4MXUA

Human brain aspartoacylase mutant k213e complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGEEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 95
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mxuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mxuA01
2PJAA 2JBJA 2F8HA 3RBUA 1YW4A 3PEIA 2WYRA 4P4JA 3SI2A 4TNUA 3WC6A 3KHXA 3FEDA 3LWUA 1LAPA 1HDUA 1PCAA 3D68A 4MXUA 1Z8LA 2ANPA 1ZLHA 1ELLP 4JYWA 3KHZA 5K8NA 3LMSA 2PJBA 2PVVA 3B3VA 3PRTA 3PB8X 2O4HA 3BI1A 3D4UA 8CPAA 2IMOA 2AFWA 4PXEA 1VGYA 5LYIA 5J1QA 3NFZA 5D29A 2JBKA 1Y0RA 1VHOA 4MRIA 1Z5RA 2PJ7A 4IAVA 1CBXA 5K8PA 2BOAA 4TWEA 5IB9A 4R76A 2ZENA 1XMBA 2V8VA 4F9UA 3B3TA 3GB0A 4EWTA 3IIBA 3D7GA 3D7HA 3B7IA 3FECA 2HC9A 3S9LA 4NGNA 1JQGA 4FBEA 3PFOA 1VIXA 2ZEGA 2G9DA 3DLJA 3I1UA 1H8LA 2ABZA 1FT7A 3KL9A 1M4LA 3KASA 1F2OA 1YW6A 1KWMA 2CTBA 1BAVA 2PJ6A 5F09A 1XBUA 1XJOA 3B3SA 5THWA 1QMUA 4A37A 2Q4ZA 3PB6X 4UIBA 4OIWA 4MHPA 1R3NA 2C1CA 3S9NA 3TC8A 4PPZA 4IHMA 3B3WA 4NGTA 4P4EA 5HXDA 1TF8A 2GU2A 1BPMA 2J9AA 2PJ0A 2QJ8A 3RZAA 3IC1A 3FH4A 1F57A 2Q51A 3NH8A 2EK9A 4R8FA 1Z2LA 2RFHA 4ZX9A 4X2TA 4P45A 4P4DA 5DS0A 4OC2A 4FAIA 3L2NA 4YU9A 1PYTB 3ISZA 2NYQA 3FF3A 3BHXA 3FVLA 4KSIA 4OIDA 4K3NA 4FWUA 2V8DA 5JGFA 4MMOA 5LYFA 2ZEMA 3PFEA 1BPNA 5I4MA 2ZELA 4ONWA 4EFDA 3WABA 2VL1A 3H8GA 4GM5A 3KGQA 4X8IA 1ZLIA 2C6GA 3KZWA 4YWYA 2BO9A 5LYLA 4JZ0A 3IEHA 2WZNA 4NGPA 2PE3A 1XFOA 2XEGA 2XEFA 5LRGA 2GLJA 2ZOGA 4WWVA 2PJ5A 6CPAA 2NSMA 1F2PA 4F8ZA 1TKJA 2CF4A 4RUHA 3GLJA 4W9YA 4P10A 2V8HA 3S9MA 1XRYA 3N5FA 4OC0A 3BI0A 2PJ3A 5HVHA 3QNVA 1TKFA 4NFRA 3T8WA 2O53A 4MHNA 3WC7A 2OOTA 5K8MA 1ZG8A 1ZG9A 4OC3A 4UF4A 3IWWA 5D8NA 4OMEA 4ZY1A 3NH5A 5ELYA 4A38A 3VH9A 3KQZA 4NGSA 4NJRA 3D7FA 4P4IA 3JRUA 2AFZA 4Z65A 5K8OA 3K9TA 2HB6A 3CPAA 2DEAA 4ZY0A 3SJFA 3D7DA 2Q43A 4R7MA 4MCSA 1Y0YA 1DE4C 4P44A 3CPXA 3SJGA 3B2YA 3BXMA 4OC1A 2ZEFA 4OP4A 2IQ6A 2QVPA 2BCOA 4A39A 5JH9A 4P4FA 3IFEA 2IJZA 3SJEA 4PXBA 3IJ3A 4OC4A 1RTQA 3MRUA 3PBEA 4H2KA 3D66A 3SJXA 1CPXA 5LRJA 1DTDA 3ISXA 1ZG7A 2JEWA 2AFXA 5CPAA 1LANA 3B35A 1VHEA 2PJ8A 3FMCA 4OKOA 1CPSA 3KI9A 1BLLE 1Y7EA 3KR4A 3H8FA 4DYOA 2ZEPA 1UWYA 1LCPA 3B3CA 4R6TA 4MCQA 4ZI6A 4DJLA 2EWBA 1IGBA 1TXRA 4CPAA 1CX8A 1TF9A 2V77A 3KR5A 2ZEDA 3WT4A 1EE3P 4PQAA 3HLPA 2XEIA 4FUUA 3GUXA 1YSJA 3KQXA 4AXVA 3SI0A 2V8GA 4NGRA 2C6PA 2ZEHA 4EMEA 4NJQA 3V7ZA 3D67A 3K2KA 4PXDA 3WC5A 5CBMA 1HDQA 4G1PA 1ARLA 2OR4A 4X3RA 2GREA 5JM6A 2XEJA 3H8EA 3HUVA 3PBBA 2PJCA 4A94A 1R43A 1LOKA 3PB9X 4LQGA 2ZOFA 2PVWA 3RAMA 2PIZA 5HVFA 4DUKA 3DGVA 3VARA 1CP6A 4WJBA 1LFWA 1ELMP 2FVGA 4ZYQA 2C6CA 2PIYA 4O23A 3MN8A 2PJ4A 2AFMA 3SI1A 4ZY2A 2EK8A 3FX6A 2AFOA 5LRKA 1LAMA 1OBRA 4PXCA 3PB7X 1CP7A 4BD9A 2CTCA 2ZEOA 1YLOA 4IK2A 4OC5A 1ARMA 3CT9A 1Q7LA 3FEEA 4MCRA 1CG2A 2ZEEA 5LYDA 2AFSA 2PCUA 4UIAA 4B6ZA 3CDXA 2GLFA 1TKHA 2RB7A 4UEFA 7CPAA 2AFUA 2F7VA 1AMPA 3TX8A 3PB4X 1YMEA 3NH4A 2PRQA 1GYTA 1IY7A 3VATA 4F9VA 5HVGA 3NA6A 1QQ9A 4P6YA 4UEZA 2PJ1A 4NGMA 2CIJA 4ZX8A 3FJUA 1NSAA 3V38A 4MCPA 2PJ9A 4UEEA 4NGQA 3IO1A 1FNOA 1HEEA 4MHYA 2POKA 2PJ2A 4P4BA 1AYEA 4MHZA 2QYVA 4Q7AA 2I3CA
chains in the Genus database with same CATH superfamily
3RBUA 2ZXVA 5G22A 4P4JA 3P5JB 4E2YA 2YGWA 4QUSA 3CCJ1 4E2WA 2QKDA 3DR6A 2PK7A 1AUGA 2ANPA 3KHZA 4NB9A 2PJBA 1QSMA 2PVVA 3B3VA 3BJ8A 1QSTA 4E31A 5C4XI 4PXEA 3G711 4KOTA 1YQEA 3N7ZA 4NBGA 4A3EI 2Z0ZA 3BG1B 3NFZA 3Q87A 3I4NI 4E2XA 5IT9f 2JMOA 1VHOA 3G4S1 4MRIA 3UY5A 1LQLA 4A2ZA 2F4MA 3J80f 2RHBA 4R76A 2ZENA 1YVOA 2JA7I 3S15I 3IIBA 4HKFA 4CAEA 1M4GA 3D7HA 4QC6A 1BOBA 1MK4A 4PK3A 3S9LA 1Z9UA 1XIXA 2P28A 2R1IA 3TO9A 2R7HA 3KL9A 2B3VA 3I561 4RV9A 3TFYA 2PMZA 2PSWA 3NDJA 1VQO1 1XJOA 3C26A 5THWA 2M6NA 3EXNA 3G6EZ 2VXKA 5KTAA 1Z8XA 2F4OA 3LACA 3FKII 4AYBA 5A28A 1Q7Y1 1NUIA 3S9NA 1P0HA 4IHMA 2VZZA 1I3QI 4CYQA 4BY7I 5F47A 3IC1A 2V3VA 1F57A 2Q51A 1Q2CA 1VQ7Z 3NH8A 3F5BA 2R92I 4GS4A 4BBHA 4X6AI 4HPSA 3M3YI 2EVNA 4CYNA 4ZX9A 4X2TA 4P45A 4P4DA 1I21A 4FAIA 3FF3A 3BHXA 3FVLA 5C4JI 4KSIA 1K8A1 4OIDA 3KKWA 4E0AA 2Z3PA 2HUZA 3PO2I 5JGFA 1Q821 2OOXB 1BPNA 4EFDA 2J6AA 3MZLB 3WABA 4KVME 3DNSA 4X8IA 4H89A 1RO0A 3KZWA 2ZPAA 2Z3NA 4II9A 3W91A 1UFHA 1KQSY 1Q861 3F3PC 2GLJA 2HV2A 2AYDA 1B6BA 3CCUZ 1QVFZ 1RO2A 4ONUA 1MJ9A 4M6GA 3M4OI 4RVGA 4W9YA 3I4MI 2FIWA 2YNCC 2P3YA 3S9MA 1XRYA 2JNYA 4MFJA 3QNVA 1TKFA 3FYNA 4NFRA 1S7KA 2O53A 1X0TA 3H5ZA 4JJXA 3CCU1 1ZG8A 2JUBA 2Z3OA 4KLWA 1M1K2 4UF4A 4CGOA 2CXAA 3NH5A 1CJWA 4QTUA 3CC2Z 3H3VJ 4NGSA 3GTPI 4A32A 3GY9A 2PDOA 2AFZA 5K8OA 3K9TA 1A2ZA 2X7BA 3QB8A 3CCM1 4HH4A 2OB0A 4R7MA 4MCSA 1XF8A 5ISVA 3CPXA 1KD11 3IU2A 3GTJI 3R9FA 3CD6Z 5EBVA 2C27A 3IWGA 5G20A 4P4FA 4UCMA 2IJZA 3SJEA 4PXBA 4JXRA 3CXQA 4OC4A 2ZW7A 3PBEA 1KUYA 4OLLA 5A2Qf 1XEBA 1CPXA 4KOUA 3ISXA 2JEWA 2AFXA 5CPAA 1LANA 2PJ8A 1CPSA 1Q16A 4C2ZA 1I6HI 1BLLE 1Y7EA 3DDDA 4DYOA 3HOUI 2ZEPA 5H84A 2Q4VA 3JAMb 4ZI6A 4FD6A 2VPXA 3CCQZ 1TXRA 3CZXA 2FE7A 4CRZB 2BL1A 5AN9F 2JDCA 2PR8A 3WT4A 1EE3P 1Y1VI 3EFAA 3GUXA 4BBRI 1WZNA 2C6PA 5IP9I 4CRYB 1TWCI 3D67A 2V8IA 4PXDA 5J8CA 4OADA 4X5KA 1Z03A 2GREA 2QIRA 1YGHA 2CNSA 5I0CA 3MGDA 2FT0A 4A94A 3HKZA 2VPWA 2PVWA 1JJ2Y 4CGPA 4F0YA 3D2LA 2Z3LA 4WJBA 3I551 4ZYQA 1YJWZ 4MJ8A 2ARHA 1Y7RA 3S2HI 3SI1A 1VQ41 4CGNA 5LRKA 1LAMA 2DE6A 3S1RI 3PB7X 1K8A2 1NE9A 4QB9A 5CM2M 2Z11A 3PO3I 1USPA 1YLOA 2JLMA 4OC5A 1P9NA 3FEEA 4MCRA 2P6FA 4HGZA 4B11A 5T6BA 3RZDI 4UIAA 2V8KA 3CC7Z 2K5RA 2H85A 1TKHA 2OU2A 4NCZA 7CPAA 1YHQ1 1AMPA 2F7VA 1PFTA 1VQOZ 4NXYA 1GYTA 4B5PB 3VATA 1M4IA 4UWJA 4ZX8A 2QRDB 2EUIA 2PJ9A 4UEEA 2HQYA 3IO1A 1FNOA 3IWEA 2QYVA 5IT9b 4Q7AA 2JBJA 3S6KA 2F8HA 2JA6I 3CCS1 1VQ51 1VQL1 2I00A 3WC6A 1VKCA 2Q44A 3R95A 4RVFA 4MY3A 4MXUA 2P0WA 3P2FA 4NBEA 3BG0B 4JYWA 3S16I 4BMHA 2W04A 2YNEA 3VWEA 2O4HA 3MONA 3S17I 3BI1A 2ODFA 2LEXA 3HOZI 1VGYA 4KZTA 5J1QA 2OTLZ 2OZUA 1V0CA 3OW2Y 4B12A 2G3AA 1Z5RA 2PJ7A 1B87A 1CBXA 2Z3MA 3GTOI 5IB9A 4FD5A 2DE7A 3HOXI 2V8VA 2PRBA 3B3TA 4KS9A 3D7GA 2EO8A 4FBEA 3PFOA 1VIXA 1IB1E 2EBJA 2ZEGA 1YJW1 3DLJA 3I1UA 4A3GI 5G21A 1GHEA 3TTHA 2JIMA 4CAFA 3CXPA 1YW6A 4C2YA 4RS4A 3EC4A 5FVJA 4KOXA 1YIJ1 2WAQA 4IUSA 2Q4ZA 3I55Z 3PB6X 3SHPA 1ZB8A 4MHPA 2QR1B 3TT2A 1R3NA 4MFQA 4Y7NI 3TC8A 1NP6A 1TWHI 2DPTA 4NGTA 3HOYI 3CCR1 2GU2A 1BPMA 2QJ8A 3CD61 3RZAA 3LD2A 1S721 4MFPA 2VPZA 3D2PA 4K30A 2R98A 2NVQI 2YNDA 5JPHA 5JQ4A 4MFKA 4KOWA 3D9XA 3HOVI 3V8IA 2P6GA 2K5TA 4PSXA 4EWCA 1YJNZ 4OC2A 3L2NA 2JA5I 4F6AA 2NYQA 2WPWA 2M48A 2QEX1 3F8KA 4FWUA 1VQN1 1IOFA 2ZEMA 2E2JI 3PFEA 2DF5A 4ONWA 4XNHB 2VL1A 3PGPA 4C7IA 1ZLIA 3CXCZ 2C6GA 1KUVA 2BO9A 1K9M2 4JZ0A 4UFXA 2PE3A 4NOZA 1XFOA 2Q7BA 1XOVA 2XEFA 1Q862 4WWVA 1VQPZ 6CPAA 2NSMA 2Q0YA 4F8ZA 4RUHA 1ML8A 2B58A 4LUAA 2PJ3A 3SXOA 5C3EI 4A3II 3CCEZ 4H6ZA 2P6EA 2BUEA 3JVNA 2VF1A 1Z8WA 4OC3A 4DGLA 1S3ZA 5H86A 2ZW4A 4M6HA 5D8NA 4PSWA 2JIQA 4NJRA 3D7FA 4P4IA 1KUXA 3JRUA 4CYOA 4UWIA 4ZY0A 3I07A 3SJFA 2Q43A 4P44A 1DE4C 4I49A 1K9M1 2ZEFA 2V45A 4OP4A 2QECA 4R57A 4E30A 4AVCA 1L0CA 3T4NB 3IJ3A 1VQ91 4MD7A 3MRUA 1RLYA 2IZ4A 4H2KA 3GTMS 1FDOA 2YNCA 3D66A 3CQZI 2H5MA 1IOIA 1QVFY 3FMCA 4A95A 4HGYA 3GIUA 3H8FA 4E2ZA 2GIVA 2HU9A 3R9EA 5AGEA 2NVTI 3B3CA 3CCRZ 4C2XA 2F5IA 3CCV1 4CPAA 4GXHA 5T64A 1S72Z 2PQ8A 3KR5A 2ZEDA 2NAPA 3CMA1 3JTKA 4E33A 3FIXA 2XEIA 3H4QA 3ZZIA 3SI0A 3FXTA 1YJ91 4NGRA 4UBRA 4EVYA 4ZBGA 1OZPA 3WC5A 3CCQ1 4XX2A 1I50I 1JWQA 2YADA 4X3RA 3LUSA 3R1KA 4Q36A 3TE4A 2K3RA 1VQ4Z 3F3FC 1R43A 2R6MA 4MFLA 2KI7B 2ZOFA 2PIZA 4AG7A 4DUKA 2FXFA 1TWAI 3DGVA 1VQKZ 1DL6A 3FRMA 2B5GB 2LIYA 5LL6f 2FVGA 2PIYA 4O23A 3TE5B 2BJOA 3RO0A 1PU9A 2PM9A 4J3GA 4MBUA 4A30A 3CCVZ 3S6FA 2Y0MA 1YJ9Z 1W2BZ 4A3BI 4M6IA 3VMHA 1CP7A 4HNYB 3IX0A 2Q04A 3FQQA 4BD9A 2OTL1 4IK2A 1WK4A 1ARMA 3CT9A 2W03A 1Q7LA 1WIIA 1CG2A 3D3SA 5LYDA 3GTKI 4E2AA 2RPRA 4JD6A 4B6ZA 3CDXA 2KCWA 4NBCA 2B4BA 2JDDA 4R87A 4A3DI 2R8VA 3TX8A 4DQYB 1M1K1 1YX0A 1KC82 2WPXA 4OAEA 1IY7A 3LODA 1VQM1 5HVGA 3DSBA 4JXQA 4UEZA 4BINA 5D1PA 2CIJA 2JIOA 2QEXZ 1NSAA 2FL4A 2CNTA 3V38A 4NGQA 5J8FA 4UFWA 2PJ2A 1YREA 1CM0A 3KIFA 2OTJZ 3SXNA 4NBAA 1YW4A 3PEIA 3CMEZ 3T9YA 3SI2A 2J8NA 4RVHA 3KHXA 3LWUA 1HDUA 4M85A 1M4DA 1Z8LA 1VQ8Z 2REFA 1ELLP 2LFUA 4QTTA 4C68A 1K83I 3PRTA 3PB8X 3NDIA 2OZHA 3S1MI 3D4UA 8CPAA 5EC4A 2IMOA 1R9TI 4CAXA 1R57A 5LYIA 1YVKA 2RBLA 4B14A 4MD9A 5HH1A 1Y0RA 5FLXb 4MD8A 3FNCA 1ZB9A 4KOSA 5KTCA 4C7HA 1VQK1 5KTDA 2BOAA 2FS5A 4TWEA 5C88A 4A3LI 4KVOE 2VI7A 1RO4A 4F9UA 4EWTA 1YIT1 1TIQA 4KSFA 3GYAA 3B7IA 2HC9A 3HOWI 1K731 2G0BA 2G9DA 2REEA 4KSAA 3KASA 2IL4A 1KWMA 1BAVA 5F09A 1XBUA 3B3SA 4UCPA 2QA41 1Y1WI 5G1ZA 5IX3A 1WW9A 4KORA 1MJBA 4UIBA 4QVTA 4MHDA 5AG6A 1Z01A 3ESWA 5DWNA 3B3WA 5DWMA 3QWUA 4U5YA 4P4EA 1TF8A 2B3UA 2J9AA 2PJ0A 3BLNA 2G3TA 1Q812 1VQMZ 4FD4A 4IF5A 2EK9A 1L1OC 3J81b 1Z2LA 3VMIA 1KZFA 1QSOA 4R9MA 2VUGA 1YI21 5DS0A 4A3FI 1VQ5Z 1WWZA 3ISZA 4MONA 4Y49B 3ZJ0A 2NVXI 2V8DA 3CCJZ 5LYFA 1JJ2Z 4RVDA 4CS0B 1X12A 5I4MA 4YGOA 2ZELA 3S6HA 4GM5A 1I1DA 4NBFA 1Q7Y2 4YWYA 5C82A 1JWHC 3IEHA 4AVAA 4XPLA 1IYLA 4KUAA 2VEZA 1MJAA 5AG7A 5LRGA 2VBQA 2PJ5A 1SIWA 1F2PA 2CF4A 1VQ81 4KOVA 2V8HA 2R93I 5F48A 5IB0A 1NJI2 3W6SA 4MHNA 2OOTA 5K8MA 4R3KA 1ZG9A 4AVBA 4KLVA 4R3LA 3IWWA 5AG5A 3T90A 4OMEA 2DE5A 4ZY1A 3PO3S 3KQZA 1N8R1 2OTJ1 1X3WA 1NSLA 2HB6A 2E7ZA 3PP9A 2FSRA 2DEAA 3D7DA 2JR6A 2ZW6A 2O28A 3VTNA 1VLAA 3B2YA 2AE6A 4Q38A 3S1NI 3CC4Z 4CGLA 3RNZA 2I79A 2QVPA 2Q4YA 2BCOA 3D6WA 4A39A 3IFEA 1WJ2A 1VQ61 1QSRA 4ORFA 1XMTA 3NE7A 1RTQA 1YUKA 3EEDA 3SJXA 2ZAEB 4NBHA 4KUBA 3CC71 1YJN1 4F0XA 3EO4A 4U9YA 3OW2Z 1VHEA 4OKOA 5T67A 2DXQA 3OWCA 3GCFA 1TWFI 1UWYA 1N8R2 4MCQA 4XPDB 1N2FA 1CX8A 2A4NA 2V77A 1YITZ 4BY1I 2QREB 2GFQA 4PQAA 2OZGA 4E8OA 5A27A 1S7FA 2E2HI 3IR7A 3GTGI 4AXVA 3I9SA 2ZEHA 4EMEA 2Q7SA 3K2KA 2WUUA 1HDQA 4XPKA 2E9HA 1ARLA 3H0GI 3BJ7A 1ZH1A 1ON0A 2XEJA 3H8EA 5IV0A 3PBBA 2PJCA 2JIRA 3TOAA 1LOKA 3PB9X 2Z10A 4UFVA 5HVFA 2CNMA 3EY5A 4XNHC 4A3MI 3CCL1 1WCMI 3VARA 2EGTA 2IV2X 1ELMP 3TOBA 1I12A 4H6UA 3CCMZ 3MN8A 2V8JA 3J7A4 2PJ4A 2AFMA 4ZY2A 4NBBA 2AFOA 3K7AI 3CXSA 3G4SZ 4A3JI 1VHSA 3CC41 1Q811 5IP7I 2CTCA 2OOYB 1VQ6Z 4CL1A 2D4PA 2AFSA 2JS4A 2BSWA 3R96A 4UEFA 3S1QI 5GCNA 2AFUA 2GE3A 2JIPA 3PB4X 3TO6A 2B4DB 4M3SA 2PRQA 1S60A 1Y9KA 1QVGY 4NBDA 4F9VA 3CCSZ 3NA6A 1QQ9A 3KIHA 3EERA 2PJ1A 4UCNA 4A31A 3FJUA 3IFUA 5CNPA 1QVGZ 3CPWY 1IIDA 3S2DI 4P4BA 1AYEA 2I3CA 1FY7A 3TDHB 2GTHA 1IICA 2PJAA 1N71A 5BWAB 2WYRA 4PV6A 1QYPA 4TNUA 2QMLA 3FEDA 1LAPA 3CPWZ 4A93I 3TO7A 1PCAA 3D68A 2PR1A 4UA3A 2B63I 1ZLHA 2RC4A 5K8NA 3LMSA 2VPYA 5D1OA 1YIJZ 3CME1 4A3CI 2AFWA 1NJI1 2DPSA 2ZW5A 4JWPA 3K9UA 5D29A 3JUWA 1J4JA 2OH1A 2JBKA 4BBSI 1ZO0A 4IAVA 5K8PA 2B5GA 2GANA 1Z8TA 1NMTA 3FB3A 1K4JA 1XMBA 3GB0A 5HMNA 3FECA 4NGNA 5D1OB 1JQGA 1H8LA 2ABZA 2IZ3A 1FT7A 4NF1A 1M4LA 1F2OA 2CTBA 2PJ6A 2QA4Z 1RQFA 1QMUA 4A37A 4OIWA 2C1CA 4PPZA 2FCKA 4U9ZA 2G2KA 4YFJA 5HXDA 3RZOI 1W2BY 4NEXA 3G8WA 2D4OA 3IU1A 2Y0SA 3FH4A 5F49A 1VQ9Z 3JAMf 1Y8CA 2B4DA 4R8FA 2NMTA 1YHQZ 2RFHA 1TWGI 4CAWA 3F0AA 1Y9WA 2RIQA 4YU9A 2J8RA 1PYTB 4AG9A 1SFOI 4E32A 4NB8A 2QRCB 4K3NA 1S7NA 2YU9I 3S14I 4MMOA 2HF1A 5AG4A 4LQ6A 1Q822 3GKQA 3H8GA 3KGQA 5LYLA 1Z02A 1QSNA 4FD7A 4Y49C 2WZNA 3MZKB 1RNIA 4NGPA 3R9GA 2XEGA 3RYOA 1U6MA 2ZOGA 3IF8A 4DK1A 2ATRA 1XE4A 4CAVA 1TKJA 1X10A 3GLJA 4P10A 4MH4A 4CGMA 3N5FA 1VQLZ 4OC0A 3BI0A 5HVHA 5EMIA 5FLXf 2BEIA 3G71Z 1P4NA 3T8WA 3WC7A 1VQP1 4B10A 4MY0A 2AJ6A 1YUAA 2NVYI 1X3ZA 4L89A 4B5OA 2VZYA 5ELYA 1Q2DA 4A38A 3VH9A 3VWDA 3CXCY 3GKRA 4Z65A 1VQNZ 5E96A 2WSAA 3CPAA 3D2MA 1YR0A 5C44I 4L8AA 3QAHA 3NE8A 5FLMI 3A9LA 1Y0YA 1KD12 3SJGA 4A3KI 3BXMA 4OC1A 4QBJA 4RN7A 3P2HA 2IQ6A 3W6XA 4YRHA 4KOYA 4LX9A 5JH9A 3D8PA 1BO4A 4PK2A 4HNWB 4AB7A 2JA8I 1KRLA 3VMGA 3FBUA 3E0KA 1QF8A 4KVXA 3G3SA 3CCLZ 5LRJA 1DTDA 3FQMA 1ZG7A 2R7ZI 5F46A 3B35A 4DNCA 3KI9A 4NH1C 3J81f 3KR4A 2Z3KA 1M1DA 4RS2A 1VQ71 1LCPA 3CCE1 4R6TA 4DJLA 1YI2Z 2EWBA 2CY2A 4RI1A 4MFZA 1SQHA 1IGBA 1YLEA 2GTIA 3PZJA 1TF9A 4Y52I 5A2Qb 3HLPA 4FUUA 1YSJA 3DR8A 3CMAZ 3KQXA 2V8GA 4NJQA 3GTMI 1M902 3V7ZA 4B5PA 3U50C 5CBMA 4CYPA 4XPDC 4G1PA 2OR4A 2WB1A 2E2II 2QLVB 1YK3A 5JM6A 3G6E1 2OZKA 4B13A 3HUVA 1KC81 4LQGA 4S1TA 3VB9A 3RAMA 1USPB 3I56Z 1FDIA 2AKLA 2VQYA 1CP6A 2KPIA 1LFWA 2C6CA 4MI4A 1S5KA 1PUAA 3B8GA 1LRZA 1M44A 2EK8A 3FX6A 1OBRA 2PC1A 3GTQI 4PXCA 2FIAA 2ZEOA 1Z4EA 2VUMI 1M901 4A33A 3WR7A 1AA6A 3I3GA 2J8MA 4HNXB 2ZEEA 1S7LA 4BXXI 2RT9A 4JLYA 3S6GA 2PCUA 1IU8A 3TCVA 1KQSZ 2JEVA 2GLFA 2RB7A 3GTLI 1IYKA 4NSQA 1YMEA 3NH4A 1TFIA 3J80b 4P6YA 4NGMA 3IGRA 1Q2YA 1S7MA 1Y1VS 4MCPA 4ZGYB 1QXFA 1RO5A 3QAYA 3CC21 1K732 1HEEA 4MHYA 2POKA 4MHZA 1RXTA 1Z4RA
chains in the Genus database with same CATH topology
3KIFA 2OTJZ 2PJAA 2JBJA 4NBAA 2F8HA 3RBUA 1YW4A 2JA6I 3PEIA 3CMEZ 3CCS1 1VQ51 2WYRA 4P4JA 1QYPA 1VQL1 3SI2A 4TNUA 3WC6A 4RVHA 3P5JB 4E2YA 3KHXA 3FEDA 3LWUA 1LAPA 3CCJ1 3CPWZ 4A93I 4E2WA 2QKDA 1HDUA 1PCAA 4RVFA 3D68A 2PK7A 4MXUA 1VQ8Z 1Z8LA 2B63I 4NBEA 3BG0B 1ELLP 1ZLHA 2ANPA 3S16I 3KHZA 4NB9A 4JYWA 5K8NA 3LMSA 2LFUA 4QTTA 2PJBA 2PVVA 1K83I 3B3VA 2W04A 3PRTA 3PB8X 2O4HA 3MONA 3S17I 3BI1A 3NDIA 5D1OA 3S1MI 3D4UA 1YIJZ 3CME1 4A3CI 4E31A 2AFWA 1NJI1 5C4XI 1R9TI 3HOZI 2IMOA 4PXEA 3G711 1VGYA 5LYIA 5J1QA 2RBLA 4NBGA 4A3EI 2OTLZ 3BG1B 3NFZA 3Q87A 3I4NI 5D29A 4E2XA 4MD9A 2JBKA 1Y0RA 5IT9f 4BBSI 2JMOA 3OW2Y 5FLXb 1VHOA 3G4S1 4MRIA 1LQLA 4MD8A 2F4MA 1ZB9A 1Z5RA 2PJ7A 4IAVA 3J80f 1CBXA 5K8PA 1VQK1 3GTOI 2RHBA 2BOAA 4TWEA 5IB9A 4A3LI 4R76A 2ZENA 2DE7A 1RO4A 2JA7I 3HOXI 1XMBA 2V8VA 4F9UA 3S15I 3B3TA 3GB0A 4EWTA 1YIT1 3IIBA 3D7GA 3D7HA 3B7IA 3FECA 2HC9A 3S9LA 3HOWI 4NGNA 5D1OB 1JQGA 4FBEA 2P28A 3PFOA 1K731 1VIXA 2ZEGA 2G9DA 1YJW1 3DLJA 3I1UA 4A3GI 1H8LA 2ABZA 2IZ3A 1FT7A 3KL9A 1M4LA 3KASA 3I561 1F2OA 4RV9A 1YW6A 2PMZA 1KWMA 2CTBA 1BAVA 2PJ6A 2QA4Z 5F09A 1RQFA 3NDJA 1VQO1 1XBUA 1XJOA 3B3SA 4RS4A 5THWA 2QA41 2M6NA 1Y1WI 1QMUA 1YIJ1 2WAQA 3G6EZ 4A37A 1WW9A 2Q4ZA 2F4OA 3I55Z 1ZB8A 3PB6X 4UIBA 3FKII 4AYBA 4OIWA 4MHPA 2QR1B 1Q7Y1 1R3NA 1NUIA 2C1CA 3S9NA 4Y7NI 3TC8A 1NP6A 1Z01A 1TWHI 3ESWA 3B3WA 4IHMA 4NGTA 4PPZA 3HOYI 3QWUA 4P4EA 2G2KA 5HXDA 1TF8A 3RZOI 3CCR1 2GU2A 1W2BY 1BPMA 2J9AA 1I3QI 2PJ0A 2QJ8A 4BY7I 3CD61 2Y0SA 1Q812 3RZAA 1VQMZ 3IC1A 3FH4A 1F57A 2Q51A 1S721 1VQ9Z 1VQ7Z 3JAMf 3NH8A 2NVQI 2R92I 2EK9A 4R8FA 1L1OC 3J81b 1YHQZ 4X6AI 1Z2LA 2RFHA 3VMIA 3M3YI 3D9XA 3HOVI 4ZX9A 4X2TA 1TWGI 4P45A 4EWCA 1YJNZ 4P4DA 2VUGA 1YI21 5DS0A 4A3FI 4OC2A 2RIQA 3L2NA 4FAIA 2JA5I 4YU9A 1VQ5Z 1PYTB 3ISZA 2NYQA 4MONA 3FF3A 1SFOI 3BHXA 3FVLA 5C4JI 4E32A 4KSIA 1K8A1 4OIDA 4NB8A 2QRCB 4K3NA 2M48A 2QEX1 2YU9I 4FWUA 2NVXI 3S14I 1VQN1 2V8DA 3PO2I 5JGFA 1Q821 3CCJZ 4MMOA 2HF1A 5LYFA 2ZEMA 2E2JI 1JJ2Z 2OOXB 1Q822 3PFEA 4RVDA 1BPNA 5I4MA 2ZELA 4ONWA 2J6AA 3MZLB 4EFDA 3GKQA 3WABA 2VL1A 3H8GA 4GM5A 3KGQA 4X8IA 1ZLIA 3CXCZ 1RO0A 2C6GA 3KZWA 4NBFA 1Q7Y2 4YWYA 2BO9A 5LYLA 1Z02A 1JWHC 1K9M2 4JZ0A 3IEHA 2WZNA 3MZKB 1RNIA 4NGPA 1KQSY 4NOZA 2PE3A 1XFOA 1Q861 3F3PC 2XEGA 2XEFA 5LRGA 2GLJA 2ZOGA 3IF8A 1Q862 4WWVA 3CCUZ 4DK1A 1VQPZ 1QVFZ 2PJ5A 1RO2A 6CPAA 2NSMA 1F2PA 4F8ZA 1TKJA 3M4OI 2CF4A 4RUHA 3GLJA 1VQ81 4RVGA 4W9YA 3I4MI 4P10A 2P3YA 2V8HA 2R93I 4MH4A 3S9MA 1XRYA 1ML8A 2JNYA 3N5FA 1VQLZ 4OC0A 3BI0A 2PJ3A 5HVHA 1NJI2 1TKFA 3QNVA 4NFRA 5FLXf 5C3EI 4A3II 3G71Z 3T8WA 2O53A 4MHNA 3CCEZ 1X0TA 3WC7A 2OOTA 3CCU1 1VQP1 5K8MA 2VF1A 1ZG8A 1ZG9A 2JUBA 1YUAA 1M1K2 4OC3A 4DGLA 4UF4A 2NVYI 3IWWA 1X3ZA 5D8NA 4OMEA 2DE5A 4ZY1A 3NH5A 5ELYA 4QTUA 3CC2Z 4A38A 3H3VJ 3VH9A 3PO3S 3KQZA 4NGSA 3GTPI 1N8R1 4NJRA 3D7FA 4P4IA 3CXCY 2OTJ1 3JRUA 1X3WA 2AFZA 4Z65A 5K8OA 1VQNZ 3K9TA 2HB6A 3CPAA 2DEAA 5C44I 4ZY0A 3I07A 3CCM1 4HH4A 3SJFA 3D7DA 2JR6A 2Q43A 4R7MA 4MCSA 3VTNA 5FLMI 1Y0YA 1DE4C 4P44A 1VLAA 1KD12 3CPXA 3SJGA 3B2YA 1K9M1 4A3KI 3BXMA 3S1NI 4OC1A 3CC4Z 2ZEFA 1KD11 4OP4A 2IQ6A 3GTJI 3CD6Z 2QVPA 4E30A 2BCOA 3D6WA 4A39A 4P4FA 5JH9A 3IFEA 2IJZA 3SJEA 4PXBA 1VQ61 3T4NB 2JA8I 1KRLA 3VMGA 3IJ3A 1VQ91 1QF8A 4MD7A 1RLYA 2IZ4A 1RTQA 3MRUA 4OC4A 3PBEA 4H2KA 1YUKA 3GTMS 3EEDA 3D66A 3CQZI 3SJXA 2ZAEB 5A2Qf 4NBHA 1CPXA 3CCLZ 5LRJA 1DTDA 3FQMA 3ISXA 3CC71 1YJN1 1QVFY 2R7ZI 1ZG7A 2JEWA 2AFXA 5CPAA 1LANA 3B35A 3OW2Z 1VHEA 2PJ8A 3FMCA 4OKOA 5T67A 1CPSA 3KI9A 4HGYA 4NH1C 3J81f 1I6HI 1BLLE 1Y7EA 3KR4A 3H8FA 4E2ZA 4DYOA 1VQ71 3HOUI 2ZEPA 3GCFA 2HU9A 1TWFI 1UWYA 1LCPA 3CCE1 2NVTI 3B3CA 4R6TA 1N8R2 4MCQA 3JAMb 4ZI6A 4DJLA 1YI2Z 3CCRZ 2EWBA 3CCV1 1IGBA 3CCQZ 1TXRA 4CPAA 2GTIA 1N2FA 1CX8A 1TF9A 5T64A 1S72Z 5AN9F 2V77A 3KR5A 1YITZ 3CMA1 4BY1I 2QREB 4Y52I 1EE3P 2ZEDA 4PQAA 5A2Qb 4E33A 3WT4A 1Y1VI 3HLPA 2XEIA 4FUUA 3GUXA 2E2HI 3GTGI 1YSJA 4BBRI 3CMAZ 3KQXA 4AXVA 3SI0A 2V8GA 1YJ91 4NGRA 2C6PA 5IP9I 2ZEHA 4NJQA 4EMEA 3GTMI 1M902 3V7ZA 1TWCI 3D67A 2V8IA 3K2KA 4PXDA 3WC5A 3U50C 3CCQ1 5CBMA 4XX2A 1HDQA 1I50I 4G1PA 2E9HA 1ARLA 3H0GI 2OR4A 2WB1A 2YADA 4X3RA 2E2II 1Z03A 3LUSA 8CPAA 2QLVB 2GREA 1ZH1A 5JM6A 3G6E1 2OZKA 2XEJA 3H8EA 3HUVA 1KC81 3PBBA 2PJCA 2K3RA 1VQ4Z 3F3FC 3HKZA 1R43A 4A94A 2R6MA 1LOKA 3PB9X 4LQGA 4S1TA 2KI7B 3VB9A 2PVWA 2ZOFA 2PIZA 3RAMA 5HVFA 4DUKA 1USPB 1TWAI 4A3MI 3I56Z 1JJ2Y 3DGVA 1VQKZ 1DL6A 3CCL1 2AKLA 1WCMI 3VARA 2EGTA 2LIYA 1CP6A 5LL6f 4WJBA 2KPIA 1LFWA 1ELMP 2FVGA 3I551 4ZYQA 2C6CA 2PIYA 4O23A 3CCMZ 1YJWZ 3MN8A 2V8JA 3J7A4 2PJ4A 3TE5B 3S2HI 2AFMA 2BJOA 3SI1A 1VQ41 2PM9A 4ZY2A 2EK8A 4NBBA 3FX6A 2AFOA 5LRKA 1LAMA 2DE6A 3CCVZ 1OBRA 3K7AI 1YJ9Z 1W2BZ 3GTQI 3G4SZ 4A3BI 4A3JI 3S1RI 4PXCA 3PB7X 1K8A2 3CC41 3VMHA 1Q811 1CP7A 5IP7I 3IX0A 3FQQA 5CM2M 4BD9A 3PO3I 2OTL1 2CTCA 2ZEOA 1USPA 2VUMI 1YLOA 4IK2A 4OC5A 1M901 1P9NA 1ARMA 3CT9A 2W03A 2OOYB 1Q7LA 3FEEA 1WIIA 1VQ6Z 4MCRA 4CL1A 1CG2A 2ZEEA 4HGZA 4BXXI 2AFSA 2RT9A 2JS4A 5LYDA 5T6BA 3GTKI 3RZDI 2PCUA 2RPRA 4UIAA 2V8KA 4B6ZA 3CC7Z 3CDXA 4NBCA 1KQSZ 2K5RA 2GLFA 2H85A 1TKHA 2RB7A 3S1QI 4UEFA 7CPAA 3GTLI 2AFUA 1YHQ1 1AMPA 2F7VA 4A3DI 3TX8A 3PB4X 4DQYB 1M1K1 1PFTA 1VQOZ 1YMEA 1KC82 3NH4A 2PRQA 1TFIA 1GYTA 1QVGY 4NBDA 1IY7A 3VATA 4F9VA 1VQM1 5HVGA 3CCSZ 3NA6A 1QQ9A 3KIHA 3EERA 3J80b 4P6YA 4UEZA 2PJ1A 5D1PA 4NGMA 2CIJA 4ZX8A 3FJUA 1S7MA 1Y1VS 2QRDB 2QEXZ 1NSAA 3V38A 3IFUA 4MCPA 1QVGZ 3CPWY 2PJ9A 4UEEA 4NGQA 3IO1A 1FNOA 3CC21 1K732 1HEEA 3S2DI 4MHYA 2POKA 2PJ2A 4P4BA 1AYEA 4MHZA 2QYVA 5IT9b 4Q7AA 2I3CA 3TDHB 2GTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJA A;  2JBJ A;  2F8H A;  3RBU A;  1YW4 A;  3PEI A;  2WYR A;  4P4J A;  3SI2 A;  4TNU A;  3WC6 A;  3KHX A;  3FED A;  3LWU A;  1LAP A;  1HDU A;  1PCA A;  3D68 A;  4MXU A;  1Z8L A;  2ANP A;  1ZLH A;  1ELL P;  4JYW A;  3KHZ A;  5K8N A;  3LMS A;  2PJB A;  2PVV A;  3B3V A;  3PRT A;  3PB8 X;  2O4H A;  3BI1 A;  3D4U A;  8CPA A;  2IMO A;  2AFW A;  4PXE A;  1VGY A;  5LYI A;  5J1Q A;  3NFZ A;  5D29 A;  2JBK A;  1Y0R A;  1VHO A;  4MRI A;  1Z5R A;  2PJ7 A;  4IAV A;  1CBX A;  5K8P A;  2BOA A;  4TWE A;  5IB9 A;  4R76 A;  2ZEN A;  1XMB A;  2V8V A;  4F9U A;  3B3T A;  3GB0 A;  4EWT A;  3IIB A;  3D7G A;  3D7H A;  3B7I A;  3FEC A;  2HC9 A;  3S9L A;  4NGN A;  1JQG A;  4FBE A;  3PFO A;  1VIX A;  2ZEG A;  2G9D A;  3DLJ A;  3I1U A;  1H8L A;  2ABZ A;  1FT7 A;  3KL9 A;  1M4L A;  3KAS A;  1F2O A;  1YW6 A;  1KWM A;  2CTB A;  1BAV A;  2PJ6 A;  5F09 A;  1XBU A;  1XJO A;  3B3S A;  5THW A;  1QMU A;  4A37 A;  2Q4Z A;  3PB6 X;  4UIB A;  4OIW A;  4MHP A;  1R3N A;  2C1C A;  3S9N A;  3TC8 A;  4PPZ A;  4IHM A;  3B3W A;  4NGT A;  4P4E A;  5HXD A;  1TF8 A;  2GU2 A;  1BPM A;  2J9A A;  2PJ0 A;  2QJ8 A;  3RZA A;  3IC1 A;  3FH4 A;  1F57 A;  2Q51 A;  3NH8 A;  2EK9 A;  4R8F A;  1Z2L A;  2RFH A;  4ZX9 A;  4X2T A;  4P45 A;  4P4D A;  5DS0 A;  4OC2 A;  4FAI A;  3L2N A;  4YU9 A;  1PYT B;  3ISZ A;  2NYQ A;  3FF3 A;  3BHX A;  3FVL A;  4KSI A;  4OID A;  4K3N A;  4FWU A;  2V8D A;  5JGF A;  4MMO A;  5LYF A;  2ZEM A;  3PFE A;  1BPN A;  5I4M A;  2ZEL A;  4ONW A;  4EFD A;  3WAB A;  2VL1 A;  3H8G A;  4GM5 A;  3KGQ A;  4X8I A;  1ZLI A;  2C6G A;  3KZW A;  4YWY A;  2BO9 A;  5LYL A;  4JZ0 A;  3IEH A;  2WZN A;  4NGP A;  2PE3 A;  1XFO A;  2XEG A;  2XEF A;  5LRG A;  2GLJ A;  2ZOG A;  4WWV A;  2PJ5 A;  6CPA A;  2NSM A;  1F2P A;  4F8Z A;  1TKJ A;  2CF4 A;  4RUH A;  3GLJ A;  4W9Y A;  4P10 A;  2V8H A;  3S9M A;  1XRY A;  3N5F A;  4OC0 A;  3BI0 A;  2PJ3 A;  5HVH A;  3QNV A;  1TKF A;  4NFR A;  3T8W A;  2O53 A;  4MHN A;  3WC7 A;  2OOT A;  5K8M A;  1ZG8 A;  1ZG9 A;  4OC3 A;  4UF4 A;  3IWW A;  5D8N A;  4OME A;  4ZY1 A;  3NH5 A;  5ELY A;  4A38 A;  3VH9 A;  3KQZ A;  4NGS A;  4NJR A;  3D7F A;  4P4I A;  3JRU A;  2AFZ A;  4Z65 A;  5K8O A;  3K9T A;  2HB6 A;  3CPA A;  2DEA A;  4ZY0 A;  3SJF A;  3D7D A;  2Q43 A;  4R7M A;  4MCS A;  1Y0Y A;  1DE4 C;  4P44 A;  3CPX A;  3SJG A;  3B2Y A;  3BXM A;  4OC1 A;  2ZEF A;  4OP4 A;  2IQ6 A;  2QVP A;  2BCO A;  4A39 A;  5JH9 A;  4P4F A;  3IFE A;  2IJZ A;  3SJE A;  4PXB A;  3IJ3 A;  4OC4 A;  1RTQ A;  3MRU A;  3PBE A;  4H2K A;  3D66 A;  3SJX A;  1CPX A;  5LRJ A;  1DTD A;  3ISX A;  1ZG7 A;  2JEW A;  2AFX A;  5CPA A;  1LAN A;  3B35 A;  1VHE A;  2PJ8 A;  3FMC A;  4OKO A;  1CPS A;  3KI9 A;  1BLL E;  1Y7E A;  3KR4 A;  3H8F A;  4DYO A;  2ZEP A;  1UWY A;  1LCP A;  3B3C A;  4R6T A;  4MCQ A;  4ZI6 A;  4DJL A;  2EWB A;  1IGB A;  1TXR A;  4CPA A;  1CX8 A;  1TF9 A;  2V77 A;  3KR5 A;  2ZED A;  3WT4 A;  1EE3 P;  4PQA A;  3HLP A;  2XEI A;  4FUU A;  3GUX A;  1YSJ A;  3KQX A;  4AXV A;  3SI0 A;  2V8G A;  4NGR A;  2C6P A;  2ZEH A;  4EME A;  4NJQ A;  3V7Z A;  3D67 A;  3K2K A;  4PXD A;  3WC5 A;  5CBM A;  1HDQ A;  4G1P A;  1ARL A;  2OR4 A;  4X3R A;  2GRE A;  5JM6 A;  2XEJ A;  3H8E A;  3HUV A;  3PBB A;  2PJC A;  4A94 A;  1R43 A;  1LOK A;  3PB9 X;  4LQG A;  2ZOF A;  2PVW A;  3RAM A;  2PIZ A;  5HVF A;  4DUK A;  3DGV A;  3VAR A;  1CP6 A;  4WJB A;  1LFW A;  1ELM P;  2FVG A;  4ZYQ A;  2C6C A;  2PIY A;  4O23 A;  3MN8 A;  2PJ4 A;  2AFM A;  3SI1 A;  4ZY2 A;  2EK8 A;  3FX6 A;  2AFO A;  5LRK A;  1LAM A;  1OBR A;  4PXC A;  3PB7 X;  1CP7 A;  4BD9 A;  2CTC A;  2ZEO A;  1YLO A;  4IK2 A;  4OC5 A;  1ARM A;  3CT9 A;  1Q7L A;  3FEE A;  4MCR A;  1CG2 A;  2ZEE A;  5LYD A;  2AFS A;  2PCU A;  4UIA A;  4B6Z A;  3CDX A;  2GLF A;  1TKH A;  2RB7 A;  4UEF A;  7CPA A;  2AFU A;  2F7V A;  1AMP A;  3TX8 A;  3PB4 X;  1YME A;  3NH4 A;  2PRQ A;  1GYT A;  1IY7 A;  3VAT A;  4F9V A;  5HVG A;  3NA6 A;  1QQ9 A;  4P6Y A;  4UEZ A;  2PJ1 A;  4NGM A;  2CIJ A;  4ZX8 A;  3FJU A;  1NSA A;  3V38 A;  4MCP A;  2PJ9 A;  4UEE A;  4NGQ A;  3IO1 A;  1FNO A;  1HEE A;  4MHY A;  2POK A;  2PJ2 A;  4P4B A;  1AYE A;  4MHZ A;  2QYV A;  4Q7A A;  2I3C A; 
#chains in the Genus database with same CATH topology
 3RBU A;  2ZXV A;  5G22 A;  4P4J A;  3P5J B;  4E2Y A;  2YGW A;  4QUS A;  3CCJ 1;  4E2W A;  2QKD A;  3DR6 A;  2PK7 A;  1AUG A;  2ANP A;  3KHZ A;  4NB9 A;  2PJB A;  1QSM A;  2PVV A;  3B3V A;  3BJ8 A;  1QST A;  4E31 A;  5C4X I;  4PXE A;  3G71 1;  4KOT A;  1YQE A;  3N7Z A;  4NBG A;  4A3E I;  2Z0Z A;  3BG1 B;  3NFZ A;  3Q87 A;  3I4N I;  4E2X A;  5IT9 f;  2JMO A;  1VHO A;  3G4S 1;  4MRI A;  3UY5 A;  1LQL A;  4A2Z A;  2F4M A;  3J80 f;  2RHB A;  4R76 A;  2ZEN A;  1YVO A;  2JA7 I;  3S15 I;  3IIB A;  4HKF A;  4CAE A;  1M4G A;  3D7H A;  4QC6 A;  1BOB A;  1MK4 A;  4PK3 A;  3S9L A;  1Z9U A;  1XIX A;  2P28 A;  2R1I A;  3TO9 A;  2R7H A;  3KL9 A;  2B3V A;  3I56 1;  4RV9 A;  3TFY A;  2PMZ A;  2PSW A;  3NDJ A;  1VQO 1;  1XJO A;  3C26 A;  5THW A;  2M6N A;  3EXN A;  3G6E Z;  2VXK A;  5KTA A;  1Z8X A;  2F4O A;  3LAC A;  3FKI I;  4AYB A;  5A28 A;  1Q7Y 1;  1NUI A;  3S9N A;  1P0H A;  4IHM A;  2VZZ A;  1I3Q I;  4CYQ A;  4BY7 I;  5F47 A;  3IC1 A;  2V3V A;  1F57 A;  2Q51 A;  1Q2C A;  1VQ7 Z;  3NH8 A;  3F5B A;  2R92 I;  4GS4 A;  4BBH A;  4X6A I;  4HPS A;  3M3Y I;  2EVN A;  4CYN A;  4ZX9 A;  4X2T A;  4P45 A;  4P4D A;  1I21 A;  4FAI A;  3FF3 A;  3BHX A;  3FVL A;  5C4J I;  4KSI A;  1K8A 1;  4OID A;  3KKW A;  4E0A A;  2Z3P A;  2HUZ A;  3PO2 I;  5JGF A;  1Q82 1;  2OOX B;  1BPN A;  4EFD A;  2J6A A;  3MZL B;  3WAB A;  4KVM E;  3DNS A;  4X8I A;  4H89 A;  1RO0 A;  3KZW A;  2ZPA A;  2Z3N A;  4II9 A;  3W91 A;  1UFH A;  1KQS Y;  1Q86 1;  3F3P C;  2GLJ A;  2HV2 A;  2AYD A;  1B6B A;  3CCU Z;  1QVF Z;  1RO2 A;  4ONU A;  1MJ9 A;  4M6G A;  3M4O I;  4RVG A;  4W9Y A;  3I4M I;  2FIW A;  2YNC C;  2P3Y A;  3S9M A;  1XRY A;  2JNY A;  4MFJ A;  3QNV A;  1TKF A;  3FYN A;  4NFR A;  1S7K A;  2O53 A;  1X0T A;  3H5Z A;  4JJX A;  3CCU 1;  1ZG8 A;  2JUB A;  2Z3O A;  4KLW A;  1M1K 2;  4UF4 A;  4CGO A;  2CXA A;  3NH5 A;  1CJW A;  4QTU A;  3CC2 Z;  3H3V J;  4NGS A;  3GTP I;  4A32 A;  3GY9 A;  2PDO A;  2AFZ A;  5K8O A;  3K9T A;  1A2Z A;  2X7B A;  3QB8 A;  3CCM 1;  4HH4 A;  2OB0 A;  4R7M A;  4MCS A;  1XF8 A;  5ISV A;  3CPX A;  1KD1 1;  3IU2 A;  3GTJ I;  3R9F A;  3CD6 Z;  5EBV A;  2C27 A;  3IWG A;  5G20 A;  4P4F A;  4UCM A;  2IJZ A;  3SJE A;  4PXB A;  4JXR A;  3CXQ A;  4OC4 A;  2ZW7 A;  3PBE A;  1KUY A;  4OLL A;  5A2Q f;  1XEB A;  1CPX A;  4KOU A;  3ISX A;  2JEW A;  2AFX A;  5CPA A;  1LAN A;  2PJ8 A;  1CPS A;  1Q16 A;  4C2Z A;  1I6H I;  1BLL E;  1Y7E A;  3DDD A;  4DYO A;  3HOU I;  2ZEP A;  5H84 A;  2Q4V A;  3JAM b;  4ZI6 A;  4FD6 A;  2VPX A;  3CCQ Z;  1TXR A;  3CZX A;  2FE7 A;  4CRZ B;  2BL1 A;  5AN9 F;  2JDC A;  2PR8 A;  3WT4 A;  1EE3 P;  1Y1V I;  3EFA A;  3GUX A;  4BBR I;  1WZN A;  2C6P A;  5IP9 I;  4CRY B;  1TWC I;  3D67 A;  2V8I A;  4PXD A;  5J8C A;  4OAD A;  4X5K A;  1Z03 A;  2GRE A;  2QIR A;  1YGH A;  2CNS A;  5I0C A;  3MGD A;  2FT0 A;  4A94 A;  3HKZ A;  2VPW A;  2PVW A;  1JJ2 Y;  4CGP A;  4F0Y A;  3D2L A;  2Z3L A;  4WJB A;  3I55 1;  4ZYQ A;  1YJW Z;  4MJ8 A;  2ARH A;  1Y7R A;  3S2H I;  3SI1 A;  1VQ4 1;  4CGN A;  5LRK A;  1LAM A;  2DE6 A;  3S1R I;  3PB7 X;  1K8A 2;  1NE9 A;  4QB9 A;  5CM2 M;  2Z11 A;  3PO3 I;  1USP A;  1YLO A;  2JLM A;  4OC5 A;  1P9N A;  3FEE A;  4MCR A;  2P6F A;  4HGZ A;  4B11 A;  5T6B A;  3RZD I;  4UIA A;  2V8K A;  3CC7 Z;  2K5R A;  2H85 A;  1TKH A;  2OU2 A;  4NCZ A;  7CPA A;  1YHQ 1;  1AMP A;  2F7V A;  1PFT A;  1VQO Z;  4NXY A;  1GYT A;  4B5P B;  3VAT A;  1M4I A;  4UWJ A;  4ZX8 A;  2QRD B;  2EUI A;  2PJ9 A;  4UEE A;  2HQY A;  3IO1 A;  1FNO A;  3IWE A;  2QYV A;  5IT9 b;  4Q7A A;  2JBJ A;  3S6K A;  2F8H A;  2JA6 I;  3CCS 1;  1VQ5 1;  1VQL 1;  2I00 A;  3WC6 A;  1VKC A;  2Q44 A;  3R95 A;  4RVF A;  4MY3 A;  4MXU A;  2P0W A;  3P2F A;  4NBE A;  3BG0 B;  4JYW A;  3S16 I;  4BMH A;  2W04 A;  2YNE A;  3VWE A;  2O4H A;  3MON A;  3S17 I;  3BI1 A;  2ODF A;  2LEX A;  3HOZ I;  1VGY A;  4KZT A;  5J1Q A;  2OTL Z;  2OZU A;  1V0C A;  3OW2 Y;  4B12 A;  2G3A A;  1Z5R A;  2PJ7 A;  1B87 A;  1CBX A;  2Z3M A;  3GTO I;  5IB9 A;  4FD5 A;  2DE7 A;  3HOX I;  2V8V A;  2PRB A;  3B3T A;  4KS9 A;  3D7G A;  2EO8 A;  4FBE A;  3PFO A;  1VIX A;  1IB1 E;  2EBJ A;  2ZEG A;  1YJW 1;  3DLJ A;  3I1U A;  4A3G I;  5G21 A;  1GHE A;  3TTH A;  2JIM A;  4CAF A;  3CXP A;  1YW6 A;  4C2Y A;  4RS4 A;  3EC4 A;  5FVJ A;  4KOX A;  1YIJ 1;  2WAQ A;  4IUS A;  2Q4Z A;  3I55 Z;  3PB6 X;  3SHP A;  1ZB8 A;  4MHP A;  2QR1 B;  3TT2 A;  1R3N A;  4MFQ A;  4Y7N I;  3TC8 A;  1NP6 A;  1TWH I;  2DPT A;  4NGT A;  3HOY I;  3CCR 1;  2GU2 A;  1BPM A;  2QJ8 A;  3CD6 1;  3RZA A;  3LD2 A;  1S72 1;  4MFP A;  2VPZ A;  3D2P A;  4K30 A;  2R98 A;  2NVQ I;  2YND A;  5JPH A;  5JQ4 A;  4MFK A;  4KOW A;  3D9X A;  3HOV I;  3V8I A;  2P6G A;  2K5T A;  4PSX A;  4EWC A;  1YJN Z;  4OC2 A;  3L2N A;  2JA5 I;  4F6A A;  2NYQ A;  2WPW A;  2M48 A;  2QEX 1;  3F8K A;  4FWU A;  1VQN 1;  1IOF A;  2ZEM A;  2E2J I;  3PFE A;  2DF5 A;  4ONW A;  4XNH B;  2VL1 A;  3PGP A;  4C7I A;  1ZLI A;  3CXC Z;  2C6G A;  1KUV A;  2BO9 A;  1K9M 2;  4JZ0 A;  4UFX A;  2PE3 A;  4NOZ A;  1XFO A;  2Q7B A;  1XOV A;  2XEF A;  1Q86 2;  4WWV A;  1VQP Z;  6CPA A;  2NSM A;  2Q0Y A;  4F8Z A;  4RUH A;  1ML8 A;  2B58 A;  4LUA A;  2PJ3 A;  3SXO A;  5C3E I;  4A3I I;  3CCE Z;  4H6Z A;  2P6E A;  2BUE A;  3JVN A;  2VF1 A;  1Z8W A;  4OC3 A;  4DGL A;  1S3Z A;  5H86 A;  2ZW4 A;  4M6H A;  5D8N A;  4PSW A;  2JIQ A;  4NJR A;  3D7F A;  4P4I A;  1KUX A;  3JRU A;  4CYO A;  4UWI A;  4ZY0 A;  3I07 A;  3SJF A;  2Q43 A;  4P44 A;  1DE4 C;  4I49 A;  1K9M 1;  2ZEF A;  2V45 A;  4OP4 A;  2QEC A;  4R57 A;  4E30 A;  4AVC A;  1L0C A;  3T4N B;  3IJ3 A;  1VQ9 1;  4MD7 A;  3MRU A;  1RLY A;  2IZ4 A;  4H2K A;  3GTM S;  1FDO A;  2YNC A;  3D66 A;  3CQZ I;  2H5M A;  1IOI A;  1QVF Y;  3FMC A;  4A95 A;  4HGY A;  3GIU A;  3H8F A;  4E2Z A;  2GIV A;  2HU9 A;  3R9E A;  5AGE A;  2NVT I;  3B3C A;  3CCR Z;  4C2X A;  2F5I A;  3CCV 1;  4CPA A;  4GXH A;  5T64 A;  1S72 Z;  2PQ8 A;  3KR5 A;  2ZED A;  2NAP A;  3CMA 1;  3JTK A;  4E33 A;  3FIX A;  2XEI A;  3H4Q A;  3ZZI A;  3SI0 A;  3FXT A;  1YJ9 1;  4NGR A;  4UBR A;  4EVY A;  4ZBG A;  1OZP A;  3WC5 A;  3CCQ 1;  4XX2 A;  1I50 I;  1JWQ A;  2YAD A;  4X3R A;  3LUS A;  3R1K A;  4Q36 A;  3TE4 A;  2K3R A;  1VQ4 Z;  3F3F C;  1R43 A;  2R6M A;  4MFL A;  2KI7 B;  2ZOF A;  2PIZ A;  4AG7 A;  4DUK A;  2FXF A;  1TWA I;  3DGV A;  1VQK Z;  1DL6 A;  3FRM A;  2B5G B;  2LIY A;  5LL6 f;  2FVG A;  2PIY A;  4O23 A;  3TE5 B;  2BJO A;  3RO0 A;  1PU9 A;  2PM9 A;  4J3G A;  4MBU A;  4A30 A;  3CCV Z;  3S6F A;  2Y0M A;  1YJ9 Z;  1W2B Z;  4A3B I;  4M6I A;  3VMH A;  1CP7 A;  4HNY B;  3IX0 A;  2Q04 A;  3FQQ A;  4BD9 A;  2OTL 1;  4IK2 A;  1WK4 A;  1ARM A;  3CT9 A;  2W03 A;  1Q7L A;  1WII A;  1CG2 A;  3D3S A;  5LYD A;  3GTK I;  4E2A A;  2RPR A;  4JD6 A;  4B6Z A;  3CDX A;  2KCW A;  4NBC A;  2B4B A;  2JDD A;  4R87 A;  4A3D I;  2R8V A;  3TX8 A;  4DQY B;  1M1K 1;  1YX0 A;  1KC8 2;  2WPX A;  4OAE A;  1IY7 A;  3LOD A;  1VQM 1;  5HVG A;  3DSB A;  4JXQ A;  4UEZ A;  4BIN A;  5D1P A;  2CIJ A;  2JIO A;  2QEX Z;  1NSA A;  2FL4 A;  2CNT A;  3V38 A;  4NGQ A;  5J8F A;  4UFW A;  2PJ2 A;  1YRE A;  1CM0 A;  3KIF A;  2OTJ Z;  3SXN A;  4NBA A;  1YW4 A;  3PEI A;  3CME Z;  3T9Y A;  3SI2 A;  2J8N A;  4RVH A;  3KHX A;  3LWU A;  1HDU A;  4M85 A;  1M4D A;  1Z8L A;  1VQ8 Z;  2REF A;  1ELL P;  2LFU A;  4QTT A;  4C68 A;  1K83 I;  3PRT A;  3PB8 X;  3NDI A;  2OZH A;  3S1M I;  3D4U A;  8CPA A;  5EC4 A;  2IMO A;  1R9T I;  4CAX A;  1R57 A;  5LYI A;  1YVK A;  2RBL A;  4B14 A;  4MD9 A;  5HH1 A;  1Y0R A;  5FLX b;  4MD8 A;  3FNC A;  1ZB9 A;  4KOS A;  5KTC A;  4C7H A;  1VQK 1;  5KTD A;  2BOA A;  2FS5 A;  4TWE A;  5C88 A;  4A3L I;  4KVO E;  2VI7 A;  1RO4 A;  4F9U A;  4EWT A;  1YIT 1;  1TIQ A;  4KSF A;  3GYA A;  3B7I A;  2HC9 A;  3HOW I;  1K73 1;  2G0B A;  2G9D A;  2REE A;  4KSA A;  3KAS A;  2IL4 A;  1KWM A;  1BAV A;  5F09 A;  1XBU A;  3B3S A;  4UCP A;  2QA4 1;  1Y1W I;  5G1Z A;  5IX3 A;  1WW9 A;  4KOR A;  1MJB A;  4UIB A;  4QVT A;  4MHD A;  5AG6 A;  1Z01 A;  3ESW A;  5DWN A;  3B3W A;  5DWM A;  3QWU A;  4U5Y A;  4P4E A;  1TF8 A;  2B3U A;  2J9A A;  2PJ0 A;  3BLN A;  2G3T A;  1Q81 2;  1VQM Z;  4FD4 A;  4IF5 A;  2EK9 A;  1L1O C;  3J81 b;  1Z2L A;  3VMI A;  1KZF A;  1QSO A;  4R9M A;  2VUG A;  1YI2 1;  5DS0 A;  4A3F I;  1VQ5 Z;  1WWZ A;  3ISZ A;  4MON A;  4Y49 B;  3ZJ0 A;  2NVX I;  2V8D A;  3CCJ Z;  5LYF A;  1JJ2 Z;  4RVD A;  4CS0 B;  1X12 A;  5I4M A;  4YGO A;  2ZEL A;  3S6H A;  4GM5 A;  1I1D A;  4NBF A;  1Q7Y 2;  4YWY A;  5C82 A;  1JWH C;  3IEH A;  4AVA A;  4XPL A;  1IYL A;  4KUA A;  2VEZ A;  1MJA A;  5AG7 A;  5LRG A;  2VBQ A;  2PJ5 A;  1SIW A;  1F2P A;  2CF4 A;  1VQ8 1;  4KOV A;  2V8H A;  2R93 I;  5F48 A;  5IB0 A;  1NJI 2;  3W6S A;  4MHN A;  2OOT A;  5K8M A;  4R3K A;  1ZG9 A;  4AVB A;  4KLV A;  4R3L A;  3IWW A;  5AG5 A;  3T90 A;  4OME A;  2DE5 A;  4ZY1 A;  3PO3 S;  3KQZ A;  1N8R 1;  2OTJ 1;  1X3W A;  1NSL A;  2HB6 A;  2E7Z A;  3PP9 A;  2FSR A;  2DEA A;  3D7D A;  2JR6 A;  2ZW6 A;  2O28 A;  3VTN A;  1VLA A;  3B2Y A;  2AE6 A;  4Q38 A;  3S1N I;  3CC4 Z;  4CGL A;  3RNZ A;  2I79 A;  2QVP A;  2Q4Y A;  2BCO A;  3D6W A;  4A39 A;  3IFE A;  1WJ2 A;  1VQ6 1;  1QSR A;  4ORF A;  1XMT A;  3NE7 A;  1RTQ A;  1YUK A;  3EED A;  3SJX A;  2ZAE B;  4NBH A;  4KUB A;  3CC7 1;  1YJN 1;  4F0X A;  3EO4 A;  4U9Y A;  3OW2 Z;  1VHE A;  4OKO A;  5T67 A;  2DXQ A;  3OWC A;  3GCF A;  1TWF I;  1UWY A;  1N8R 2;  4MCQ A;  4XPD B;  1N2F A;  1CX8 A;  2A4N A;  2V77 A;  1YIT Z;  4BY1 I;  2QRE B;  2GFQ A;  4PQA A;  2OZG A;  4E8O A;  5A27 A;  1S7F A;  2E2H I;  3IR7 A;  3GTG I;  4AXV A;  3I9S A;  2ZEH A;  4EME A;  2Q7S A;  3K2K A;  2WUU A;  1HDQ A;  4XPK A;  2E9H A;  1ARL A;  3H0G I;  3BJ7 A;  1ZH1 A;  1ON0 A;  2XEJ A;  3H8E A;  5IV0 A;  3PBB A;  2PJC A;  2JIR A;  3TOA A;  1LOK A;  3PB9 X;  2Z10 A;  4UFV A;  5HVF A;  2CNM A;  3EY5 A;  4XNH C;  4A3M I;  3CCL 1;  1WCM I;  3VAR A;  2EGT A;  2IV2 X;  1ELM P;  3TOB A;  1I12 A;  4H6U A;  3CCM Z;  3MN8 A;  2V8J A;  3J7A 4;  2PJ4 A;  2AFM A;  4ZY2 A;  4NBB A;  2AFO A;  3K7A I;  3CXS A;  3G4S Z;  4A3J I;  1VHS A;  3CC4 1;  1Q81 1;  5IP7 I;  2CTC A;  2OOY B;  1VQ6 Z;  4CL1 A;  2D4P A;  2AFS A;  2JS4 A;  2BSW A;  3R96 A;  4UEF A;  3S1Q I;  5GCN A;  2AFU A;  2GE3 A;  2JIP A;  3PB4 X;  3TO6 A;  2B4D B;  4M3S A;  2PRQ A;  1S60 A;  1Y9K A;  1QVG Y;  4NBD A;  4F9V A;  3CCS Z;  3NA6 A;  1QQ9 A;  3KIH A;  3EER A;  2PJ1 A;  4UCN A;  4A31 A;  3FJU A;  3IFU A;  5CNP A;  1QVG Z;  3CPW Y;  1IID A;  3S2D I;  4P4B A;  1AYE A;  2I3C A;  1FY7 A;  3TDH B;  2GTH A;  1IIC A;  2PJA A;  1N71 A;  5BWA B;  2WYR A;  4PV6 A;  1QYP A;  4TNU A;  2QML A;  3FED A;  1LAP A;  3CPW Z;  4A93 I;  3TO7 A;  1PCA A;  3D68 A;  2PR1 A;  4UA3 A;  2B63 I;  1ZLH A;  2RC4 A;  5K8N A;  3LMS A;  2VPY A;  5D1O A;  1YIJ Z;  3CME 1;  4A3C I;  2AFW A;  1NJI 1;  2DPS A;  2ZW5 A;  4JWP A;  3K9U A;  5D29 A;  3JUW A;  1J4J A;  2OH1 A;  2JBK A;  4BBS I;  1ZO0 A;  4IAV A;  5K8P A;  2B5G A;  2GAN A;  1Z8T A;  1NMT A;  3FB3 A;  1K4J A;  1XMB A;  3GB0 A;  5HMN A;  3FEC A;  4NGN A;  5D1O B;  1JQG A;  1H8L A;  2ABZ A;  2IZ3 A;  1FT7 A;  4NF1 A;  1M4L A;  1F2O A;  2CTB A;  2PJ6 A;  2QA4 Z;  1RQF A;  1QMU A;  4A37 A;  4OIW A;  2C1C A;  4PPZ A;  2FCK A;  4U9Z A;  2G2K A;  4YFJ A;  5HXD A;  3RZO I;  1W2B Y;  4NEX A;  3G8W A;  2D4O A;  3IU1 A;  2Y0S A;  3FH4 A;  5F49 A;  1VQ9 Z;  3JAM f;  1Y8C A;  2B4D A;  4R8F A;  2NMT A;  1YHQ Z;  2RFH A;  1TWG I;  4CAW A;  3F0A A;  1Y9W A;  2RIQ A;  4YU9 A;  2J8R A;  1PYT B;  4AG9 A;  1SFO I;  4E32 A;  4NB8 A;  2QRC B;  4K3N A;  1S7N A;  2YU9 I;  3S14 I;  4MMO A;  2HF1 A;  5AG4 A;  4LQ6 A;  1Q82 2;  3GKQ A;  3H8G A;  3KGQ A;  5LYL A;  1Z02 A;  1QSN A;  4FD7 A;  4Y49 C;  2WZN A;  3MZK B;  1RNI A;  4NGP A;  3R9G A;  2XEG A;  3RYO A;  1U6M A;  2ZOG A;  3IF8 A;  4DK1 A;  2ATR A;  1XE4 A;  4CAV A;  1TKJ A;  1X10 A;  3GLJ A;  4P10 A;  4MH4 A;  4CGM A;  3N5F A;  1VQL Z;  4OC0 A;  3BI0 A;  5HVH A;  5EMI A;  5FLX f;  2BEI A;  3G71 Z;  1P4N A;  3T8W A;  3WC7 A;  1VQP 1;  4B10 A;  4MY0 A;  2AJ6 A;  1YUA A;  2NVY I;  1X3Z A;  4L89 A;  4B5O A;  2VZY A;  5ELY A;  1Q2D A;  4A38 A;  3VH9 A;  3VWD A;  3CXC Y;  3GKR A;  4Z65 A;  1VQN Z;  5E96 A;  2WSA A;  3CPA A;  3D2M A;  1YR0 A;  5C44 I;  4L8A A;  3QAH A;  3NE8 A;  5FLM I;  3A9L A;  1Y0Y A;  1KD1 2;  3SJG A;  4A3K I;  3BXM A;  4OC1 A;  4QBJ A;  4RN7 A;  3P2H A;  2IQ6 A;  3W6X A;  4YRH A;  4KOY A;  4LX9 A;  5JH9 A;  3D8P A;  1BO4 A;  4PK2 A;  4HNW B;  4AB7 A;  2JA8 I;  1KRL A;  3VMG A;  3FBU A;  3E0K A;  1QF8 A;  4KVX A;  3G3S A;  3CCL Z;  5LRJ A;  1DTD A;  3FQM A;  1ZG7 A;  2R7Z I;  5F46 A;  3B35 A;  4DNC A;  3KI9 A;  4NH1 C;  3J81 f;  3KR4 A;  2Z3K A;  1M1D A;  4RS2 A;  1VQ7 1;  1LCP A;  3CCE 1;  4R6T A;  4DJL A;  1YI2 Z;  2EWB A;  2CY2 A;  4RI1 A;  4MFZ A;  1SQH A;  1IGB A;  1YLE A;  2GTI A;  3PZJ A;  1TF9 A;  4Y52 I;  5A2Q b;  3HLP A;  4FUU A;  1YSJ A;  3DR8 A;  3CMA Z;  3KQX A;  2V8G A;  4NJQ A;  3GTM I;  1M90 2;  3V7Z A;  4B5P A;  3U50 C;  5CBM A;  4CYP A;  4XPD C;  4G1P A;  2OR4 A;  2WB1 A;  2E2I I;  2QLV B;  1YK3 A;  5JM6 A;  3G6E 1;  2OZK A;  4B13 A;  3HUV A;  1KC8 1;  4LQG A;  4S1T A;  3VB9 A;  3RAM A;  1USP B;  3I56 Z;  1FDI A;  2AKL A;  2VQY A;  1CP6 A;  2KPI A;  1LFW A;  2C6C A;  4MI4 A;  1S5K A;  1PUA A;  3B8G A;  1LRZ A;  1M44 A;  2EK8 A;  3FX6 A;  1OBR A;  2PC1 A;  3GTQ I;  4PXC A;  2FIA A;  2ZEO A;  1Z4E A;  2VUM I;  1M90 1;  4A33 A;  3WR7 A;  1AA6 A;  3I3G A;  2J8M A;  4HNX B;  2ZEE A;  1S7L A;  4BXX I;  2RT9 A;  4JLY A;  3S6G A;  2PCU A;  1IU8 A;  3TCV A;  1KQS Z;  2JEV A;  2GLF A;  2RB7 A;  3GTL I;  1IYK A;  4NSQ A;  1YME A;  3NH4 A;  1TFI A;  3J80 b;  4P6Y A;  4NGM A;  3IGR A;  1Q2Y A;  1S7M A;  1Y1V S;  4MCP A;  4ZGY B;  1QXF A;  1RO5 A;  3QAY A;  3CC2 1;  1K73 2;  1HEE A;  4MHY A;  2POK A;  4MHZ A;  1RXT A;  1Z4R A; 
#chains in the Genus database with same CATH homology
 3KIF A;  2OTJ Z;  2PJA A;  2JBJ A;  4NBA A;  2F8H A;  3RBU A;  1YW4 A;  2JA6 I;  3PEI A;  3CME Z;  3CCS 1;  1VQ5 1;  2WYR A;  4P4J A;  1QYP A;  1VQL 1;  3SI2 A;  4TNU A;  3WC6 A;  4RVH A;  3P5J B;  4E2Y A;  3KHX A;  3FED A;  3LWU A;  1LAP A;  3CCJ 1;  3CPW Z;  4A93 I;  4E2W A;  2QKD A;  1HDU A;  1PCA A;  4RVF A;  3D68 A;  2PK7 A;  4MXU A;  1VQ8 Z;  1Z8L A;  2B63 I;  4NBE A;  3BG0 B;  1ELL P;  1ZLH A;  2ANP A;  3S16 I;  3KHZ A;  4NB9 A;  4JYW A;  5K8N A;  3LMS A;  2LFU A;  4QTT A;  2PJB A;  2PVV A;  1K83 I;  3B3V A;  2W04 A;  3PRT A;  3PB8 X;  2O4H A;  3MON A;  3S17 I;  3BI1 A;  3NDI A;  5D1O A;  3S1M I;  3D4U A;  1YIJ Z;  3CME 1;  4A3C I;  4E31 A;  2AFW A;  1NJI 1;  5C4X I;  1R9T I;  3HOZ I;  2IMO A;  4PXE A;  3G71 1;  1VGY A;  5LYI A;  5J1Q A;  2RBL A;  4NBG A;  4A3E I;  2OTL Z;  3BG1 B;  3NFZ A;  3Q87 A;  3I4N I;  5D29 A;  4E2X A;  4MD9 A;  2JBK A;  1Y0R A;  5IT9 f;  4BBS I;  2JMO A;  3OW2 Y;  5FLX b;  1VHO A;  3G4S 1;  4MRI A;  1LQL A;  4MD8 A;  2F4M A;  1ZB9 A;  1Z5R A;  2PJ7 A;  4IAV A;  3J80 f;  1CBX A;  5K8P A;  1VQK 1;  3GTO I;  2RHB A;  2BOA A;  4TWE A;  5IB9 A;  4A3L I;  4R76 A;  2ZEN A;  2DE7 A;  1RO4 A;  2JA7 I;  3HOX I;  1XMB A;  2V8V A;  4F9U A;  3S15 I;  3B3T A;  3GB0 A;  4EWT A;  1YIT 1;  3IIB A;  3D7G A;  3D7H A;  3B7I A;  3FEC A;  2HC9 A;  3S9L A;  3HOW I;  4NGN A;  5D1O B;  1JQG A;  4FBE A;  2P28 A;  3PFO A;  1K73 1;  1VIX A;  2ZEG A;  2G9D A;  1YJW 1;  3DLJ A;  3I1U A;  4A3G I;  1H8L A;  2ABZ A;  2IZ3 A;  1FT7 A;  3KL9 A;  1M4L A;  3KAS A;  3I56 1;  1F2O A;  4RV9 A;  1YW6 A;  2PMZ A;  1KWM A;  2CTB A;  1BAV A;  2PJ6 A;  2QA4 Z;  5F09 A;  1RQF A;  3NDJ A;  1VQO 1;  1XBU A;  1XJO A;  3B3S A;  4RS4 A;  5THW A;  2QA4 1;  2M6N A;  1Y1W I;  1QMU A;  1YIJ 1;  2WAQ A;  3G6E Z;  4A37 A;  1WW9 A;  2Q4Z A;  2F4O A;  3I55 Z;  1ZB8 A;  3PB6 X;  4UIB A;  3FKI I;  4AYB A;  4OIW A;  4MHP A;  2QR1 B;  1Q7Y 1;  1R3N A;  1NUI A;  2C1C A;  3S9N A;  4Y7N I;  3TC8 A;  1NP6 A;  1Z01 A;  1TWH I;  3ESW A;  3B3W A;  4IHM A;  4NGT A;  4PPZ A;  3HOY I;  3QWU A;  4P4E A;  2G2K A;  5HXD A;  1TF8 A;  3RZO I;  3CCR 1;  2GU2 A;  1W2B Y;  1BPM A;  2J9A A;  1I3Q I;  2PJ0 A;  2QJ8 A;  4BY7 I;  3CD6 1;  2Y0S A;  1Q81 2;  3RZA A;  1VQM Z;  3IC1 A;  3FH4 A;  1F57 A;  2Q51 A;  1S72 1;  1VQ9 Z;  1VQ7 Z;  3JAM f;  3NH8 A;  2NVQ I;  2R92 I;  2EK9 A;  4R8F A;  1L1O C;  3J81 b;  1YHQ Z;  4X6A I;  1Z2L A;  2RFH A;  3VMI A;  3M3Y I;  3D9X A;  3HOV I;  4ZX9 A;  4X2T A;  1TWG I;  4P45 A;  4EWC A;  1YJN Z;  4P4D A;  2VUG A;  1YI2 1;  5DS0 A;  4A3F I;  4OC2 A;  2RIQ A;  3L2N A;  4FAI A;  2JA5 I;  4YU9 A;  1VQ5 Z;  1PYT B;  3ISZ A;  2NYQ A;  4MON A;  3FF3 A;  1SFO I;  3BHX A;  3FVL A;  5C4J I;  4E32 A;  4KSI A;  1K8A 1;  4OID A;  4NB8 A;  2QRC B;  4K3N A;  2M48 A;  2QEX 1;  2YU9 I;  4FWU A;  2NVX I;  3S14 I;  1VQN 1;  2V8D A;  3PO2 I;  5JGF A;  1Q82 1;  3CCJ Z;  4MMO A;  2HF1 A;  5LYF A;  2ZEM A;  2E2J I;  1JJ2 Z;  2OOX B;  1Q82 2;  3PFE A;  4RVD A;  1BPN A;  5I4M A;  2ZEL A;  4ONW A;  2J6A A;  3MZL B;  4EFD A;  3GKQ A;  3WAB A;  2VL1 A;  3H8G A;  4GM5 A;  3KGQ A;  4X8I A;  1ZLI A;  3CXC Z;  1RO0 A;  2C6G A;  3KZW A;  4NBF A;  1Q7Y 2;  4YWY A;  2BO9 A;  5LYL A;  1Z02 A;  1JWH C;  1K9M 2;  4JZ0 A;  3IEH A;  2WZN A;  3MZK B;  1RNI A;  4NGP A;  1KQS Y;  4NOZ A;  2PE3 A;  1XFO A;  1Q86 1;  3F3P C;  2XEG A;  2XEF A;  5LRG A;  2GLJ A;  2ZOG A;  3IF8 A;  1Q86 2;  4WWV A;  3CCU Z;  4DK1 A;  1VQP Z;  1QVF Z;  2PJ5 A;  1RO2 A;  6CPA A;  2NSM A;  1F2P A;  4F8Z A;  1TKJ A;  3M4O I;  2CF4 A;  4RUH A;  3GLJ A;  1VQ8 1;  4RVG A;  4W9Y A;  3I4M I;  4P10 A;  2P3Y A;  2V8H A;  2R93 I;  4MH4 A;  3S9M A;  1XRY A;  1ML8 A;  2JNY A;  3N5F A;  1VQL Z;  4OC0 A;  3BI0 A;  2PJ3 A;  5HVH A;  1NJI 2;  1TKF A;  3QNV A;  4NFR A;  5FLX f;  5C3E I;  4A3I I;  3G71 Z;  3T8W A;  2O53 A;  4MHN A;  3CCE Z;  1X0T A;  3WC7 A;  2OOT A;  3CCU 1;  1VQP 1;  5K8M A;  2VF1 A;  1ZG8 A;  1ZG9 A;  2JUB A;  1YUA A;  1M1K 2;  4OC3 A;  4DGL A;  4UF4 A;  2NVY I;  3IWW A;  1X3Z A;  5D8N A;  4OME A;  2DE5 A;  4ZY1 A;  3NH5 A;  5ELY A;  4QTU A;  3CC2 Z;  4A38 A;  3H3V J;  3VH9 A;  3PO3 S;  3KQZ A;  4NGS A;  3GTP I;  1N8R 1;  4NJR A;  3D7F A;  4P4I A;  3CXC Y;  2OTJ 1;  3JRU A;  1X3W A;  2AFZ A;  4Z65 A;  5K8O A;  1VQN Z;  3K9T A;  2HB6 A;  3CPA A;  2DEA A;  5C44 I;  4ZY0 A;  3I07 A;  3CCM 1;  4HH4 A;  3SJF A;  3D7D A;  2JR6 A;  2Q43 A;  4R7M A;  4MCS A;  3VTN A;  5FLM I;  1Y0Y A;  1DE4 C;  4P44 A;  1VLA A;  1KD1 2;  3CPX A;  3SJG A;  3B2Y A;  1K9M 1;  4A3K I;  3BXM A;  3S1N I;  4OC1 A;  3CC4 Z;  2ZEF A;  1KD1 1;  4OP4 A;  2IQ6 A;  3GTJ I;  3CD6 Z;  2QVP A;  4E30 A;  2BCO A;  3D6W A;  4A39 A;  4P4F A;  5JH9 A;  3IFE A;  2IJZ A;  3SJE A;  4PXB A;  1VQ6 1;  3T4N B;  2JA8 I;  1KRL A;  3VMG A;  3IJ3 A;  1VQ9 1;  1QF8 A;  4MD7 A;  1RLY A;  2IZ4 A;  1RTQ A;  3MRU A;  4OC4 A;  3PBE A;  4H2K A;  1YUK A;  3GTM S;  3EED A;  3D66 A;  3CQZ I;  3SJX A;  2ZAE B;  5A2Q f;  4NBH A;  1CPX A;  3CCL Z;  5LRJ A;  1DTD A;  3FQM A;  3ISX A;  3CC7 1;  1YJN 1;  1QVF Y;  2R7Z I;  1ZG7 A;  2JEW A;  2AFX A;  5CPA A;  1LAN A;  3B35 A;  3OW2 Z;  1VHE A;  2PJ8 A;  3FMC A;  4OKO A;  5T67 A;  1CPS A;  3KI9 A;  4HGY A;  4NH1 C;  3J81 f;  1I6H I;  1BLL E;  1Y7E A;  3KR4 A;  3H8F A;  4E2Z A;  4DYO A;  1VQ7 1;  3HOU I;  2ZEP A;  3GCF A;  2HU9 A;  1TWF I;  1UWY A;  1LCP A;  3CCE 1;  2NVT I;  3B3C A;  4R6T A;  1N8R 2;  4MCQ A;  3JAM b;  4ZI6 A;  4DJL A;  1YI2 Z;  3CCR Z;  2EWB A;  3CCV 1;  1IGB A;  3CCQ Z;  1TXR A;  4CPA A;  2GTI A;  1N2F A;  1CX8 A;  1TF9 A;  5T64 A;  1S72 Z;  5AN9 F;  2V77 A;  3KR5 A;  1YIT Z;  3CMA 1;  4BY1 I;  2QRE B;  4Y52 I;  1EE3 P;  2ZED A;  4PQA A;  5A2Q b;  4E33 A;  3WT4 A;  1Y1V I;  3HLP A;  2XEI A;  4FUU A;  3GUX A;  2E2H I;  3GTG I;  1YSJ A;  4BBR I;  3CMA Z;  3KQX A;  4AXV A;  3SI0 A;  2V8G A;  1YJ9 1;  4NGR A;  2C6P A;  5IP9 I;  2ZEH A;  4NJQ A;  4EME A;  3GTM I;  1M90 2;  3V7Z A;  1TWC I;  3D67 A;  2V8I A;  3K2K A;  4PXD A;  3WC5 A;  3U50 C;  3CCQ 1;  5CBM A;  4XX2 A;  1HDQ A;  1I50 I;  4G1P A;  2E9H A;  1ARL A;  3H0G I;  2OR4 A;  2WB1 A;  2YAD A;  4X3R A;  2E2I I;  1Z03 A;  3LUS A;  8CPA A;  2QLV B;  2GRE A;  1ZH1 A;  5JM6 A;  3G6E 1;  2OZK A;  2XEJ A;  3H8E A;  3HUV A;  1KC8 1;  3PBB A;  2PJC A;  2K3R A;  1VQ4 Z;  3F3F C;  3HKZ A;  1R43 A;  4A94 A;  2R6M A;  1LOK A;  3PB9 X;  4LQG A;  4S1T A;  2KI7 B;  3VB9 A;  2PVW A;  2ZOF A;  2PIZ A;  3RAM A;  5HVF A;  4DUK A;  1USP B;  1TWA I;  4A3M I;  3I56 Z;  1JJ2 Y;  3DGV A;  1VQK Z;  1DL6 A;  3CCL 1;  2AKL A;  1WCM I;  3VAR A;  2EGT A;  2LIY A;  1CP6 A;  5LL6 f;  4WJB A;  2KPI A;  1LFW A;  1ELM P;  2FVG A;  3I55 1;  4ZYQ A;  2C6C A;  2PIY A;  4O23 A;  3CCM Z;  1YJW Z;  3MN8 A;  2V8J A;  3J7A 4;  2PJ4 A;  3TE5 B;  3S2H I;  2AFM A;  2BJO A;  3SI1 A;  1VQ4 1;  2PM9 A;  4ZY2 A;  2EK8 A;  4NBB A;  3FX6 A;  2AFO A;  5LRK A;  1LAM A;  2DE6 A;  3CCV Z;  1OBR A;  3K7A I;  1YJ9 Z;  1W2B Z;  3GTQ I;  3G4S Z;  4A3B I;  4A3J I;  3S1R I;  4PXC A;  3PB7 X;  1K8A 2;  3CC4 1;  3VMH A;  1Q81 1;  1CP7 A;  5IP7 I;  3IX0 A;  3FQQ A;  5CM2 M;  4BD9 A;  3PO3 I;  2OTL 1;  2CTC A;  2ZEO A;  1USP A;  2VUM I;  1YLO A;  4IK2 A;  4OC5 A;  1M90 1;  1P9N A;  1ARM A;  3CT9 A;  2W03 A;  2OOY B;  1Q7L A;  3FEE A;  1WII A;  1VQ6 Z;  4MCR A;  4CL1 A;  1CG2 A;  2ZEE A;  4HGZ A;  4BXX I;  2AFS A;  2RT9 A;  2JS4 A;  5LYD A;  5T6B A;  3GTK I;  3RZD I;  2PCU A;  2RPR A;  4UIA A;  2V8K A;  4B6Z A;  3CC7 Z;  3CDX A;  4NBC A;  1KQS Z;  2K5R A;  2GLF A;  2H85 A;  1TKH A;  2RB7 A;  3S1Q I;  4UEF A;  7CPA A;  3GTL I;  2AFU A;  1YHQ 1;  1AMP A;  2F7V A;  4A3D I;  3TX8 A;  3PB4 X;  4DQY B;  1M1K 1;  1PFT A;  1VQO Z;  1YME A;  1KC8 2;  3NH4 A;  2PRQ A;  1TFI A;  1GYT A;  1QVG Y;  4NBD A;  1IY7 A;  3VAT A;  4F9V A;  1VQM 1;  5HVG A;  3CCS Z;  3NA6 A;  1QQ9 A;  3KIH A;  3EER A;  3J80 b;  4P6Y A;  4UEZ A;  2PJ1 A;  5D1P A;  4NGM A;  2CIJ A;  4ZX8 A;  3FJU A;  1S7M A;  1Y1V S;  2QRD B;  2QEX Z;  1NSA A;  3V38 A;  3IFU A;  4MCP A;  1QVG Z;  3CPW Y;  2PJ9 A;  4UEE A;  4NGQ A;  3IO1 A;  1FNO A;  3CC2 1;  1K73 2;  1HEE A;  3S2D I;  4MHY A;  2POK A;  2PJ2 A;  4P4B A;  1AYE A;  4MHZ A;  2QYV A;  5IT9 b;  4Q7A A;  2I3C A;  3TDH B;  2GTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...