4 A;  3KIH A;  1I6H I;  3KGQ A;  3G4S 1;  3TO9 A;  5J8F A;  1RO4 A;  1Z8W A;  3FF3 A;  4BBS I;  3SI1 A;  4U5Y A;  4CAV A;  4PV6 A;  4BY1 I;  3GTL I;  1SFO I;  3WC6 A;  3CCL Z;  4NJQ A;  4CAW A;  4MHD A;  1CP6 A;  5HVG A;  2AFM A;  2R6M A;  4E2W A;  2NYQ A;  1M90 1;  2O4H A;  4ZYQ A;  3IIB A;  1YJN 1;  2K5T A;  1W2B Z;  4DQY B;  3TX8 A;  4HNX B;  4Y49 C;  2WAQ A;  1XOV A;  2VPY A;  4AG7 A;  1YI2 Z;  5G22 A;  4A3J I;  3FYN A;  3BG1 B;  2CNT A;  1BOB A;  3NE7 A;  2QEX Z;  3QNV A;  1U6M A;  2QYV A;  4JWP A;  5K8N A;  2G0B A;  4B5P A;  2YND A;  1Y1W I;  2P6F A;  4BXX I;  1YHQ Z;  1QVG Z;  1J4J A;  4IK2 A;  3IGR A;  3TE4 A;  2ZED A;  2F4M A;  1FT7 A;  2D4O A;  5GCN A;  3HKZ A;  4PSX A;  3P5J B;  3JTK A;  3S6H A;  3CPA A;  3VWE A;  1MJB A;  3B3C A;  1JJ2 Z;  3PB4 X;  3H4Q A;  3R9E A;  4OC2 A;  4A33 A;  3I9S A;  4RVD A;  3ISX A;  3TFY A;  2OOT A;  2JDD A;  3C26 A;  4F9V A;  2R98 A;  3J80 f;  1WCM I;  1X12 A;  3CQZ I;  2ZOF A;  4K30 A;  1RXT A;  1F2P A;  4Q36 A;  4CL1 A;  4UEF A;  5D1O B;  2ZW4 A;  3IO1 A;  4A93 I;  4CYQ A;  2RT9 A;  5A28 A;  3PBB A;  4DGL A;  3CCQ 1;  2LIY A;  3DR8 A;  2NVX I;  4JXQ A;  3B3T A;  1VQM 1;  1YME A;  2BEI A;  3T4N B;  2CXA A;  2I00 A;  2OB0 A;  1YR0 A;  4RUH A;  1S7K A;  3OWC A;  3CCR 1;  1W2B Y;  1ELM P;  2FL4 A;  1K8A 1;  2YU9 I;  2OTL Z;  2JBK A;  3B3S A;  3WT4 A;  4HNY B;  1FY7 A;  3FBU A;  4JJX A;  5C44 I;  2B3U A;  1VQ6 1;  1WZN A;  4KOX A;  2ATR A;  2P6G A;  4A94 A;  5F48 A;  3F3F C;  4PXE A;  1L0C A;  4ZY1 A;  3IFU A;  2PQ8 A;  2C6P A;  4E33 A;  4KOV A;  1WJ2 A;  3P2H A;  5AG7 A;  1V0C A;  3V8I A;  4MCS A;  4JYW A;  1XRY A;  4MFJ A;  4CGL A;  4A3G I;  4R6T A;  3NH5 A;  3I3G A;  2AFO A;  4BY7 I;  2CTB A;  4MCR A;  3I4N I;  2YNE A;  4R7M A;  1JJ2 Y;  4O23 A;  4LQG A;  2RC4 A;  2FS5 A;  3N5F A;  4M6G A;  4CGN A;  2OZG A;  2ZEE A;  3F0A A;  2Q04 A;  4GS4 A;  3BLN A;  2VPZ A;  5F47 A;  2ZEF A;  2Y0S A;  1KUY A;  5A27 A;  2XEF A;  1Y9K A;  2PIZ A;  5HMN A;  5LYD A;  1VQ8 Z;  4F6A A;  3CC7 1;  2B5G B;  2JR6 A;  2Z0Z A;  2Z3K A;  3PBE A;  1CP7 A;  2GE3 A;  4FD6 A;  2Z3L A;  4A30 A;  1TF9 A;  2H5M A;  2GU2 A;  1K4J A;  3B3W A;  3FIX A;  1CPX A;  3FEE A;  1Z2L A;  2D4P A;  3B2Y A;  3S2H I;  2J8M A;  4X8I A;  3A9L A;  2PJ7 A;  4AG9 A;  3KI9 A;  2OTJ Z;  4LQ6 A;  1FDI A;  2HF1 A;  3HOW I;  3CC4 Z;  1QVF Z;  1ARL A;  1PU9 A;  1AA6 A;  1YJ9 Z;  4A37 A;  1Q2C A;  1OBR A;  3K7A I;  4PXD A;  2J8N A;  2OH1 A;  4MFL A;  1F2O A;  2PCU A;  2PR8 A;  4NH1 C;  3VWD A;  5E96 A;  2B4D B;  4PPZ A;  3RAM A;  2AKL A;  3EY5 A;  4NFR A;  5D1O A;  2QKD A;  3IU2 A;  4UIB A;  4AVA A;  1M4I A;  1DL6 A;  4G1P A;  2XEG A;  1S60 A;  3HOX I;  3TOB A;  1VQ7 Z;  3FEC A;  3H8E A;  4DK1 A;  1LOK A;  1YRE A;  4B13 A;  4NXY A;  2VF1 A;  3D2P A;  3DR6 A;  3IX0 A;  3PO2 I;  2B3V A;  3J7A 4;  3S6K A;  4P4B A;  3FVL A;  2NSM A;  4XNH C;  1I3Q I;  5K8P A;  4R87 A;  2JUB A;  1YIJ 1;  2C1C A;  3GY9 A;  1R3N A;  2CNM A;  3DNS A;  1KWM A;  2FIA A;  3RZD I;  2LEX A;  1CPS A;  1X10 A;  3E0K A;  3CCM Z;  4NGQ A;  3GTJ I;  1ZG9 A;  2ODF A;  4UBR A;  2DF5 A;  4MY3 A;  1Q7L A;  1LQL A;  2AJ6 A;  4M6I A;  1Y7R A;  3S1M I;  1IID A;  2WUU A;  1ZB9 A;  4XX2 A;  2ZEN A;  1XJO A;  3NA6 A;  2RBL A;  4JLY A;  1YX0 A;  4P4J A;  4MJ8 A;  1LAP A;  1MK4 A;  1IY7 A;  3VTN A;  4X5K A;  4X6A I;  2DXQ A;  5LYF A;  2IMO A;  3CCU Z;  2B5G A;  3V7Z A;  4AB7 A;  4CRY B;  2Z10 A;  3S15 I;  5T64 A;  4QVT A;  1X0T A;  2PJC A;  2PMZ A;  2F4O A;  4A3M I;  3LWU A;  2V8J A;  4YFJ A;  4RS4 A;  3FKI I;  2ZOG A;  1M44 A;  4F9U A;  2ZEM A;  4A3I I;  4QBJ A;  3GUX A;  1Q16 A;  2JMO A;  4HH4 A;  2DPT A;  2EUI A;  3EER A;  2YGW A;  4Q38 A;  3U50 C;  2ZW7 A;  5C3E I;  1K73 2;  4WWV A;  4BD9 A;  2H85 A;  3D7F A;  1CM0 A;  1P9N A;  2ZEL A;  1TWH I;  1WW9 A;  4A31 A;  4Y7N I;  4IUS A;  1CJW A;  2B4D A;  1Z9U A;  4P4E A;  2QVP A;  3MGD A;  1YQE A;  4CYN A;  3JUW A;  4RVG A;  1AUG A;  1S72 Z;  4Y52 I;  2KPI A;  2VPW A;  3I55 Z;  2REF A;  4C68 A;  4AYB A;  5FLM I;  1PYT B;  2V8V A;  5KTA A;  1QSM A;  2EO8 A;  4NGT A;  1VKC A;  1JQG A;  2J6A A;  1S7N A;  4BBR I;  3KQZ A;  4J3G A;  4YU9 A;  4XPD C;  4ONW A;  4NEX A;  4F8Z A;  4MH4 A;  4HKF A;  3W6X A;  2WSA A;  3H3V J;  1UFH A;  5KTD A;  1Z01 A;  3D2L A;  4JZ0 A;  3TDH B;  2JA8 I;  4KSF A;  4JXR A;  1KUV A;  4KVO E;  3S17 I;  4Z65 A;  1IYK A;  5AG6 A;  2DE5 A;  4RS2 A;  2W04 A;  2ZEH A;  3CD6 Z;  4FD5 A;  2VQY A;  3PB6 X;  1I12 A;  3WAB A;  3H8G A;  3J81 b;  4MXU A;  3HOU I;  1X3W A;  3NDJ A;  5CNP A;  2GTH A;  2FXF A;  3I07 A;  1RO2 A;  2QML A;  5BWA B;  4LUA A;  1VQO Z;  4KOW A;  5IB0 A;  2E2H I;  2Q51 A;  2B4B A;  4CYP A;  3PFE A;  1KRL A;  4NGP A;  3HOV I;  1VQK Z;  2PJ6 A;  3CCL 1;  1ML8 A;  4NBF A;  4OP4 A;  1Q7Y 2;  3K2K A;  3CPW Z;  1BLL E;  3D4U A;  2FE7 A;  3SJX A;  3CDX A;  1ZG7 A;  4C2Y A;  4UFV A;  4IAV A;  5IV0 A;  3B7I A;  2GTI A;  1YI2 1;  4OC1 A;  1NP6 A;  5F46 A;  1IU8 A;  1ZO0 A;  4CS0 B;  1IB1 E;  2VPX A;  4ZX8 A;  2Z3N A;  4MD8 A;  1B6B A;  3S1Q I;  3BHX A;  2JIM A;  1VHO A;  4NOZ A;  2QEC A;  5IB9 A;  2QJ8 A;  1N71 A;  1YHQ 1;  3BXM A;  5G1Z A;  2LFU A;  3CC2 Z;  4UA3 A;  1Y0R A;  2PSW A;  2JIR A;  2VI7 A;  1YW4 A;  1VQ5 1;  4E2A A;  2PM9 A;  5LRJ A;  2CF4 A;  1QSO A;  2EWB A;  3FED A;  4AXV A;  4MBU A;  4RVH A;  1K73 1;  4P44 A;  4MD9 A;  2PVV A;  4CAE A;  4FWU A;  1ZH1 A;  1QMU A;  1YJN Z;  3SI0 A;  1S7M A;  1VQ9 Z;  2V77 A;  2ARH A;  2I3C A;  4ZI6 A;  3WC7 A;  1VQP Z;  2R7H A;  3CPW Y;  3HOY I;  4TWE A;  1NSL A;  4XPL A;  3TE5 B;  3LMS A;  2JA7 I;  2FSR A;  2W03 A;  1PFT A;  2OTL 1;  2JA6 I;  3JAM b;  3VH9 A;  1BO4 A;  1BPM A;  8CPA A;  4OID A;  4NBH A;  4II9 A;  2P6E A;  3ZZI A;  5IP9 I;  2HV2 A;  2OOX B;  4AVC A;  3V38 A;  4BIN A;  1AYE A;  2P0W A;  4H89 A;  2V8G A;  4C2X A;  1YGH A;  1RQF A;  3RZA A;  5AG4 A;  2FCK A;  5IP7 I;  1HDU A;  3CZX A;  4NJR A;  3NDI A;  2OR4 A;  3KAS A;  4Y49 B;  5C82 A;  5JQ4 A;  2YAD A;  2GLJ A;  2JEV A;  2PDO A;  2AFZ A;  3RZO I;  4ONU A;  5HXD A;  4MON A;  3HLP A;  4MFZ A;  4Q7A A;  2JBJ A;  5KTC A;  3CCR Z;  4UEZ A;  4C2Z A;  4IF5 A;  1M1D A;  2ABZ A;  4E2Y A;  2PC1 A;  3LUS A;  4OAD A;  3SJE A;  4KVM E;  1YJW Z;  1VQ8 1;  2E9H A;  5IT9 b;  2EVN A;  3CXQ A;  1QQ9 A;  1N2F A;  4FAI A;  3T8W A;  1B87 A;  2PJA A;  3W91 A;  4GM5 A;  1ZLI A;  4B10 A;  5H84 A;  3TT2 A;  1NE9 A;  1UWY A;  1Q82 1;  1K83 I;  1IOI A;  1S7L A;  4KUA A;  3KHZ A;  2YNC A;  3T90 A;  2PRB A;  3BJ7 A;  1Q7Y 1;  2R92 I;  5LL6 f;  2DEA A;  7CPA A;  3CC4 1;  2JLM A;  2QRD B;  1VQL 1;  3R9G A;  4A3L I;  4UF4 A;  3FQQ A;  3BI1 A;  5AGE A;  1YJ9 1;  4OAE A;  3DLJ A;  3CXC Z;  1Z5R A;  5DWN A;  2BL1 A;  4LX9 A;  4BMH A;  1P4N A;  4B6Z A;  3H0G I;  3R95 A;  4R3L A;  3MZL B;  2WYR A;  3DDD A;  5K8O A;  1JWH C;  2JIP A;  4E31 A;  4MHZ A;  1VQ4 Z;  2ZXV A;  1NJI 2;  2PJ3 A;  3RNZ A;  1JWQ A;  3MZK B;  2BOA A;  1S7F A;  5EMI A;  2HB6 A;  2VL1 A;  3FXT A;  3GTO I;  1Y7E A;  1VHE A;  2QR1 B;  3IJ3 A;  2VUM I;  3MRU A;  1Y8C A;  4MMO A;  5T6B A;  4I49 A;  3CCJ Z;  1ELL P;  2VXK A;  1TKF A;  3D6W A;  3D9X A;  4K3N A;  1YLO A;  3IWW A;  4MI4 A;  2Z3M A;  4KZT A;  3GIU A;  3G6E Z;  1NSA A;  4U9Z A;  4YGO A;  2CNS A;  3TC8 A;  1ZG8 A;  2IZ3 A;  4EVY A;  3WC5 A;  3CCM 1;  4L89 A;  1QXF A;  2J9A A;  1CG2 A;  2IQ6 A;  1ZB8 A;  4U9Y A;  4F0Y A;  4CYO A;  5THW A;  4ZY0 A;  3CXC Y;  2OU2 A;  3VAT A;  2NMT A;  4P4F A;  3EXN A;  2XEI A;  2G2K A;  3IFE A;  3FX6 A;  3D7D A;  3RBU A;  5A2Q b;  2JEW A;  5DS0 A;  4ORF A;  3TO7 A;  1TWG I;  3TO6 A;  2JS4 A;  4MCQ A;  5JM6 A;  4RN7 A;  2RPR A;  2WPW A;  2QIR A;  5C88 A;  3IU1 A;  1LAN A;  3CCU 1;  1ZLH A;  1QF8 A;  1YW6 A;  1YVK A;  2GAN A;  4EFD A;  1I1D A;  2GIV A;  4W9Y A;  3FB3 A;  2R93 I;  3H5Z A;  4MHN A;  5AN9 F;  4X3R A;  1I50 I;  4OKO A;  3PP9 A;  1WWZ A;  1XMB A;  4R9M A;  4R76 A;  5G21 A;  1VHS A;  1KQS Y;  3PEI A;  2QA4 1;  2E2I I;  4P45 A;  5JPH A;  1Q2D A;  3GB0 A;  2REE A;  2HUZ A;  2Y0M A;  2GFQ A;  3MON A;  4NGS A;  2OZU A;  1Y1V S;  2V8K A;  2CY2 A;  2POK A;  4KSI A;  2PK7 A;  4KVX A;  4MHY A;  2QRC B;  4XNH B;  1A2Z A;  1GYT A;  3B35 A;  2PJ5 A;  4AVB A;  4OIW A;  6CPA A;  3S9N A;  2AFS A;  4UCN A;  1P0H A;  2BO9 A;  3DSB A;  1S72 1;  3I55 1;  4B5O A;  3G8W A;  4ZX9 A;  2G3T A;  4B12 A;  4KOR A;  3S9L A;  1RTQ A;  2KI7 B;  2Q4V A;  5F09 A;  3CXP A;  5DWM A;  3SJF A;  4RI1 A;  3WR7 A;  1RNI A;  1EE3 P;  1VQN 1;  3GKQ A;  1K9M 2;  1X3Z A;  3CCV Z;  2VZZ A;  4S1T A;  2F7V A;  2V8D A;  1IOF A;  4OC3 A;  3F3P C;  4NBC A;  4E2Z A;  3L2N A;  5LRG A;  3D3S A;  3K9T A;  1NJI 1;  2G3A A;  2FT0 A;  4L8A A;  2R8V A;  1YIT Z;  2ZW5 A;  3NH4 A;  3CD6 1;  3CCS Z;  1LFW A;  3S9M A;  3RYO A;  4P10 A;  2Q4Y A;  3D2M A;  1N8R 2;  3HOZ I;  1XEB A;  1M1K 2;  4R8F A;  1IYL A;  3GLJ A;  4XPK A;  1QYP A;  4NSQ A;  1VQO 1;  3KR4 A;  4UEE A;  1Z03 A;  3PZJ A;  4DUK A;  1IGB A;  2Q0Y A;  1XFO A;  3I56 1;  2VEZ A;  2PIY A;  2ZEG A;  1KD1 2;  1KC8 2;  1SQH A;  3EC4 A;  3IWE A;  1Z4R A;  1GHE A;  4NBD A;  4PK2 A;  5EC4 A;  2CIJ A;  1S5K A;  3GTM S;  2A4N A;  4HNW B;  3J81 f;  3QB8 A;  1LCP A;  5I4M A;  4H2K A;  1WII A;  1Q2Y A;  3GTQ I;  1Q82 2;  3CMA Z;  1TKH A;  2BCO A;  2ZAE B;  4C7I A;  3S2D I;  2DE7 A;  5C4J I;  4XPD B;  3MN8 A;  2PRQ A;  3CCE Z;  3G71 Z;  2HC9 A;  2Q43 A;  2ZEO A;  4NBA A;  1CBX A;  4MRI A;  4F0X A;  3GYA A;  3CC2 1;  2PJ1 A;  3KZW A;  1ON0 A;  2Q4Z A;  3PB8 X;  4UFW A;  4FBE A;  2JIQ A;  1VLA A;  4P4D A;  2K3R A;  2QEX 1;  2JDC A;  3S1N I;  1XIX A;  3CME Z;  1Y0Y A;  4NGN A;  5JH9 A;  4A95 A;  2K5R A;  4MFK A;  2I79 A;  2EGT A;  4P6Y A;  3G4S Z;  2Z3P A;  4EWC A;  1VQ9 1;  4DYO A;  3DGV A;  2PJB A;  3D7H A;  1VQP 1;  4UWI A;  3KL9 A;  3TOA A;  3R96 A;  5FLX b;  4A3B I;  2CTC A;  2WB1 A;  5LRK A;  4OC4 A;  3D7G A;  3JVN A;  4E30 A;  1TF8 A;  3BI0 A;  3R9F A;  5T67 A;  3CXS A;  3PO3 S;  2RIQ A;  1ARM A;  2WPX A;  1HDQ A;  4UIA A;  5FLX f;  1Q86 2;  3FNC A;  4YWY A;  2HU9 A; 
#chains in the Genus database with same CATH homology
 1K9M 1;  3J80 b;  2JA5 I;  2PE3 A;  4DJL A;  4OC0 A;  1VQK 1;  5LYF A;  1VQ5 Z;  1R43 A;  2IMO A;  2PJ9 A;  4QTU A;  3CCU Z;  4EME A;  3CMA 1;  3V7Z A;  4A3C I;  4PXC A;  2QRE B;  4MCP A;  4FUU A;  4B6Z A;  4NB8 A;  3H0G I;  1AMP A;  3S15 I;  3MZL B;  5T64 A;  2WYR A;  1X0T A;  3KIF A;  2O53 A;  2M48 A;  5K8O A;  2PJC A;  1JWH C;  2PJ0 A;  2PMZ A;  3CCE 1;  1CX8 A;  2F4O A;  1R9T I;  4E31 A;  4MHZ A;  1VQ4 Z;  3G71 1;  1NJI 2;  2PJ3 A;  4A3M I;  3LWU A;  3MZK B;  2EK9 A;  2V8J A;  2BOA A;  3GTP I;  2V8H A;  1NUI A;  2HB6 A;  4RS4 A;  3FKI I;  2ZOG A;  1F57 A;  2VL1 A;  3GTO I;  1Y7E A;  1BAV A;  3JAM f;  1Z02 A;  1VHE A;  2QR1 B;  4F9U A;  3Q87 A;  1Q81 2;  2ZEM A;  2JNY A;  2VUM I;  3IJ3 A;  3MRU A;  4A3I I;  3S16 I;  4MMO A;  5T6B A;  3GUX A;  3CCJ Z;  1ELL P;  2WZN A;  3EED A;  2P28 A;  2JMO A;  3I56 Z;  1TKJ A;  1TXR A;  4HH4 A;  2G9D A;  1TKF A;  3CME 1;  3D6W A;  2ANP A;  3D9X A;  1N8R 1;  4K3N A;  3S14 I;  3EER A;  3U50 C;  1M1K 1;  1YLO A;  1USP A;  3IWW A;  5C3E I;  1K73 2;  4WWV A;  5JGF A;  2EK8 A;  4BD9 A;  4A3K I;  2H85 A;  5CPA A;  2VUG A;  3D7F A;  3BG0 B;  3G6E Z;  2ZEP A;  2PJ4 A;  1NSA A;  1P9N A;  2ZEL A;  1TWH I;  1YJW 1;  1TFI A;  1WW9 A;  2IZ4 A;  3CCQ Z;  3VMH A;  3KIH A;  4Y7N I;  1I6H I;  2R7Z I;  3KGQ A;  2B63 I;  3TC8 A;  1VQM Z;  3S1R I;  3G4S 1;  1ZG8 A;  4P4E A;  1RO4 A;  2QVP A;  3FF3 A;  2IZ3 A;  4BBS I;  3SI1 A;  3WC5 A;  3PB7 X;  4BY1 I;  3GTL I;  3CCM 1;  1SFO I;  3WC6 A;  3CCL Z;  4NJQ A;  3PB9 X;  2J9A A;  1CG2 A;  2IQ6 A;  1CP6 A;  4QTT A;  4RVG A;  2AFM A;  5HVG A;  2R6M A;  1S72 Z;  1KC8 1;  1KD1 1;  1ZB8 A;  4Y52 I;  2KPI A;  3I55 Z;  4E2W A;  4AYB A;  3D68 A;  2NYQ A;  5THW A;  1M90 1;  5FLM I;  1PYT B;  4WJB A;  1QVG Y;  4ZY0 A;  3CXC Y;  2V8V A;  4NGT A;  3VAT A;  2O4H A;  4P4F A;  4RVF A;  4ZYQ A;  3IIB A;  1YJN 1;  1VQ6 Z;  1JQG A;  2J6A A;  2XEI A;  2G2K A;  4DQY B;  1W2B Z;  3IFE A;  3FX6 A;  4BBR I;  3TX8 A;  3KQZ A;  3D7D A;  4HGZ A;  3RBU A;  3I4M I;  5A2Q b;  4YU9 A;  2WAQ A;  4ONW A;  2JEW A;  5DS0 A;  4F8Z A;  4MH4 A;  1YI2 Z;  4A3J I;  5LYL A;  1TWG I;  3VB9 A;  3BG1 B;  2JS4 A;  3H3V J;  4MCQ A;  1Y1V I;  5JM6 A;  5IT9 f;  3M4O I;  2RPR A;  2V8I A;  3VMI A;  2OTJ 1;  4MHP A;  2QEX Z;  1Z01 A;  4A3D I;  1LAN A;  3CCU 1;  1ZLH A;  1QF8 A;  3QNV A;  4NBG A;  1YW6 A;  3M3Y I;  2QYV A;  5K8N A;  4JZ0 A;  3TDH B;  2PJ8 A;  4EFD A;  2JA8 I;  4W9Y A;  5ELY A;  1Y1W I;  5CBM A;  2R93 I;  3S17 I;  1FNO A;  1BPN A;  4BXX I;  1YHQ Z;  2AFX A;  4Z65 A;  1QVG Z;  4MHN A;  4IK2 A;  5AN9 F;  4X3R A;  2DE5 A;  1I50 I;  2W04 A;  4OKO A;  2ZED A;  2F4M A;  1DTD A;  1VQ4 1;  2ZEH A;  3OW2 Z;  1FT7 A;  3CD6 Z;  2OOY B;  3HKZ A;  3P5J B;  1XMB A;  4IHM A;  3PB6 X;  3CPA A;  4R76 A;  3WAB A;  3B3C A;  3H8G A;  1KQS Y;  1JJ2 Z;  3PB4 X;  3CCJ 1;  2GLF A;  2QA4 1;  2E2I I;  3PEI A;  4P45 A;  4OC2 A;  3SJG A;  3J81 b;  4MXU A;  3CC7 Z;  4RVD A;  3HOU I;  1X3W A;  3NDJ A;  3ISX A;  3GB0 A;  2GTH A;  2OOT A;  3QWU A;  4F9V A;  3I07 A;  3J80 f;  1WCM I;  1RO2 A;  4NBB A;  3CQZ I;  2ZOF A;  3MON A;  1VQO Z;  3G6E 1;  1F2P A;  4NGS A;  1Y1V S;  2V8K A;  1VQ7 1;  3PFO A;  4CL1 A;  4UEF A;  5D1O B;  2PJ2 A;  2POK A;  4KSI A;  3IO1 A;  4A93 I;  2PK7 A;  2RT9 A;  1VQL Z;  2E2H I;  3PBB A;  2QRC B;  2Q51 A;  4MHY A;  4DGL A;  3CCQ 1;  2LIY A;  1GYT A;  3B35 A;  1TWF I;  2PJ5 A;  4OME A;  3PFE A;  2NVX I;  3B3T A;  1VQM 1;  1YME A;  5CM2 M;  4CPA A;  1KRL A;  4NGP A;  3T4N B;  4OIW A;  1H8L A;  6CPA A;  1RLY A;  4RUH A;  3HOV I;  3S9N A;  2AFS A;  3CCR 1;  1W2B Y;  4NGR A;  1ELM P;  1VQK Z;  3SI2 A;  1K8A 1;  2PJ6 A;  1ML8 A;  3CCL 1;  2BO9 A;  2YU9 I;  2OTL Z;  2JBK A;  3B3S A;  4A3F I;  4NBF A;  3WT4 A;  4OP4 A;  1S72 1;  3IF8 A;  3I55 1;  1KQS Z;  3CPX A;  3ISZ A;  1HEE A;  2DE6 A;  1Q7Y 2;  3K2K A;  4ZX9 A;  3CPW Z;  3GCF A;  5C44 I;  1BLL E;  3D4U A;  1VQ6 1;  3S9L A;  1RTQ A;  3SJX A;  3CDX A;  2KI7 B;  1ZG7 A;  1TWC I;  4HGY A;  1VIX A;  4A94 A;  1RO0 A;  3F3F C;  4PXE A;  5F09 A;  1Q86 1;  4ZY1 A;  3IFU A;  4IAV A;  3SJF A;  2C6P A;  3B7I A;  1RNI A;  1EE3 P;  2GTI A;  1YI2 1;  1VQN 1;  4OC1 A;  3GKQ A;  4E33 A;  1K9M 2;  4P4I A;  1NP6 A;  1X3Z A;  2GRE A;  3CCV Z;  4MCS A;  4JYW A;  4PXB A;  4S1T A;  4ZX8 A;  5D8N A;  3OW2 Y;  2F7V A;  2E2J I;  2V8D A;  1XRY A;  4MD8 A;  4OC3 A;  3S1Q I;  3BHX A;  4A3G I;  4R6T A;  3F3P C;  3NH5 A;  4NBC A;  2AFO A;  1VHO A;  4E2Z A;  4NOZ A;  3L2N A;  5LRG A;  4BY7 I;  2CTB A;  4MCR A;  3I4N I;  4RV9 A;  5IB9 A;  2QJ8 A;  3K9T A;  1NJI 1;  3GTK I;  1JJ2 Y;  4R7M A;  1YHQ 1;  3BXM A;  4O23 A;  5D29 A;  4LQG A;  2LFU A;  3CC2 Z;  2OZK A;  4A3E I;  3N5F A;  1Y0R A;  2NVT I;  1YIT Z;  2ZEE A;  3FH4 A;  1Q81 1;  3NH4 A;  4NB9 A;  3VMG A;  3CCS Z;  3CD6 1;  1LFW A;  1YW4 A;  1VQ5 1;  2PM9 A;  3GTM I;  3S9M A;  3IEH A;  5LRJ A;  1L1O C;  4X2T A;  2CF4 A;  1YIJ Z;  3NH8 A;  5A2Q f;  2ZEF A;  4P10 A;  2Y0S A;  2EWB A;  1YSJ A;  4NBE A;  5D1P A;  3FED A;  4MD7 A;  3CT9 A;  4AXV A;  3KHX A;  4PQA A;  1QVF Y;  2XEF A;  2AFU A;  1N8R 2;  3HOZ I;  1DE4 C;  2PIZ A;  5LYD A;  1VQ8 Z;  1M1K 2;  4RVH A;  3CC7 1;  1K73 1;  4MD9 A;  2PVV A;  4P44 A;  1VGY A;  4R8F A;  2JR6 A;  4FWU A;  1ZH1 A;  5K8M A;  1XBU A;  3GLJ A;  1QMU A;  1YJN Z;  3FJU A;  3SI0 A;  1S7M A;  1QYP A;  3PBE A;  1VQ9 Z;  2V77 A;  1CP7 A;  1VQO 1;  3KR4 A;  4UEE A;  2I3C A;  1PCA A;  4ZI6 A;  1Z03 A;  1YUA A;  4DUK A;  1TF9 A;  2GU2 A;  1IGB A;  3WC7 A;  1VQP Z;  3B3W A;  1CPX A;  3FEE A;  1Z2L A;  1XFO A;  4A39 A;  3CPW Y;  3I56 1;  3B2Y A;  3S2H I;  3HOY I;  1LAM A;  4X8I A;  2PIY A;  4TWE A;  2PJ7 A;  2C6C A;  3HUV A;  3TE5 B;  3KI9 A;  2P3Y A;  2ZEG A;  1KD1 2;  1KC8 2;  2OTJ Z;  3LMS A;  3KR5 A;  2JA7 I;  2RB7 A;  3PRT A;  2W03 A;  1M90 2;  2XEJ A;  1PFT A;  2OTL 1;  2JA6 I;  2HF1 A;  3JAM b;  1TWA I;  3HOW I;  3CC4 Z;  3VH9 A;  1BPM A;  4NBD A;  4OID A;  8CPA A;  4NBH A;  1QVF Z;  2CIJ A;  1ARL A;  2IJZ A;  3ESW A;  4E32 A;  5HVH A;  3GTM S;  1YJ9 Z;  4A37 A;  5IP9 I;  1USP B;  1OBR A;  3J81 f;  3K7A I;  1LCP A;  2OOX B;  4PXD A;  5I4M A;  3JRU A;  4H2K A;  1WII A;  2RFH A;  3V38 A;  3GTQ I;  1AYE A;  1Q82 2;  2V8G A;  4TNU A;  3H8F A;  3CMA Z;  1F2O A;  1TKH A;  2PCU A;  4NH1 C;  1RQF A;  3RZA A;  5J1Q A;  2BCO A;  3CCV 1;  2ZAE B;  4PPZ A;  3D67 A;  5IP7 I;  1HDU A;  2C6G A;  3S2D I;  3RAM A;  2DE7 A;  2AFW A;  2QA4 Z;  4NJR A;  2AKL A;  3NDI A;  2OR4 A;  4NFR A;  3KAS A;  5D1O A;  2QKD A;  5C4J I;  3MN8 A;  2PRQ A;  4UIB A;  4E2X A;  3CCE Z;  5C4X I;  4NGM A;  1DL6 A;  4G1P A;  3G71 Z;  2XEG A;  2YAD A;  2GLJ A;  2HC9 A;  3FMC A;  2Q43 A;  3HOX I;  2AFZ A;  3RZO I;  1VQ7 Z;  2RHB A;  2ZEO A;  5HXD A;  4NBA A;  3FEC A;  4MON A;  1CBX A;  4MRI A;  4DK1 A;  3H8E A;  3HLP A;  4Q7A A;  1LOK A;  3CC2 1;  3PO3 I;  2PJ1 A;  2FVG A;  2VF1 A;  4EWT A;  3KZW A;  3PB8 X;  2Q4Z A;  1YIT 1;  4FBE A;  1M4L A;  3IX0 A;  1VLA A;  4P4D A;  3PO2 I;  2K3R A;  3CCS 1;  2JBJ A;  3J7A 4;  2QEX 1;  4P4B A;  3FVL A;  3S1N I;  2BJO A;  2NSM A;  3CME Z;  1Y0Y A;  1I3Q I;  3CCR Z;  2M6N A;  3KQX A;  4NGN A;  5K8P A;  4UEZ A;  5JH9 A;  2JUB A;  3D66 A;  2ABZ A;  1YIJ 1;  2C1C A;  2NVQ I;  4E2Y A;  2K5R A;  3LUS A;  3SJE A;  1YJW Z;  1VQ8 1;  3NFZ A;  1Z8L A;  2QLV B;  2F8H A;  3B3V A;  2E9H A;  5IT9 b;  1R3N A;  2PVW A;  3I1U A;  1QQ9 A;  1KWM A;  1N2F A;  2EGT A;  4P6Y A;  3RZD I;  4FAI A;  2NVY I;  3G4S Z;  3T8W A;  4EWC A;  1VQ9 1;  1CPS A;  4DYO A;  2PJA A;  3DGV A;  1YUK A;  4GM5 A;  2PJB A;  1ZLI A;  3CCM Z;  4OC5 A;  4NGQ A;  3GTJ I;  1ZG9 A;  3D7H A;  1VQP 1;  1VQN Z;  3GTG I;  3KL9 A;  1UWY A;  1Q82 1;  1K83 I;  1Q7L A;  5FLX b;  4A3B I;  2CTC A;  1LQL A;  2WB1 A;  1K8A 2;  4OC4 A;  3D7G A;  3KHZ A;  5LRK A;  3FQM A;  3S1M I;  5LYI A;  4E30 A;  1ZB9 A;  1TF8 A;  4XX2 A;  3BI0 A;  2ZEN A;  1Q7Y 1;  5T67 A;  1XJO A;  4ZY2 A;  3VAR A;  3NA6 A;  2RBL A;  2R92 I;  5LL6 f;  2DEA A;  7CPA A;  3CC4 1;  3PO3 S;  4A38 A;  2QRD B;  4P4J A;  2RIQ A;  1ARM A;  1VQL 1;  4A3L I;  4UF4 A;  3IC1 A;  3FQQ A;  3BI1 A;  1YJ9 1;  1HDQ A;  3DLJ A;  3CXC Z;  4UIA A;  1Z5R A;  5FLX f;  1Q86 2;  1LAP A;  1IY7 A;  5HVF A;  3VTN A;  4YWY A;  4X6A I;  2HU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...