4MXUA

Human brain aspartoacylase mutant k213e complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
b'HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGEEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 95
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mxuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mxuA01
4MCQA 5ELYA 3PB6X 4OMEA 2PJ2A 3D7FA 3H8FA 3FEEA 3SI1A 4MMOA 1PYTB 3FH4A 1YMEA 1YW4A 2PJ3A 2V8GA 4WJBA 2ZEOA 1VHOA 3V7ZA 1UWYA 2GREA 4DJLA 4YWYA 3KASA 4IAVA 4PQAA 1F2PA 5LRJA 2G9DA 4FBEA 3LMSA 1NSAA 2AFZA 1AYEA 2QVPA 2V8VA 3TX8A 1LFWA 3IO1A 4JYWA 2QYVA 3B3VA 3CPXA 2ZEHA 3K9TA 3S9MA 3CT9A 3FMCA 1Y7EA 3B35A 1EE3P 2NYQA 3GUXA 3FJUA 4P6YA 1CPXA 4P4IA 4MHYA 3PB9X 1TKJA 2PJ7A 1JQGA 1ZLIA 4MCSA 1LAPA 4LQGA 3GLJA 3PEIA 4F9UA 2Q51A 4R8FA 2O53A 4X3RA 2V77A 1OBRA 1DE4C 2EK9A 5K8MA 3DGVA 4F8ZA 3CDXA 1ELMP 4OC0A 2PIYA 4ZY1A 4W9YA 1LAMA 3WABA 3IFEA 4A94A 1HDUA 1CG2A 2XEIA 1YW6A 3FX6A 3SJFA 2JEWA 4GM5A 3HUVA 2OR4A 4K3NA 1BPNA 4OC3A 5J1QA 3IIBA 4FAIA 3BHXA 2CTBA 4P4FA 2EWBA 2BO9A 2CF4A 4UEZA 2PJ6A 2O4HA 3PB4X 4TNUA 4NJQA 2WYRA 3V38A 3RBUA 2PJ8A 3N5FA 1LANA 3GB0A 1RTQA 2ZENA 4R6TA 2EK8A 1CX8A 1KWMA 1PCAA 5I4MA 3MN8A 3MRUA 4DUKA 3PFEA 4OIDA 2PJBA 5DS0A 2J9AA 2PJ4A 1YSJA 2PRQA 2ZEMA 4R76A 1XBUA 4H2KA 1ZG8A 5K8NA 3KZWA 2AFSA 4ZY0A 2PCUA 2POKA 1HEEA 4UIBA 2WZNA 5K8OA 4MCRA 3KGQA 4KSIA 3I1UA 2F8HA 4ZYQA 5K8PA 4NJRA 4FWUA 2FVGA 2C6PA 2BOAA 3D67A 3D4UA 3B7IA 3H8GA 1XJOA 2IJZA 4R7MA 4B6ZA 5D29A 2AFOA 1BAVA 3D7DA 3FF3A 3KQZA 3LWUA 4P10A 2PJ0A 2ZEDA 5HXDA 5LRKA 4PXDA 4BD9A 4NFRA 3BI1A 2CIJA 4IHMA 2ABZA 4A37A 5CPAA 4MRIA 4MCPA 2XEJA 5HVHA 1XRYA 2ANPA 3PBBA 1F57A 4UEEA 2C6GA 2ZEFA 2HC9A 3JRUA 2V8DA 3D7HA 3PBEA 1ZLHA 1ZG7A 4P4EA 1CPSA 2AFMA 4P44A 1IY7A 4OC5A 2V8HA 3IJ3A 4F9VA 2PIZA 3HLPA 1ARLA 1GYTA 4NGQA 3FECA 4MHPA 5LYIA 3BI0A 1TF8A 4P45A 4P4JA 4X8IA 2XEFA 1QQ9A 2GLJA 4DYOA 5IB9A 3S9LA 1FT7A 5LYDA 1Z2LA 3ISZA 1QMUA 3NH4A 4A39A 2ZEGA 2OOTA 1Z5RA 4CPAA 4ZI6A 4NGPA 1VIXA 3KQXA 4OKOA 3IWWA 4ZX9A 2RFHA 2XEGA 5HVGA 2GLFA 2ZOGA 2AFUA 2HB6A 2GU2A 3B3WA 1CP6A 1FNOA 2PVVA 3B2YA 4O23A 2IMOA 3B3TA 2AFWA 3L2NA 4EFDA 1Y0YA 4UIAA 4ZY2A 3KHZA 1Z8LA 4OIWA 3H8EA 3T8WA 3CPAA 1VHEA 2QJ8A 2PJ5A 3ISXA 3D7GA 1ZG9A 3DLJA 3RAMA 2ZEPA 3S9NA 3D68A 3WC6A 5JM6A 4PXCA 3B3SA 1TKFA 4EMEA 3FVLA 3K2KA 4UEFA 3KL9A 3NH5A 3SI0A 1LOKA 3KR4A 4PPZA 3FEDA 2DEAA 4OC2A 3SJGA 8CPAA 1ELLP 5THWA 3SJXA 5JH9A 1DTDA 2NSMA 4PXEA 4WWVA 2AFXA 1CBXA 1ARMA 1AMPA 5F09A 1Y0RA 1BLLE 4OC1A 4OC4A 3SJEA 4MXUA 1IGBA 2ZOFA 4EWTA 1XMBA 5LYFA 1R3NA 2CTCA 1TXRA 1XFOA 4OP4A 3WC5A 1CP7A 4PXBA 3SI2A 4Z65A 4NGMA 2JBKA 3D66A 3WC7A 3PFOA 3KI9A 4UF4A 4IK2A 2Q43A 2PJ9A 4RUHA 1R43A 2PJAA 1F2OA 3IC1A 3NFZA 1Q7LA 2ZEEA 2ZELA 4JZ0A 3NH8A 5D8NA 4AXVA 1TF9A 3PB7X 2C1CA 3WT4A 3QNVA 3B3CA 3IEHA 1YLOA 2Q4ZA 1H8LA 4NGNA 2PJ1A 2C6CA 4MHZA 3TC8A 1LCPA 2PJCA 5LRGA 1M4LA 1TKHA 6CPAA 2I3CA 2F7VA 4G1PA 2BCOA 5HVFA 5CBMA 2JBJA 3KHXA 4Q7AA 5LYLA 4MHNA 2IQ6A 3BXMA 2VL1A 1HDQA 3PRTA 4FUUA 4ZX8A 5JGFA 4NGRA 1BPMA 3NA6A 2RB7A 3KR5A 2PE3A 4NGSA 1VGYA 3VARA 4TWEA 4A38A 4ONWA 4P4DA 2PVWA 3RZAA 3VH9A 3PB8X 3VATA 7CPAA 4P4BA 4X2TA 4YU9A 4NGTA
chains in the Genus database with same CATH superfamily
4MCQA 3E0KA 3WR7A 1ZO0A 1R9TI 4CS0B 2EO8A 3I55Z 2CXAA 3FH4A 5JQ4A 4DK1A 1YW4A 4WJBA 1VHOA 3V7ZA 1UWYA 2ZAEB 4IAVA 2F5IA 1F2PA 1I3QI 2Q4YA 4HGZA 3EXNA 3D8PA 2QVPA 3LD2A 5CNPA 1LFWA 3IO1A 1CM0A 2WAQA 4Q36A 2EVNA 4JYWA 2QYVA 2YNCA 2F4OA 3K9TA 3S9MA 4RS2A 1UFHA 1Y7RA 1YJ91 2NYQA 3GIUA 4XPDB 3GUXA 4P6YA 5LL6f 3K9UA 4MHYA 2P6EA 1TKJA 2P0WA 3U50C 1JQGA 2FXFA 4F9UA 3BJ8A 2NVXI 4R8FA 2O53A 4X3RA 3TE4A 2GANA 4RN7A 4R9MA 3DGVA 4F8ZA 4OC0A 1K9M1 4KVME 2G2KA 2YGWA 2WSAA 4B13A 1XF8A 4RVFA 2PM9A 4A94A 1S7FA 2NAPA 1X10A 1YW6A 2PDOA 4K3NA 5F48A 3D2PA 3R95A 4MJ8A 3IIBA 1NUIA 1Y9WA 2OTJ1 4BY1I 4P4FA 5FLXf 2J8NA 1Z02A 3FB3A 3CMAZ 2O4HA 3PB4X 4XPDC 4TNUA 3DR6A 2WYRA 1VQNZ 3N5FA 4NBGA 3GB0A 1TWCI 3H0GI 1VQ8Z 4NBHA 5T6BA 2ZENA 2R98A 3R9FA 5I4MA 3MN8A 3MRUA 4DUKA 3PFEA 4ZGYB 2J8MA 2QMLA 5AG5A 3CD6Z 3CC41 3CC7Z 4HNWB 2IL4A 2Z3LA 3HKZA 1S60A 2PRQA 2ZEMA 2FE7A 2G0BA 1YITZ 4LQ6A 3CCVZ 1YI21 4KZTA 5T64A 2POKA 1HEEA 3I9SA 1ML8A 1YVOA 2RBLA 4CYPA 3KGQA 4XPKA 4F6AA 2BEIA 3GCFA 4ZYQA 4MBUA 2C6PA 3QAYA 3B7IA 3H8GA 3GKRA 1TWAI 1VQ4Z 4NBAA 3D7DA 4HGYA 1K9M2 2R1IA 4BD9A 4GXHA 2JA7I 3BI1A 4KUAA 1QVFZ 3W91A 3JAMf 1M1K1 4MCPA 3CPWZ 4OAEA 2Z3NA 2P3YA 2ANPA 3PBBA 4UEEA 4QUSA 2DPSA 3D7HA 3PBEA 2JLMA 1FY7A 2CNTA 1WW9A 3IJ3A 3R9GA 3NDJA 4F9VA 2PIZA 1ARLA 2KI7B 1GYTA 5KTCA 3FQMA 3TOAA 5LYIA 4CYNA 4Y7NI 4NH1C 4P4JA 4MI4A 2VPWA 1FT7A 5AGEA 1YJ9Z 3JTKA 5LYDA 3ISZA 3S1NI 1P4NA 4IUSA 1Q2YA 2OOTA 4MH4A 3RO0A 3DNSA 3IU1A 5D1OB 4CPAA 2ZW5A 1P9NA 3F8KA 3KQXA 3IWWA 2RFHA 5HVGA 2OOXB 4M6HA 2HB6A 2AYDA 1RQFA 4UFXA 2AFWA 3TT2A 3L2NA 4UIAA 1M4GA 3D2LA 4UA3A 3T8WA 2R6MA 4B5PA 3DLJA 2ZEPA 3WC6A 1RNIA 2IV2X 3GTLI 5GCNA 3S14I 1MJ9A 3HOWI 4RV9A 2DEAA 4R57A 4B11A 4KORA 5JH9A 4CGOA 2ODFA 1QSOA 1YK3A 1X3WA 1SQHA 4UWIA 1BLLE 4PSWA 4MXUA 4L8AA 1IGBA 2ZOFA 3PO2I 4KUBA 5AG7A 1M1K2 4CGPA 1B87A 5LYFA 1R3NA 5C3EI 3S6KA 1KQSY 1CP7A 3SI2A 4Z65A 3WC7A 1YI2Z 3KI9A 1V0CA 4UF4A 5T67A 1QVGZ 3IFUA 2Q43A 3F0AA 5IT9f 2PJ9A 3CCM1 2D4OA 1R43A 2Z0ZA 1F2OA 3IC1A 3GTPI 4M85A 4H6ZA 5J8FA 4NBEA 4QB9A 1Q821 4KOXA 2C1CA 3WT4A 5EC4A 2GE3A 3S2HI 2JMOA 2Q4ZA 3VB9A 4MFZA 3TC8A 2BUEA 4R3LA 3I551 2P6GA 4J3GA 1LQLA 4DNCA 2K5RA 1RO0A 3TTHA 2HV2A 2ZW6A 3KHXA 4KVXA 2IQ6A 2VL1A 4CGMA 4FUUA 1NP6A 3B8GA 1USPB 3CCLZ 3FIXA 1VGYA 4UWJA 3SXOA 2P28A 4A38A 4ONWA 2W04A 3CQZI 5C82A 4NB8A 2ARHA 1YQEA 7CPAA 1VQ6Z 4LX9A 5ELYA 3PB6X 4OMEA 4DQYB 2B58A 3SI1A 4MMOA 5HH1A 4MFLA 4B12A 3EEDA 4QTUA 4DJLA 4YWYA 2EUIA 4PQAA 1Q812 5F46A 4FBEA 3LMSA 2AFZA 2QRCB 1ZH1A 1AYEA 2V8VA 1SIWA 1PU9A 4A32A 2JA8I 3SXNA 1YJWZ 2ZEHA 3UY5A 5F47A 3CT9A 4E0AA 4A31A 1Y7EA 1EE3P 2QA41 1NSLA 3CMA1 2JS4A 4AVCA 1Q822 2JNYA 3IR7A 4XPLA 1WWZA 3PB9X 4KLWA 4YRHA 3R1KA 2PJ7A 1VQN1 1S72Z 1IOFA 3GLJA 5A28A 3PEIA 1VQ81 2C27A 4KSAA 2KPIA 5C44I 4A3CI 3GYAA 1QXFA 2V77A 2F4MA 4MONA 2JEVA 3EFAA 4UBRA 1FDIA 5G1ZA 3G3SA 1ELMP 3CD61 3EO4A 3CC71 3J81f 3PO3I 3IFEA 4HNXB 4KS9A 1YIT1 3CCV1 3FX6A 3SJFA 4GM5A 5IB0A 2GTHA 3CMEZ 2OR4A 1KC81 3TO7A 4BXXI 4OC3A 1M4DA 5J1QA 2REFA 1GHEA 4FAIA 3BHXA 3P2FA 2CTBA 1Y1VS 3M4OI 1KUYA 2BO9A 3QB8A 4FD6A 3CCMZ 4EVYA 3RBUA 4F0XA 4MD8A 3JUWA 4K30A 4R6TA 1J4JA 2EK8A 1VQ41 1CX8A 2E2II 4OLLA 4UFVA 3BG0B 2R7ZI 2PR8A 1U6MA 3T90A 5BWAB 1YSJA 5H84A 4JWPA 2B63I 4R76A 1KUVA 1ZG8A 4H2KA 3N7ZA 4MHDA 5K8NA 2Q44A 4A93I 1NMTA 4U9ZA 5FLXb 4UIBA 2WZNA 2J6AA 1I12A 5K8OA 4MY3A 4MCRA 2BL1A 2FIAA 1I1DA 5K8PA 4NJRA 1QYPA 1NJI1 3OW2Z 1QVFY 1PUAA 2FL4A 1XJOA 3CPWY 4B6ZA 1WZNA 4H89A 4C7HA 3LWUA 2Q4VA 4A3KI 4P10A 2PJ0A 3DR8A 2ZEDA 5HXDA 4ZBGA 4CRYB 5LRKA 2PRBA 4PXDA 1X12A 4IHMA 2IZ4A 2ABZA 3J80b 2XEJA 1KC82 4JXQA 2M6NA 2Z11A 1ZB8A 1ZG7A 4P4EA 2REEA 1IY7A 3HLPA 2RT9A 3FECA 3CCQZ 3VMGA 4U5YA 4P45A 3CXSA 1VHSA 2OH1A 2GLJA 4DYOA 2QA4Z 3CXCZ 3ZJ0A 3EC4A 3H4QA 1Z01A 4ZI6A 3KIFA 1Z4EA 4GS4A 1VIXA 3JAMb 4OKOA 2XEGA 2ZOGA 1CP6A 5IP7I 3S16I 4AB7A 2VPYA 1Y0YA 4MFKA 1XMTA 1L1OC 4NB9A 4OIWA 1QSRA 4Y52I 4RVDA 2VEZA 1VHEA 2QJ8A 4H6UA 3BG1B 3ISXA 3RAMA 3S9NA 4KOVA 2WPWA 3B3SA 1NJI2 2DXQA 3FVLA 4EMEA 3J80f 4ONUA 3SI0A 1LOKA 3KR4A 3FEDA 3SJGA 8CPAA 2Z3OA 4AVBA 3SJXA 2NSMA 4NCZA 4KOYA 5AG4A 2AFXA 1QVGY 1CBXA 5D1OA 1DL6A 5F09A 1IB1E 4JXRA 4MD9A 3D2MA 3S1QI 2QRDB 1TXRA 3G6EZ 4BBSI 3GY9A 1YGHA 2JBKA 1VQOZ 4E2WA 1BOBA 3CCL1 4XX2A 2PJAA 5C88A 1Q7LA 1WK4A 2ZELA 4CAVA 1TWGI 3S6HA 4YGOA 3QNVA 3B3CA 3IEHA 3F3FC 3F3PC 1S3ZA 4C2ZA 3S2DI 1VQ61 3CCUZ 3D9XA 4NGNA 3LODA 2PJ1A 2C6CA 4UFWA 1KD11 1TKHA 1YLEA 3CC21 6CPAA 2I3CA 2Q7SA 2Y0MA 4A95A 4FD7A 2F7VA 1N8R1 4CAFA 3HOXI 2OOYB 4MY0A 5IT9b 5EMIA 3FKII 2Z3KA 4MHNA 3BXMA 4HNYB 3FXTA 1SFOI 3IX0A 4ZX8A 2R92I 4NGRA 1BPMA 3FRMA 3NA6A 1YJW1 2CNMA 2PE3A 2E2HI 2PVWA 1YJN1 2VZYA 3PB8X 1S7NA 4P4BA 4KOWA 4NGTA 3TCVA 2BSWA 5IP9I 1S721 2B4BA 3DDDA 2GIVA 2M48A 1PYTB 1YMEA 3S1RI 2PJ3A 2V8GA 4KSFA 3FQQA 4CYOA 4A3BI 1VQ91 4A3II 3KASA 5A2Qf 3LUSA 2G9DA 1A2ZA 2ATRA 3DSBA 4QVTA 4CGNA 2QIRA 3TX8A 3CCEZ 3CME1 2VPZA 1Z03A 2OZKA 1Z9UA 3B3VA 3CPXA 3PZJA 2Z10A 1RO2A 1Z8XA 1VQ51 3H3VJ 2OZHA 2H85A 3I4MI 3FJUA 1CPXA 1Q861 4P4IA 2ZPAA 1RO5A 3CCJZ 1W2BZ 1ZLIA 4UCPA 1LAPA 2ZW7A 4LQGA 3NE8A 4C7IA 4C68A 1KD12 1DE4C 2EK9A 4A3EI 3G4S1 5K8MA 4CRZB 2WB1A 3CDXA 4E30A 1N8R2 2G3AA 4ZY1A 1Y9KA 4W9YA 1LAMA 1N71A 3VMIA 4E2AA 2VZZA 2JEWA 1OZPA 4KVOE 1BPNA 3FBUA 5IX3A 3P2HA 1XEBA 2EWBA 2AKLA 4JD6A 3IWEA 2OU2A 4UEZA 5G21A 2PJ6A 1L0CA 2ZXVA 3Q87A 1LANA 2V45A 3CXPA 1RTQA 2LEXA 1R57A 1KWMA 1PCAA 3J81b 3CCRZ 3ZZIA 2PSWA 3S17I 1MJBA 2PJBA 2CNSA 2DE6A 3CC2Z 2YADA 2PJ4A 4EWCA 1XBUA 1YVKA 4A3DI 3OW2Y 3KZWA 1VQLZ 3A9LA 2PCUA 3D3SA 3GTKI 2V8IA 3SHPA 2R93I 3CCQ1 4FWUA 1Q862 5EBVA 2EGTA 2BOAA 3GKQA 4E8OA 5HMNA 3D4UA 3HOZI 1YJNZ 3HOYI 2JIQA 1Z8WA 5H86A 2AFOA 1BAVA 4NOZA 2WPXA 1M4IA 1S7KA 3MONA 2DE7A 1IIDA 2Q0YA 2PQ8A 1QSMA 4A3JI 4NFRA 2DF5A 3OWCA 1XE4A 2CIJA 1TWFI 3CZXA 4A37A 4MRIA 3FYNA 3F5BA 1VQ9Z 3CXCY 1CJWA 4E33A 1RXTA 2C6GA 2HC9A 2B4DB 5FVJA 4NF1A 2IZ3A 1ZLHA 5DWMA 5F49A 2NMTA 3S6GA 2AFMA 4RS4A 5KTDA 1VQ5Z 2XEFA 1VLAA 4L89A 4X8IA 5I0CA 1YUAA 3S9LA 4RI1A 3PO3S 1KUXA 1Z2LA 2V8KA 1QMUA 3GTJI 1AA6A 4A39A 4NEXA 1K731 3VWDA 3PP9A 2PR1A 1TWHI 3GTMI 4DGLA 2GLFA 4CAEA 2AFUA 1QSTA 5FLMI 3CCSZ 2PVVA 3B2YA 3G4SZ 4O23A 2IMOA 3B3TA 4II9A 2B3UA 3ESWA 1FDOA 3HOVI 2B5GB 4ZY2A 4MFQA 2VUMI 3G6E1 3MZKB 3KHZA 3I07A 2QREB 3H8EA 1VQO1 4HPSA 4E2YA 3D7GA 1ZG9A 4YFJA 3D68A 4PXCA 1LRZA 2A4NA 3K2KA 3KL9A 4M3SA 3R96A 2QEX1 1S7LA 4X5KA 4PPZA 2J8RA 3VTNA 1ELLP 3CCU1 5THWA 2JR6A 1DTDA 1TFIA 4KOTA 3G71Z 1IYLA 4PK3A 4NBDA 2VUGA 2FT0A 2JUBA 3S1MI 1VKCA 1AMPA 5DWNA 1BO4A 1VQ71 4OC1A 3SJEA 2HUZA 4EWTA 2CTCA 3LACA 1XFOA 4OP4A 3WC5A 4R3KA 4PXBA 4AG7A 1Q7Y1 4C2YA 2P6FA 3TOBA 4CAWA 1PFTA 3GTOI 4JJXA 2NVQI 3FNCA 3NFZA 2ZEEA 5D8NA 4AXVA 1TF9A 1YR0A 4A33A 2LFUA 1YLOA 4QC6A 2KCWA 1P0HA 5KTAA 1Q2DA 3KIHA 4Y49B 4MHZA 1MK4A 1Y1WI 1K732 1VQKZ 1LCPA 1VQP1 3NDIA 2V8JA 2OTLZ 4G1PA 4HKFA 2BCOA 2JBJA 2OZUA 1VQMZ 1JJ2Z 4CGLA 1K4JA 1WCMI 1KRLA 3PRTA 3CCE1 5JGFA 2VI7A 1RLYA 2RB7A 3VARA 3I561 1I21A 2AJ6A 2LIYA 1ON0A 4BBRI 4KOSA 3VH9A 4YU9A 2JIRA 1M1DA 3CCJ1 4AVAA 1JWQA 2PJ2A 3KKWA 3D7FA 3W6SA 4Y49C 2YNEA 3C26A 3H8FA 3FEEA 1Z4RA 4B10A 4UCNA 2ZEOA 4NBFA 4A3FI 2GREA 2VQYA 3V8IA 1IYKA 5LRJA 4HH4A 1NSAA 3IF8A 3TO6A 1W2BY 2YNCC 4UCMA 4NBCA 1KZFA 1Q7Y2 4A2ZA 3RZOI 3FMCA 5ISVA 3B35A 3QWUA 2QR1B 2PMZA 2FCKA 2G3TA 2R8VA 3JVNA 3RYOA 3S15I 2VXKA 4MCSA 1M44A 2QEXZ 2Q51A 1YIJ1 2R7HA 1OBRA 2E2JI 5A2Qb 4NSQA 3CCR1 3T9YA 3I4NI 2RIQA 2PIYA 4I49A 3MGDA 2PC1A 4A30A 3G8WA 2JIMA 3WABA 2HQYA 1N2FA 1HDUA 1CG2A 1VQ7Z 2XEIA 1I50I 4CAXA 1VQL1 3HUVA 1TIQA 5IV0A 4A3GI 4S1TA 2OZGA 5J8CA 2YNDA 4E2ZA 2CF4A 1JWHC 4BMHA 3BJ7A 4NJQA 3V38A 3MZLB 2PJ8A 1X0TA 3EY5A 4F0YA 5A27A 2Z3MA 2E9HA 2CY2A 3CXQA 3T4NB 5C4JI 5AN9F 1NE9A 1YHQ1 2JA6I 4OIDA 5DS0A 2J9AA 4E32A 4MD7A 3IGRA 1Q2CA 1VQPZ 3M3YI 4AYBA 4BY7I 2X7BA 2DPTA 2QECA 2AFSA 2V3VA 4ZY0A 3VWEA 3TE5B 2OTJZ 4A3MI 4PV6A 4CYQA 4KSIA 5G22A 1S7MA 1K8A1 3I1UA 3IWGA 2F8HA 2GFQA 2QKDA 2FS5A 2FVGA 3R9EA 4LUAA 3P5JB 3I56Z 4NBBA 3D67A 1YX0A 5CM2M 1M901 2AE6A 4C2XA 1USPA 2IJZA 4R7MA 4QBJA 1AUGA 1RO4A 2RC4A 5D29A 3FF3A 3KQZA 1XOVA 4B5OA 1Q811 2FSRA 2JDCA 3W6XA 3CC4Z 1IOIA 3CCS1 3I3GA 2JA5I 5CPAA 1B6BA 5HVHA 3GTQI 1WIIA 5AG6A 1XRYA 1F57A 2ZEFA 2YU9I 3JRUA 2V8DA 4B5PB 1CPSA 2GTIA 4P44A 4OC5A 2I79A 2V8HA 3RZDI 4RVHA 1YREA 2PK7A 4NGQA 4XNHB 2JDDA 4MHPA 4RVGA 3BI0A 4R87A 1TF8A 4OADA 1WJ2A 1IICA 1QQ9A 5IB9A 4M6GA 4CL1A 5C4XI 3NH4A 1Y8CA 2ZEGA 2Q7BA 3RNZA 1MJAA 4Q38A 1Z5RA 4A3LI 3G711 2OB0A 4NGPA 4ZX9A 3VMHA 4U9YA 1YIJZ 2GU2A 3B3WA 1FNOA 2I00A 3TO9A 1XIXA 4PSXA 2B3VA 3TFYA 4EFDA 1Z8LA 2RHBA 3K7AI 3PGPA 4FD5A 1S5KA 3CPAA 2PJ5A 4ORFA 4NXYA 2B4DA 2JIPA 1K8A2 2ZW4A 5JM6A 2D4PA 1TKFA 4XNHC 4UEFA 3NH5A 1M902 4M6IA 4OC2A 2Y0SA 4PK2A 5D1PA 4QTTA 4MFJA 1YUKA 2HF1A 4B14A 2JIOA 4PXEA 1QF8A 1VQK1 2RPRA 4IF5A 4WWVA 2Q04A 4KOUA 1ARMA 4KLVA 1ZB9A 1Y0RA 2OTL1 3HOUI 1YHQZ 3J7A4 4OC4A 2NVTI 2O28A 1XMBA 3EERA 1VQM1 3TDHB 2VBQA 2WUUA 2VF1A 4BBHA 3QAHA 4NGMA 3D66A 2B5GA 3PFOA 2H5MA 5G20A 4IK2A 4RUHA 1K83I 5JPHA 4JZ0A 1IU8A 3S6FA 3NH8A 3H5ZA 3PB7X 2HU9A 3D6WA 1KQSZ 1Z8TA 4FD4A 1H8LA 1JJ2Y 3BLNA 1QSNA 2K3RA 4JLYA 1X3ZA 3IU2A 1Y1VI 2PJCA 5LRGA 1M4LA 2DE5A 5E96A 1I6HI 1Q16A 2FIWA 2Z3PA 2EBJA 5HVFA 5CBMA 4E31A 4X6AI 4Q7AA 4AG9A 5LYLA 2VPXA 3NE7A 2E7ZA 1HDQA 2BJOA 3KR5A 4NGSA 4TWEA 2K5TA 4P4DA 3GTMS 3RZAA 4BINA 4E2XA 4MFPA 3VATA 2W03A 2QLVB 4X2TA 3GTGI 2NVYI
chains in the Genus database with same CATH topology
1S721 4MCQA 5ELYA 3PB6X 4OMEA 2PJ2A 3D7FA 4DQYB 1R9TI 3H8FA 3FEEA 3I55Z 3SI1A 2M48A 4MMOA 1PYTB 3FH4A 1YMEA 3S1RI 4DK1A 1YW4A 2PJ3A 2V8GA 4WJBA 2ZEOA 1VHOA 3FQQA 4NBFA 3V7ZA 3EEDA 4QTUA 1UWYA 4A3FI 1VQ91 4A3BI 4A3II 2GREA 4DJLA 4YWYA 2ZAEB 3KASA 4IAVA 5A2Qf 3LUSA 4PQAA 1Q812 1F2PA 5LRJA 1I3QI 2G9DA 4FBEA 3LMSA 4HH4A 1NSAA 2AFZA 4HGZA 3IF8A 2QRCB 1ZH1A 1AYEA 2QVPA 2V8VA 3TX8A 1LFWA 1W2BY 3IO1A 3CCEZ 2WAQA 3CME1 2JA8I 4NBCA 4JYWA 2QYVA 1Q7Y2 1Z03A 2OZKA 1YJWZ 3B3VA 2ZEHA 3CPXA 2F4OA 3K9TA 1RO2A 3S9MA 3RZOI 3CT9A 1VQ51 3H3VJ 3FMCA 1Y7EA 3B35A 1EE3P 2QA41 1YJ91 3QWUA 2NYQA 3CMA1 2JS4A 2QR1B 2PMZA 1Q822 3GUXA 2H85A 2JNYA 3I4MI 5LL6f 3FJUA 1CPXA 1Q861 4P6YA 4P4IA 4MHYA 3PB9X 1TKJA 3U50C 2PJ7A 1JQGA 3CCJZ 1W2BZ 1VQN1 1S72Z 3S15I 1ZLIA 4MCSA 1LAPA 4LQGA 3GLJA 3PEIA 1VQ81 4F9UA 2QEXZ 2Q51A 2KPIA 5C44I 2NVXI 4A3CI 1YIJ1 2O53A 1KD12 4R8FA 2V77A 4X3RA 1OBRA 2F4MA 1DE4C 2E2JI 4MONA 2EK9A 5A2Qb 4A3EI 3G4S1 5K8MA 3CCR1 2WB1A 3DGVA 4F8ZA 3CDXA 3I4NI 2RIQA 1ELMP 4OC0A 1K9M1 4E30A 1N8R2 2G2KA 3CD61 2PIYA 4ZY1A 3CC71 4W9YA 3J81f 4RVFA 1LAMA 3PO3I 3VMIA 2PM9A 3IFEA 3WABA 1N2FA 1HDUA 4A94A 1YIT1 1CG2A 3CCV1 1VQ7Z 2XEIA 1YW6A 1I50I 3FX6A 3SJFA 2JEWA 4GM5A 1VQL1 3HUVA 2GTHA 3CMEZ 2OR4A 1KC81 4K3NA 4A3GI 4S1TA 4BXXI 1BPNA 4OC3A 5J1QA 3IIBA 1NUIA 4FAIA 2OTJ1 3BHXA 4BY1I 2CTBA 4P4FA 2EWBA 1Y1VS 3M4OI 2AKLA 5FLXf 2BO9A 1Z02A 4E2ZA 2CF4A 3CMAZ 4UEZA 1JWHC 2PJ6A 2O4HA 3PB4X 4TNUA 3CCMZ 4NJQA 2WYRA 3Q87A 3V38A 3RBUA 3MZLB 2PJ8A 4MD8A 1VQNZ 3N5FA 1X0TA 4NBGA 1LANA 3GB0A 1TWCI 3H0GI 1VQ8Z 1RTQA 4NBHA 5T6BA 2E9HA 2ZENA 3T4NB 5C4JI 4R6TA 5AN9F 2EK8A 1VQ41 1CX8A 1KWMA 2E2II 1PCAA 1YHQ1 5I4MA 3MN8A 3MRUA 4DUKA 3J81b 2JA6I 3CCRZ 3PFEA 4OIDA 3S17I 2PJBA 3BG0B 5DS0A 2R7ZI 3CD6Z 2J9AA 4E32A 4MD7A 3CC41 3CC7Z 2DE6A 1VQPZ 3CC2Z 3HKZA 2YADA 2PJ4A 1YSJA 4EWCA 2PRQA 2B63I 2ZEMA 4R76A 1XBUA 3M3YI 4AYBA 1YITZ 4BY7I 3CCVZ 4A3DI 1ZG8A 4H2KA 5K8NA 1YI21 3OW2Y 4A93I 3KZWA 1VQLZ 2AFSA 4ZY0A 2PCUA 5T64A 5FLXb 2POKA 3TE5B 3GTKI 1HEEA 1ML8A 2V8IA 4UIBA 2WZNA 2J6AA 2OTJZ 2RBLA 4A3MI 5K8OA 4MCRA 3KGQA 4KSIA 1S7MA 1K8A1 3I1UA 2F8HA 2QKDA 3GCFA 2R93I 4ZYQA 5K8PA 3CCQ1 4NJRA 4FWUA 1Q862 2FVGA 1QYPA 1NJI1 2EGTA 2C6PA 2BOAA 3OW2Z 3GKQA 3P5JB 3I56Z 4NBBA 3D67A 1QVFY 3D4UA 5CM2M 1M901 3HOZI 3B7IA 3H8GA 1YJNZ 1USPA 3HOYI 1XJOA 3CPWY 2IJZA 4R7MA 1TWAI 4B6ZA 1RO4A 1VQ4Z 5D29A 4NBAA 2AFOA 1BAVA 4NOZA 3D7DA 3FF3A 3KQZA 3MONA 3LWUA 2DE7A 4HGYA 4A3KI 1Q811 4P10A 2PJ0A 2ZEDA 1K9M2 5HXDA 3CC4Z 5LRKA 4PXDA 4BD9A 4A3JI 4NFRA 2JA7I 3BI1A 2CIJA 1QVFZ 3CCS1 1TWFI 2JA5I 2IZ4A 2ABZA 4IHMA 4A37A 5CPAA 3J80b 4MRIA 3JAMf 1M1K1 4MCPA 2XEJA 3CPWZ 5HVHA 1VQ9Z 1KC82 1WIIA 3GTQI 3CXCY 1XRYA 2P3YA 2ANPA 3PBBA 4E33A 1F57A 4UEEA 2C6GA 2M6NA 2ZEFA 2YU9I 2HC9A 3JRUA 2V8DA 3D7HA 1ZB8A 3PBEA 2IZ3A 1ZLHA 1ZG7A 4P4EA 1CPSA 2AFMA 2GTIA 4P44A 1WW9A 1IY7A 4OC5A 2V8HA 3IJ3A 3RZDI 3NDJA 4F9VA 2PIZA 3HLPA 4RVHA 1ARLA 2PK7A 2KI7B 2RT9A 1GYTA 4NGQA 3FQMA 3FECA 4RS4A 3CCQZ 3VMGA 4MHPA 5LYIA 4RVGA 3BI0A 1TF8A 4Y7NI 4P45A 4NH1C 4P4JA 1VQ5Z 2XEFA 1VLAA 1QQ9A 2GLJA 4X8IA 4DYOA 5IB9A 1YUAA 3S9LA 4CL1A 2QA4Z 3PO3S 3CXCZ 1YJ9Z 1FT7A 5LYDA 1Z2LA 2V8KA 3ISZA 5C4XI 3S1NI 1QMUA 3GTJI 3NH4A 4A39A 2ZEGA 2OOTA 4MH4A 1Z5RA 1K731 4A3LI 5D1OB 3G711 1Z01A 4CPAA 4ZI6A 3KIFA 4NGPA 1TWHI 1VIXA 1P9NA 3GTMI 3JAMb 3KQXA 4OKOA 3IWWA 4ZX9A 4DGLA 2RFHA 2XEGA 2OOXB 3VMHA 2GLFA 2ZOGA 2AFUA 5HVGA 1YIJZ 2HB6A 2GU2A 3B3WA 1CP6A 1FNOA 5FLMI 3CCSZ 2PVVA 3B2YA 3G4SZ 4O23A 2IMOA 5IP7I 3B3TA 1RQFA 3ESWA 3S16I 3HOVI 2AFWA 3L2NA 4EFDA 1Y0YA 4UIAA 4ZY2A 2VUMI 3G6E1 3MZKB 1L1OC 3KHZA 1Z8LA 3I07A 4NB9A 2RHBA 4OIWA 3K7AI 2QREB 3H8EA 1VQO1 4Y52I 4RVDA 3T8WA 3CPAA 1VHEA 2QJ8A 2PJ5A 4E2YA 3BG1B 2R6MA 3ISXA 1K8A2 3D7GA 1ZG9A 3DLJA 3RAMA 2ZEPA 3S9NA 3D68A 3WC6A 5JM6A 4PXCA 1RNIA 3B3SA 1TKFA 1NJI2 4EMEA 3FVLA 3J80f 3GTLI 3K2KA 4UEFA 3KL9A 2QEX1 3NH5A 3SI0A 1M902 1LOKA 3KR4A 3S14I 3HOWI 4PPZA 4RV9A 3FEDA 2DEAA 4OC2A 3SJGA 3VTNA 2Y0SA 8CPAA 5D1PA 1ELLP 4QTTA 3CCU1 5THWA 3SJXA 5JH9A 1YUKA 2JR6A 2HF1A 1DTDA 1TFIA 2NSMA 4PXEA 3G71Z 1QF8A 1VQK1 2RPRA 4NBDA 4WWVA 1X3WA 2VUGA 2AFXA 1QVGY 2JUBA 3S1MI 1CBXA 1ARMA 1AMPA 5D1OA 1DL6A 5F09A 1ZB9A 1VQ71 1Y0RA 1BLLE 2OTL1 3HOUI 1YHQZ 4OC1A 3J7A4 4OC4A 3SJEA 4MXUA 4MD9A 1IGBA 2NVTI 3PO2I 2ZOFA 1M1K2 4EWTA 1XMBA 3EERA 5LYFA 3S1QI 1R3NA 2QRDB 5C3EI 2CTCA 1TXRA 3G6EZ 3TDHB 1VQM1 4BBSI 1XFOA 4OP4A 2VF1A 1KQSY 3WC5A 1CP7A 4PXBA 3SI2A 4Z65A 4NGMA 2JBKA 1VQOZ 3D66A 3WC7A 1YI2Z 4E2WA 3PFOA 3KI9A 1Q7Y1 5T67A 1QVGZ 2Q43A 3IFUA 4IK2A 4UF4A 5IT9f 2PJ9A 4RUHA 1K83I 3CCM1 1R43A 3CCL1 1PFTA 4XX2A 3GTOI 2PJAA 1F2OA 2NVQI 3IC1A 3NFZA 3GTPI 1Q7LA 2ZEEA 2ZELA 4JZ0A 3NH8A 4NBEA 5D8NA 1Q821 4AXVA 1TF9A 3PB7X 1TWGI 2C1CA 3WT4A 2HU9A 3QNVA 3D6WA 3B3CA 2LFUA 3IEHA 3F3FC 3F3PC 1KQSZ 1YLOA 3S2HI 2JMOA 2Q4ZA 3VB9A 1VQ61 3S2DI 3CCUZ 3D9XA 1H8LA 4NGNA 1JJ2Y 2PJ1A 3KIHA 2C6CA 2K3RA 1X3ZA 1Y1WI 1K732 1VQKZ 1LCPA 4MHZA 3TC8A 1Y1VI 2PJCA 5LRGA 1M4LA 1KD11 1TKHA 1VQP1 2DE5A 3CC21 6CPAA 2I3CA 3I551 3NDIA 2V8JA 2OTLZ 2F7VA 1I6HI 1LQLA 1N8R1 4G1PA 2K5RA 3HOXI 2BCOA 1RO0A 2OOYB 5HVFA 5CBMA 4E31A 2JBJA 4X6AI 3KHXA 1VQMZ 4Q7AA 1JJ2Z 5IT9b 5LYLA 3FKII 1WCMI 4MHNA 2IQ6A 3BXMA 1KRLA 2VL1A 1HDQA 3PRTA 3CCE1 3IX0A 1SFOI 2BJOA 4FUUA 4ZX8A 2R92I 5JGFA 1NP6A 1RLYA 4NGRA 1BPMA 3KR5A 2RB7A 1USPB 1YJW1 3CCLZ 3NA6A 2PE3A 4NGSA 1VGYA 3VARA 4TWEA 2P28A 4A38A 3I561 4ONWA 4P4DA 2E2HI 3GTMS 2LIYA 2PVWA 1YJN1 4BBRI 2W04A 3RZAA 3CQZI 3VH9A 4NB8A 3PB8X 4E2XA 3VATA 2W03A 2QLVB 7CPAA 4P4BA 4X2TA 4YU9A 1VQ6Z 4NGTA 5IP9I 3GTGI 2NVYI 3CCJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MCQ A;  5ELY A;  3PB6 X;  4OME A;  2PJ2 A;  3D7F A;  3H8F A;  3FEE A;  3SI1 A;  4MMO A;  1PYT B;  3FH4 A;  1YME A;  1YW4 A;  2PJ3 A;  2V8G A;  4WJB A;  2ZEO A;  1VHO A;  3V7Z A;  1UWY A;  2GRE A;  4DJL A;  4YWY A;  3KAS A;  4IAV A;  4PQA A;  1F2P A;  5LRJ A;  2G9D A;  4FBE A;  3LMS A;  1NSA A;  2AFZ A;  1AYE A;  2QVP A;  2V8V A;  3TX8 A;  1LFW A;  3IO1 A;  4JYW A;  2QYV A;  3B3V A;  3CPX A;  2ZEH A;  3K9T A;  3S9M A;  3CT9 A;  3FMC A;  1Y7E A;  3B35 A;  1EE3 P;  2NYQ A;  3GUX A;  3FJU A;  4P6Y A;  1CPX A;  4P4I A;  4MHY A;  3PB9 X;  1TKJ A;  2PJ7 A;  1JQG A;  1ZLI A;  4MCS A;  1LAP A;  4LQG A;  3GLJ A;  3PEI A;  4F9U A;  2Q51 A;  4R8F A;  2O53 A;  4X3R A;  2V77 A;  1OBR A;  1DE4 C;  2EK9 A;  5K8M A;  3DGV A;  4F8Z A;  3CDX A;  1ELM P;  4OC0 A;  2PIY A;  4ZY1 A;  4W9Y A;  1LAM A;  3WAB A;  3IFE A;  4A94 A;  1HDU A;  1CG2 A;  2XEI A;  1YW6 A;  3FX6 A;  3SJF A;  2JEW A;  4GM5 A;  3HUV A;  2OR4 A;  4K3N A;  1BPN A;  4OC3 A;  5J1Q A;  3IIB A;  4FAI A;  3BHX A;  2CTB A;  4P4F A;  2EWB A;  2BO9 A;  2CF4 A;  4UEZ A;  2PJ6 A;  2O4H A;  3PB4 X;  4TNU A;  4NJQ A;  2WYR A;  3V38 A;  3RBU A;  2PJ8 A;  3N5F A;  1LAN A;  3GB0 A;  1RTQ A;  2ZEN A;  4R6T A;  2EK8 A;  1CX8 A;  1KWM A;  1PCA A;  5I4M A;  3MN8 A;  3MRU A;  4DUK A;  3PFE A;  4OID A;  2PJB A;  5DS0 A;  2J9A A;  2PJ4 A;  1YSJ A;  2PRQ A;  2ZEM A;  4R76 A;  1XBU A;  4H2K A;  1ZG8 A;  5K8N A;  3KZW A;  2AFS A;  4ZY0 A;  2PCU A;  2POK A;  1HEE A;  4UIB A;  2WZN A;  5K8O A;  4MCR A;  3KGQ A;  4KSI A;  3I1U A;  2F8H A;  4ZYQ A;  5K8P A;  4NJR A;  4FWU A;  2FVG A;  2C6P A;  2BOA A;  3D67 A;  3D4U A;  3B7I A;  3H8G A;  1XJO A;  2IJZ A;  4R7M A;  4B6Z A;  5D29 A;  2AFO A;  1BAV A;  3D7D A;  3FF3 A;  3KQZ A;  3LWU A;  4P10 A;  2PJ0 A;  2ZED A;  5HXD A;  5LRK A;  4PXD A;  4BD9 A;  4NFR A;  3BI1 A;  2CIJ A;  4IHM A;  2ABZ A;  4A37 A;  5CPA A;  4MRI A;  4MCP A;  2XEJ A;  5HVH A;  1XRY A;  2ANP A;  3PBB A;  1F57 A;  4UEE A;  2C6G A;  2ZEF A;  2HC9 A;  3JRU A;  2V8D A;  3D7H A;  3PBE A;  1ZLH A;  1ZG7 A;  4P4E A;  1CPS A;  2AFM A;  4P44 A;  1IY7 A;  4OC5 A;  2V8H A;  3IJ3 A;  4F9V A;  2PIZ A;  3HLP A;  1ARL A;  1GYT A;  4NGQ A;  3FEC A;  4MHP A;  5LYI A;  3BI0 A;  1TF8 A;  4P45 A;  4P4J A;  4X8I A;  2XEF A;  1QQ9 A;  2GLJ A;  4DYO A;  5IB9 A;  3S9L A;  1FT7 A;  5LYD A;  1Z2L A;  3ISZ A;  1QMU A;  3NH4 A;  4A39 A;  2ZEG A;  2OOT A;  1Z5R A;  4CPA A;  4ZI6 A;  4NGP A;  1VIX A;  3KQX A;  4OKO A;  3IWW A;  4ZX9 A;  2RFH A;  2XEG A;  5HVG A;  2GLF A;  2ZOG A;  2AFU A;  2HB6 A;  2GU2 A;  3B3W A;  1CP6 A;  1FNO A;  2PVV A;  3B2Y A;  4O23 A;  2IMO A;  3B3T A;  2AFW A;  3L2N A;  4EFD A;  1Y0Y A;  4UIA A;  4ZY2 A;  3KHZ A;  1Z8L A;  4OIW A;  3H8E A;  3T8W A;  3CPA A;  1VHE A;  2QJ8 A;  2PJ5 A;  3ISX A;  3D7G A;  1ZG9 A;  3DLJ A;  3RAM A;  2ZEP A;  3S9N A;  3D68 A;  3WC6 A;  5JM6 A;  4PXC A;  3B3S A;  1TKF A;  4EME A;  3FVL A;  3K2K A;  4UEF A;  3KL9 A;  3NH5 A;  3SI0 A;  1LOK A;  3KR4 A;  4PPZ A;  3FED A;  2DEA A;  4OC2 A;  3SJG A;  8CPA A;  1ELL P;  5THW A;  3SJX A;  5JH9 A;  1DTD A;  2NSM A;  4PXE A;  4WWV A;  2AFX A;  1CBX A;  1ARM A;  1AMP A;  5F09 A;  1Y0R A;  1BLL E;  4OC1 A;  4OC4 A;  3SJE A;  4MXU A;  1IGB A;  2ZOF A;  4EWT A;  1XMB A;  5LYF A;  1R3N A;  2CTC A;  1TXR A;  1XFO A;  4OP4 A;  3WC5 A;  1CP7 A;  4PXB A;  3SI2 A;  4Z65 A;  4NGM A;  2JBK A;  3D66 A;  3WC7 A;  3PFO A;  3KI9 A;  4UF4 A;  4IK2 A;  2Q43 A;  2PJ9 A;  4RUH A;  1R43 A;  2PJA A;  1F2O A;  3IC1 A;  3NFZ A;  1Q7L A;  2ZEE A;  2ZEL A;  4JZ0 A;  3NH8 A;  5D8N A;  4AXV A;  1TF9 A;  3PB7 X;  2C1C A;  3WT4 A;  3QNV A;  3B3C A;  3IEH A;  1YLO A;  2Q4Z A;  1H8L A;  4NGN A;  2PJ1 A;  2C6C A;  4MHZ A;  3TC8 A;  1LCP A;  2PJC A;  5LRG A;  1M4L A;  1TKH A;  6CPA A;  2I3C A;  2F7V A;  4G1P A;  2BCO A;  5HVF A;  5CBM A;  2JBJ A;  3KHX A;  4Q7A A;  5LYL A;  4MHN A;  2IQ6 A;  3BXM A;  2VL1 A;  1HDQ A;  3PRT A;  4FUU A;  4ZX8 A;  5JGF A;  4NGR A;  1BPM A;  3NA6 A;  2RB7 A;  3KR5 A;  2PE3 A;  4NGS A;  1VGY A;  3VAR A;  4TWE A;  4A38 A;  4ONW A;  4P4D A;  2PVW A;  3RZA A;  3VH9 A;  3PB8 X;  3VAT A;  7CPA A;  4P4B A;  4X2T A;  4YU9 A;  4NGT A; 
#chains in the Genus database with same CATH topology
 4MCQ A;  3E0K A;  3WR7 A;  1ZO0 A;  1R9T I;  4CS0 B;  2EO8 A;  3I55 Z;  2CXA A;  3FH4 A;  5JQ4 A;  4DK1 A;  1YW4 A;  4WJB A;  1VHO A;  3V7Z A;  1UWY A;  2ZAE B;  4IAV A;  2F5I A;  1F2P A;  1I3Q I;  2Q4Y A;  4HGZ A;  3EXN A;  3D8P A;  2QVP A;  3LD2 A;  5CNP A;  1LFW A;  3IO1 A;  1CM0 A;  2WAQ A;  4Q36 A;  2EVN A;  4JYW A;  2QYV A;  2YNC A;  2F4O A;  3K9T A;  3S9M A;  4RS2 A;  1UFH A;  1Y7R A;  1YJ9 1;  2NYQ A;  3GIU A;  4XPD B;  3GUX A;  4P6Y A;  5LL6 f;  3K9U A;  4MHY A;  2P6E A;  1TKJ A;  2P0W A;  3U50 C;  1JQG A;  2FXF A;  4F9U A;  3BJ8 A;  2NVX I;  4R8F A;  2O53 A;  4X3R A;  3TE4 A;  2GAN A;  4RN7 A;  4R9M A;  3DGV A;  4F8Z A;  4OC0 A;  1K9M 1;  4KVM E;  2G2K A;  2YGW A;  2WSA A;  4B13 A;  1XF8 A;  4RVF A;  2PM9 A;  4A94 A;  1S7F A;  2NAP A;  1X10 A;  1YW6 A;  2PDO A;  4K3N A;  5F48 A;  3D2P A;  3R95 A;  4MJ8 A;  3IIB A;  1NUI A;  1Y9W A;  2OTJ 1;  4BY1 I;  4P4F A;  5FLX f;  2J8N A;  1Z02 A;  3FB3 A;  3CMA Z;  2O4H A;  3PB4 X;  4XPD C;  4TNU A;  3DR6 A;  2WYR A;  1VQN Z;  3N5F A;  4NBG A;  3GB0 A;  1TWC I;  3H0G I;  1VQ8 Z;  4NBH A;  5T6B A;  2ZEN A;  2R98 A;  3R9F A;  5I4M A;  3MN8 A;  3MRU A;  4DUK A;  3PFE A;  4ZGY B;  2J8M A;  2QML A;  5AG5 A;  3CD6 Z;  3CC4 1;  3CC7 Z;  4HNW B;  2IL4 A;  2Z3L A;  3HKZ A;  1S60 A;  2PRQ A;  2ZEM A;  2FE7 A;  2G0B A;  1YIT Z;  4LQ6 A;  3CCV Z;  1YI2 1;  4KZT A;  5T64 A;  2POK A;  1HEE A;  3I9S A;  1ML8 A;  1YVO A;  2RBL A;  4CYP A;  3KGQ A;  4XPK A;  4F6A A;  2BEI A;  3GCF A;  4ZYQ A;  4MBU A;  2C6P A;  3QAY A;  3B7I A;  3H8G A;  3GKR A;  1TWA I;  1VQ4 Z;  4NBA A;  3D7D A;  4HGY A;  1K9M 2;  2R1I A;  4BD9 A;  4GXH A;  2JA7 I;  3BI1 A;  4KUA A;  1QVF Z;  3W91 A;  3JAM f;  1M1K 1;  4MCP A;  3CPW Z;  4OAE A;  2Z3N A;  2P3Y A;  2ANP A;  3PBB A;  4UEE A;  4QUS A;  2DPS A;  3D7H A;  3PBE A;  2JLM A;  1FY7 A;  2CNT A;  1WW9 A;  3IJ3 A;  3R9G A;  3NDJ A;  4F9V A;  2PIZ A;  1ARL A;  2KI7 B;  1GYT A;  5KTC A;  3FQM A;  3TOA A;  5LYI A;  4CYN A;  4Y7N I;  4NH1 C;  4P4J A;  4MI4 A;  2VPW A;  1FT7 A;  5AGE A;  1YJ9 Z;  3JTK A;  5LYD A;  3ISZ A;  3S1N I;  1P4N A;  4IUS A;  1Q2Y A;  2OOT A;  4MH4 A;  3RO0 A;  3DNS A;  3IU1 A;  5D1O B;  4CPA A;  2ZW5 A;  1P9N A;  3F8K A;  3KQX A;  3IWW A;  2RFH A;  5HVG A;  2OOX B;  4M6H A;  2HB6 A;  2AYD A;  1RQF A;  4UFX A;  2AFW A;  3TT2 A;  3L2N A;  4UIA A;  1M4G A;  3D2L A;  4UA3 A;  3T8W A;  2R6M A;  4B5P A;  3DLJ A;  2ZEP A;  3WC6 A;  1RNI A;  2IV2 X;  3GTL I;  5GCN A;  3S14 I;  1MJ9 A;  3HOW I;  4RV9 A;  2DEA A;  4R57 A;  4B11 A;  4KOR A;  5JH9 A;  4CGO A;  2ODF A;  1QSO A;  1YK3 A;  1X3W A;  1SQH A;  4UWI A;  1BLL E;  4PSW A;  4MXU A;  4L8A A;  1IGB A;  2ZOF A;  3PO2 I;  4KUB A;  5AG7 A;  1M1K 2;  4CGP A;  1B87 A;  5LYF A;  1R3N A;  5C3E I;  3S6K A;  1KQS Y;  1CP7 A;  3SI2 A;  4Z65 A;  3WC7 A;  1YI2 Z;  3KI9 A;  1V0C A;  4UF4 A;  5T67 A;  1QVG Z;  3IFU A;  2Q43 A;  3F0A A;  5IT9 f;  2PJ9 A;  3CCM 1;  2D4O A;  1R43 A;  2Z0Z A;  1F2O A;  3IC1 A;  3GTP I;  4M85 A;  4H6Z A;  5J8F A;  4NBE A;  4QB9 A;  1Q82 1;  4KOX A;  2C1C A;  3WT4 A;  5EC4 A;  2GE3 A;  3S2H I;  2JMO A;  2Q4Z A;  3VB9 A;  4MFZ A;  3TC8 A;  2BUE A;  4R3L A;  3I55 1;  2P6G A;  4J3G A;  1LQL A;  4DNC A;  2K5R A;  1RO0 A;  3TTH A;  2HV2 A;  2ZW6 A;  3KHX A;  4KVX A;  2IQ6 A;  2VL1 A;  4CGM A;  4FUU A;  1NP6 A;  3B8G A;  1USP B;  3CCL Z;  3FIX A;  1VGY A;  4UWJ A;  3SXO A;  2P28 A;  4A38 A;  4ONW A;  2W04 A;  3CQZ I;  5C82 A;  4NB8 A;  2ARH A;  1YQE A;  7CPA A;  1VQ6 Z;  4LX9 A;  5ELY A;  3PB6 X;  4OME A;  4DQY B;  2B58 A;  3SI1 A;  4MMO A;  5HH1 A;  4MFL A;  4B12 A;  3EED A;  4QTU A;  4DJL A;  4YWY A;  2EUI A;  4PQA A;  1Q81 2;  5F46 A;  4FBE A;  3LMS A;  2AFZ A;  2QRC B;  1ZH1 A;  1AYE A;  2V8V A;  1SIW A;  1PU9 A;  4A32 A;  2JA8 I;  3SXN A;  1YJW Z;  2ZEH A;  3UY5 A;  5F47 A;  3CT9 A;  4E0A A;  4A31 A;  1Y7E A;  1EE3 P;  2QA4 1;  1NSL A;  3CMA 1;  2JS4 A;  4AVC A;  1Q82 2;  2JNY A;  3IR7 A;  4XPL A;  1WWZ A;  3PB9 X;  4KLW A;  4YRH A;  3R1K A;  2PJ7 A;  1VQN 1;  1S72 Z;  1IOF A;  3GLJ A;  5A28 A;  3PEI A;  1VQ8 1;  2C27 A;  4KSA A;  2KPI A;  5C44 I;  4A3C I;  3GYA A;  1QXF A;  2V77 A;  2F4M A;  4MON A;  2JEV A;  3EFA A;  4UBR A;  1FDI A;  5G1Z A;  3G3S A;  1ELM P;  3CD6 1;  3EO4 A;  3CC7 1;  3J81 f;  3PO3 I;  3IFE A;  4HNX B;  4KS9 A;  1YIT 1;  3CCV 1;  3FX6 A;  3SJF A;  4GM5 A;  5IB0 A;  2GTH A;  3CME Z;  2OR4 A;  1KC8 1;  3TO7 A;  4BXX I;  4OC3 A;  1M4D A;  5J1Q A;  2REF A;  1GHE A;  4FAI A;  3BHX A;  3P2F A;  2CTB A;  1Y1V S;  3M4O I;  1KUY A;  2BO9 A;  3QB8 A;  4FD6 A;  3CCM Z;  4EVY A;  3RBU A;  4F0X A;  4MD8 A;  3JUW A;  4K30 A;  4R6T A;  1J4J A;  2EK8 A;  1VQ4 1;  1CX8 A;  2E2I I;  4OLL A;  4UFV A;  3BG0 B;  2R7Z I;  2PR8 A;  1U6M A;  3T90 A;  5BWA B;  1YSJ A;  5H84 A;  4JWP A;  2B63 I;  4R76 A;  1KUV A;  1ZG8 A;  4H2K A;  3N7Z A;  4MHD A;  5K8N A;  2Q44 A;  4A93 I;  1NMT A;  4U9Z A;  5FLX b;  4UIB A;  2WZN A;  2J6A A;  1I12 A;  5K8O A;  4MY3 A;  4MCR A;  2BL1 A;  2FIA A;  1I1D A;  5K8P A;  4NJR A;  1QYP A;  1NJI 1;  3OW2 Z;  1QVF Y;  1PUA A;  2FL4 A;  1XJO A;  3CPW Y;  4B6Z A;  1WZN A;  4H89 A;  4C7H A;  3LWU A;  2Q4V A;  4A3K I;  4P10 A;  2PJ0 A;  3DR8 A;  2ZED A;  5HXD A;  4ZBG A;  4CRY B;  5LRK A;  2PRB A;  4PXD A;  1X12 A;  4IHM A;  2IZ4 A;  2ABZ A;  3J80 b;  2XEJ A;  1KC8 2;  4JXQ A;  2M6N A;  2Z11 A;  1ZB8 A;  1ZG7 A;  4P4E A;  2REE A;  1IY7 A;  3HLP A;  2RT9 A;  3FEC A;  3CCQ Z;  3VMG A;  4U5Y A;  4P45 A;  3CXS A;  1VHS A;  2OH1 A;  2GLJ A;  4DYO A;  2QA4 Z;  3CXC Z;  3ZJ0 A;  3EC4 A;  3H4Q A;  1Z01 A;  4ZI6 A;  3KIF A;  1Z4E A;  4GS4 A;  1VIX A;  3JAM b;  4OKO A;  2XEG A;  2ZOG A;  1CP6 A;  5IP7 I;  3S16 I;  4AB7 A;  2VPY A;  1Y0Y A;  4MFK A;  1XMT A;  1L1O C;  4NB9 A;  4OIW A;  1QSR A;  4Y52 I;  4RVD A;  2VEZ A;  1VHE A;  2QJ8 A;  4H6U A;  3BG1 B;  3ISX A;  3RAM A;  3S9N A;  4KOV A;  2WPW A;  3B3S A;  1NJI 2;  2DXQ A;  3FVL A;  4EME A;  3J80 f;  4ONU A;  3SI0 A;  1LOK A;  3KR4 A;  3FED A;  3SJG A;  8CPA A;  2Z3O A;  4AVB A;  3SJX A;  2NSM A;  4NCZ A;  4KOY A;  5AG4 A;  2AFX A;  1QVG Y;  1CBX A;  5D1O A;  1DL6 A;  5F09 A;  1IB1 E;  4JXR A;  4MD9 A;  3D2M A;  3S1Q I;  2QRD B;  1TXR A;  3G6E Z;  4BBS I;  3GY9 A;  1YGH A;  2JBK A;  1VQO Z;  4E2W A;  1BOB A;  3CCL 1;  4XX2 A;  2PJA A;  5C88 A;  1Q7L A;  1WK4 A;  2ZEL A;  4CAV A;  1TWG I;  3S6H A;  4YGO A;  3QNV A;  3B3C A;  3IEH A;  3F3F C;  3F3P C;  1S3Z A;  4C2Z A;  3S2D I;  1VQ6 1;  3CCU Z;  3D9X A;  4NGN A;  3LOD A;  2PJ1 A;  2C6C A;  4UFW A;  1KD1 1;  1TKH A;  1YLE A;  3CC2 1;  6CPA A;  2I3C A;  2Q7S A;  2Y0M A;  4A95 A;  4FD7 A;  2F7V A;  1N8R 1;  4CAF A;  3HOX I;  2OOY B;  4MY0 A;  5IT9 b;  5EMI A;  3FKI I;  2Z3K A;  4MHN A;  3BXM A;  4HNY B;  3FXT A;  1SFO I;  3IX0 A;  4ZX8 A;  2R92 I;  4NGR A;  1BPM A;  3FRM A;  3NA6 A;  1YJW 1;  2CNM A;  2PE3 A;  2E2H I;  2PVW A;  1YJN 1;  2VZY A;  3PB8 X;  1S7N A;  4P4B A;  4KOW A;  4NGT A;  3TCV A;  2BSW A;  5IP9 I;  1S72 1;  2B4B A;  3DDD A;  2GIV A;  2M48 A;  1PYT B;  1YME A;  3S1R I;  2PJ3 A;  2V8G A;  4KSF A;  3FQQ A;  4CYO A;  4A3B I;  1VQ9 1;  4A3I I;  3KAS A;  5A2Q f;  3LUS A;  2G9D A;  1A2Z A;  2ATR A;  3DSB A;  4QVT A;  4CGN A;  2QIR A;  3TX8 A;  3CCE Z;  3CME 1;  2VPZ A;  1Z03 A;  2OZK A;  1Z9U A;  3B3V A;  3CPX A;  3PZJ A;  2Z10 A;  1RO2 A;  1Z8X A;  1VQ5 1;  3H3V J;  2OZH A;  2H85 A;  3I4M I;  3FJU A;  1CPX A;  1Q86 1;  4P4I A;  2ZPA A;  1RO5 A;  3CCJ Z;  1W2B Z;  1ZLI A;  4UCP A;  1LAP A;  2ZW7 A;  4LQG A;  3NE8 A;  4C7I A;  4C68 A;  1KD1 2;  1DE4 C;  2EK9 A;  4A3E I;  3G4S 1;  5K8M A;  4CRZ B;  2WB1 A;  3CDX A;  4E30 A;  1N8R 2;  2G3A A;  4ZY1 A;  1Y9K A;  4W9Y A;  1LAM A;  1N71 A;  3VMI A;  4E2A A;  2VZZ A;  2JEW A;  1OZP A;  4KVO E;  1BPN A;  3FBU A;  5IX3 A;  3P2H A;  1XEB A;  2EWB A;  2AKL A;  4JD6 A;  3IWE A;  2OU2 A;  4UEZ A;  5G21 A;  2PJ6 A;  1L0C A;  2ZXV A;  3Q87 A;  1LAN A;  2V45 A;  3CXP A;  1RTQ A;  2LEX A;  1R57 A;  1KWM A;  1PCA A;  3J81 b;  3CCR Z;  3ZZI A;  2PSW A;  3S17 I;  1MJB A;  2PJB A;  2CNS A;  2DE6 A;  3CC2 Z;  2YAD A;  2PJ4 A;  4EWC A;  1XBU A;  1YVK A;  4A3D I;  3OW2 Y;  3KZW A;  1VQL Z;  3A9L A;  2PCU A;  3D3S A;  3GTK I;  2V8I A;  3SHP A;  2R93 I;  3CCQ 1;  4FWU A;  1Q86 2;  5EBV A;  2EGT A;  2BOA A;  3GKQ A;  4E8O A;  5HMN A;  3D4U A;  3HOZ I;  1YJN Z;  3HOY I;  2JIQ A;  1Z8W A;  5H86 A;  2AFO A;  1BAV A;  4NOZ A;  2WPX A;  1M4I A;  1S7K A;  3MON A;  2DE7 A;  1IID A;  2Q0Y A;  2PQ8 A;  1QSM A;  4A3J I;  4NFR A;  2DF5 A;  3OWC A;  1XE4 A;  2CIJ A;  1TWF I;  3CZX A;  4A37 A;  4MRI A;  3FYN A;  3F5B A;  1VQ9 Z;  3CXC Y;  1CJW A;  4E33 A;  1RXT A;  2C6G A;  2HC9 A;  2B4D B;  5FVJ A;  4NF1 A;  2IZ3 A;  1ZLH A;  5DWM A;  5F49 A;  2NMT A;  3S6G A;  2AFM A;  4RS4 A;  5KTD A;  1VQ5 Z;  2XEF A;  1VLA A;  4L89 A;  4X8I A;  5I0C A;  1YUA A;  3S9L A;  4RI1 A;  3PO3 S;  1KUX A;  1Z2L A;  2V8K A;  1QMU A;  3GTJ I;  1AA6 A;  4A39 A;  4NEX A;  1K73 1;  3VWD A;  3PP9 A;  2PR1 A;  1TWH I;  3GTM I;  4DGL A;  2GLF A;  4CAE A;  2AFU A;  1QST A;  5FLM I;  3CCS Z;  2PVV A;  3B2Y A;  3G4S Z;  4O23 A;  2IMO A;  3B3T A;  4II9 A;  2B3U A;  3ESW A;  1FDO A;  3HOV I;  2B5G B;  4ZY2 A;  4MFQ A;  2VUM I;  3G6E 1;  3MZK B;  3KHZ A;  3I07 A;  2QRE B;  3H8E A;  1VQO 1;  4HPS A;  4E2Y A;  3D7G A;  1ZG9 A;  4YFJ A;  3D68 A;  4PXC A;  1LRZ A;  2A4N A;  3K2K A;  3KL9 A;  4M3S A;  3R96 A;  2QEX 1;  1S7L A;  4X5K A;  4PPZ A;  2J8R A;  3VTN A;  1ELL P;  3CCU 1;  5THW A;  2JR6 A;  1DTD A;  1TFI A;  4KOT A;  3G71 Z;  1IYL A;  4PK3 A;  4NBD A;  2VUG A;  2FT0 A;  2JUB A;  3S1M I;  1VKC A;  1AMP A;  5DWN A;  1BO4 A;  1VQ7 1;  4OC1 A;  3SJE A;  2HUZ A;  4EWT A;  2CTC A;  3LAC A;  1XFO A;  4OP4 A;  3WC5 A;  4R3K A;  4PXB A;  4AG7 A;  1Q7Y 1;  4C2Y A;  2P6F A;  3TOB A;  4CAW A;  1PFT A;  3GTO I;  4JJX A;  2NVQ I;  3FNC A;  3NFZ A;  2ZEE A;  5D8N A;  4AXV A;  1TF9 A;  1YR0 A;  4A33 A;  2LFU A;  1YLO A;  4QC6 A;  2KCW A;  1P0H A;  5KTA A;  1Q2D A;  3KIH A;  4Y49 B;  4MHZ A;  1MK4 A;  1Y1W I;  1K73 2;  1VQK Z;  1LCP A;  1VQP 1;  3NDI A;  2V8J A;  2OTL Z;  4G1P A;  4HKF A;  2BCO A;  2JBJ A;  2OZU A;  1VQM Z;  1JJ2 Z;  4CGL A;  1K4J A;  1WCM I;  1KRL A;  3PRT A;  3CCE 1;  5JGF A;  2VI7 A;  1RLY A;  2RB7 A;  3VAR A;  3I56 1;  1I21 A;  2AJ6 A;  2LIY A;  1ON0 A;  4BBR I;  4KOS A;  3VH9 A;  4YU9 A;  2JIR A;  1M1D A;  3CCJ 1;  4AVA A;  1JWQ A;  2PJ2 A;  3KKW A;  3D7F A;  3W6S A;  4Y49 C;  2YNE A;  3C26 A;  3H8F A;  3FEE A;  1Z4R A;  4B10 A;  4UCN A;  2ZEO A;  4NBF A;  4A3F I;  2GRE A;  2VQY A;  3V8I A;  1IYK A;  5LRJ A;  4HH4 A;  1NSA A;  3IF8 A;  3TO6 A;  1W2B Y;  2YNC C;  4UCM A;  4NBC A;  1KZF A;  1Q7Y 2;  4A2Z A;  3RZO I;  3FMC A;  5ISV A;  3B35 A;  3QWU A;  2QR1 B;  2PMZ A;  2FCK A;  2G3T A;  2R8V A;  3JVN A;  3RYO A;  3S15 I;  2VXK A;  4MCS A;  1M44 A;  2QEX Z;  2Q51 A;  1YIJ 1;  2R7H A;  1OBR A;  2E2J I;  5A2Q b;  4NSQ A;  3CCR 1;  3T9Y A;  3I4N I;  2RIQ A;  2PIY A;  4I49 A;  3MGD A;  2PC1 A;  4A30 A;  3G8W A;  2JIM A;  3WAB A;  2HQY A;  1N2F A;  1HDU A;  1CG2 A;  1VQ7 Z;  2XEI A;  1I50 I;  4CAX A;  1VQL 1;  3HUV A;  1TIQ A;  5IV0 A;  4A3G I;  4S1T A;  2OZG A;  5J8C A;  2YND A;  4E2Z A;  2CF4 A;  1JWH C;  4BMH A;  3BJ7 A;  4NJQ A;  3V38 A;  3MZL B;  2PJ8 A;  1X0T A;  3EY5 A;  4F0Y A;  5A27 A;  2Z3M A;  2E9H A;  2CY2 A;  3CXQ A;  3T4N B;  5C4J I;  5AN9 F;  1NE9 A;  1YHQ 1;  2JA6 I;  4OID A;  5DS0 A;  2J9A A;  4E32 A;  4MD7 A;  3IGR A;  1Q2C A;  1VQP Z;  3M3Y I;  4AYB A;  4BY7 I;  2X7B A;  2DPT A;  2QEC A;  2AFS A;  2V3V A;  4ZY0 A;  3VWE A;  3TE5 B;  2OTJ Z;  4A3M I;  4PV6 A;  4CYQ A;  4KSI A;  5G22 A;  1S7M A;  1K8A 1;  3I1U A;  3IWG A;  2F8H A;  2GFQ A;  2QKD A;  2FS5 A;  2FVG A;  3R9E A;  4LUA A;  3P5J B;  3I56 Z;  4NBB A;  3D67 A;  1YX0 A;  5CM2 M;  1M90 1;  2AE6 A;  4C2X A;  1USP A;  2IJZ A;  4R7M A;  4QBJ A;  1AUG A;  1RO4 A;  2RC4 A;  5D29 A;  3FF3 A;  3KQZ A;  1XOV A;  4B5O A;  1Q81 1;  2FSR A;  2JDC A;  3W6X A;  3CC4 Z;  1IOI A;  3CCS 1;  3I3G A;  2JA5 I;  5CPA A;  1B6B A;  5HVH A;  3GTQ I;  1WII A;  5AG6 A;  1XRY A;  1F57 A;  2ZEF A;  2YU9 I;  3JRU A;  2V8D A;  4B5P B;  1CPS A;  2GTI A;  4P44 A;  4OC5 A;  2I79 A;  2V8H A;  3RZD I;  4RVH A;  1YRE A;  2PK7 A;  4NGQ A;  4XNH B;  2JDD A;  4MHP A;  4RVG A;  3BI0 A;  4R87 A;  1TF8 A;  4OAD A;  1WJ2 A;  1IIC A;  1QQ9 A;  5IB9 A;  4M6G A;  4CL1 A;  5C4X I;  3NH4 A;  1Y8C A;  2ZEG A;  2Q7B A;  3RNZ A;  1MJA A;  4Q38 A;  1Z5R A;  4A3L I;  3G71 1;  2OB0 A;  4NGP A;  4ZX9 A;  3VMH A;  4U9Y A;  1YIJ Z;  2GU2 A;  3B3W A;  1FNO A;  2I00 A;  3TO9 A;  1XIX A;  4PSX A;  2B3V A;  3TFY A;  4EFD A;  1Z8L A;  2RHB A;  3K7A I;  3PGP A;  4FD5 A;  1S5K A;  3CPA A;  2PJ5 A;  4ORF A;  4NXY A;  2B4D A;  2JIP A;  1K8A 2;  2ZW4 A;  5JM6 A;  2D4P A;  1TKF A;  4XNH C;  4UEF A;  3NH5 A;  1M90 2;  4M6I A;  4OC2 A;  2Y0S A;  4PK2 A;  5D1P A;  4QTT A;  4MFJ A;  1YUK A;  2HF1 A;  4B14 A;  2JIO A;  4PXE A;  1QF8 A;  1VQK 1;  2RPR A;  4IF5 A;  4WWV A;  2Q04 A;  4KOU A;  1ARM A;  4KLV A;  1ZB9 A;  1Y0R A;  2OTL 1;  3HOU I;  1YHQ Z;  3J7A 4;  4OC4 A;  2NVT I;  2O28 A;  1XMB A;  3EER A;  1VQM 1;  3TDH B;  2VBQ A;  2WUU A;  2VF1 A;  4BBH A;  3QAH A;  4NGM A;  3D66 A;  2B5G A;  3PFO A;  2H5M A;  5G20 A;  4IK2 A;  4RUH A;  1K83 I;  5JPH A;  4JZ0 A;  1IU8 A;  3S6F A;  3NH8 A;  3H5Z A;  3PB7 X;  2HU9 A;  3D6W A;  1KQS Z;  1Z8T A;  4FD4 A;  1H8L A;  1JJ2 Y;  3BLN A;  1QSN A;  2K3R A;  4JLY A;  1X3Z A;  3IU2 A;  1Y1V I;  2PJC A;  5LRG A;  1M4L A;  2DE5 A;  5E96 A;  1I6H I;  1Q16 A;  2FIW A;  2Z3P A;  2EBJ A;  5HVF A;  5CBM A;  4E31 A;  4X6A I;  4Q7A A;  4AG9 A;  5LYL A;  2VPX A;  3NE7 A;  2E7Z A;  1HDQ A;  2BJO A;  3KR5 A;  4NGS A;  4TWE A;  2K5T A;  4P4D A;  3GTM S;  3RZA A;  4BIN A;  4E2X A;  4MFP A;  3VAT A;  2W03 A;  2QLV B;  4X2T A;  3GTG I;  2NVY I; 
#chains in the Genus database with same CATH homology
 1S72 1;  4MCQ A;  5ELY A;  3PB6 X;  4OME A;  2PJ2 A;  3D7F A;  4DQY B;  1R9T I;  3H8F A;  3FEE A;  3I55 Z;  3SI1 A;  2M48 A;  4MMO A;  1PYT B;  3FH4 A;  1YME A;  3S1R I;  4DK1 A;  1YW4 A;  2PJ3 A;  2V8G A;  4WJB A;  2ZEO A;  1VHO A;  3FQQ A;  4NBF A;  3V7Z A;  3EED A;  4QTU A;  1UWY A;  4A3F I;  1VQ9 1;  4A3B I;  4A3I I;  2GRE A;  4DJL A;  4YWY A;  2ZAE B;  3KAS A;  4IAV A;  5A2Q f;  3LUS A;  4PQA A;  1Q81 2;  1F2P A;  5LRJ A;  1I3Q I;  2G9D A;  4FBE A;  3LMS A;  4HH4 A;  1NSA A;  2AFZ A;  4HGZ A;  3IF8 A;  2QRC B;  1ZH1 A;  1AYE A;  2QVP A;  2V8V A;  3TX8 A;  1LFW A;  1W2B Y;  3IO1 A;  3CCE Z;  2WAQ A;  3CME 1;  2JA8 I;  4NBC A;  4JYW A;  2QYV A;  1Q7Y 2;  1Z03 A;  2OZK A;  1YJW Z;  3B3V A;  2ZEH A;  3CPX A;  2F4O A;  3K9T A;  1RO2 A;  3S9M A;  3RZO I;  3CT9 A;  1VQ5 1;  3H3V J;  3FMC A;  1Y7E A;  3B35 A;  1EE3 P;  2QA4 1;  1YJ9 1;  3QWU A;  2NYQ A;  3CMA 1;  2JS4 A;  2QR1 B;  2PMZ A;  1Q82 2;  3GUX A;  2H85 A;  2JNY A;  3I4M I;  5LL6 f;  3FJU A;  1CPX A;  1Q86 1;  4P6Y A;  4P4I A;  4MHY A;  3PB9 X;  1TKJ A;  3U50 C;  2PJ7 A;  1JQG A;  3CCJ Z;  1W2B Z;  1VQN 1;  1S72 Z;  3S15 I;  1ZLI A;  4MCS A;  1LAP A;  4LQG A;  3GLJ A;  3PEI A;  1VQ8 1;  4F9U A;  2QEX Z;  2Q51 A;  2KPI A;  5C44 I;  2NVX I;  4A3C I;  1YIJ 1;  2O53 A;  1KD1 2;  4R8F A;  2V77 A;  4X3R A;  1OBR A;  2F4M A;  1DE4 C;  2E2J I;  4MON A;  2EK9 A;  5A2Q b;  4A3E I;  3G4S 1;  5K8M A;  3CCR 1;  2WB1 A;  3DGV A;  4F8Z A;  3CDX A;  3I4N I;  2RIQ A;  1ELM P;  4OC0 A;  1K9M 1;  4E30 A;  1N8R 2;  2G2K A;  3CD6 1;  2PIY A;  4ZY1 A;  3CC7 1;  4W9Y A;  3J81 f;  4RVF A;  1LAM A;  3PO3 I;  3VMI A;  2PM9 A;  3IFE A;  3WAB A;  1N2F A;  1HDU A;  4A94 A;  1YIT 1;  1CG2 A;  3CCV 1;  1VQ7 Z;  2XEI A;  1YW6 A;  1I50 I;  3FX6 A;  3SJF A;  2JEW A;  4GM5 A;  1VQL 1;  3HUV A;  2GTH A;  3CME Z;  2OR4 A;  1KC8 1;  4K3N A;  4A3G I;  4S1T A;  4BXX I;  1BPN A;  4OC3 A;  5J1Q A;  3IIB A;  1NUI A;  4FAI A;  2OTJ 1;  3BHX A;  4BY1 I;  2CTB A;  4P4F A;  2EWB A;  1Y1V S;  3M4O I;  2AKL A;  5FLX f;  2BO9 A;  1Z02 A;  4E2Z A;  2CF4 A;  3CMA Z;  4UEZ A;  1JWH C;  2PJ6 A;  2O4H A;  3PB4 X;  4TNU A;  3CCM Z;  4NJQ A;  2WYR A;  3Q87 A;  3V38 A;  3RBU A;  3MZL B;  2PJ8 A;  4MD8 A;  1VQN Z;  3N5F A;  1X0T A;  4NBG A;  1LAN A;  3GB0 A;  1TWC I;  3H0G I;  1VQ8 Z;  1RTQ A;  4NBH A;  5T6B A;  2E9H A;  2ZEN A;  3T4N B;  5C4J I;  4R6T A;  5AN9 F;  2EK8 A;  1VQ4 1;  1CX8 A;  1KWM A;  2E2I I;  1PCA A;  1YHQ 1;  5I4M A;  3MN8 A;  3MRU A;  4DUK A;  3J81 b;  2JA6 I;  3CCR Z;  3PFE A;  4OID A;  3S17 I;  2PJB A;  3BG0 B;  5DS0 A;  2R7Z I;  3CD6 Z;  2J9A A;  4E32 A;  4MD7 A;  3CC4 1;  3CC7 Z;  2DE6 A;  1VQP Z;  3CC2 Z;  3HKZ A;  2YAD A;  2PJ4 A;  1YSJ A;  4EWC A;  2PRQ A;  2B63 I;  2ZEM A;  4R76 A;  1XBU A;  3M3Y I;  4AYB A;  1YIT Z;  4BY7 I;  3CCV Z;  4A3D I;  1ZG8 A;  4H2K A;  5K8N A;  1YI2 1;  3OW2 Y;  4A93 I;  3KZW A;  1VQL Z;  2AFS A;  4ZY0 A;  2PCU A;  5T64 A;  5FLX b;  2POK A;  3TE5 B;  3GTK I;  1HEE A;  1ML8 A;  2V8I A;  4UIB A;  2WZN A;  2J6A A;  2OTJ Z;  2RBL A;  4A3M I;  5K8O A;  4MCR A;  3KGQ A;  4KSI A;  1S7M A;  1K8A 1;  3I1U A;  2F8H A;  2QKD A;  3GCF A;  2R93 I;  4ZYQ A;  5K8P A;  3CCQ 1;  4NJR A;  4FWU A;  1Q86 2;  2FVG A;  1QYP A;  1NJI 1;  2EGT A;  2C6P A;  2BOA A;  3OW2 Z;  3GKQ A;  3P5J B;  3I56 Z;  4NBB A;  3D67 A;  1QVF Y;  3D4U A;  5CM2 M;  1M90 1;  3HOZ I;  3B7I A;  3H8G A;  1YJN Z;  1USP A;  3HOY I;  1XJO A;  3CPW Y;  2IJZ A;  4R7M A;  1TWA I;  4B6Z A;  1RO4 A;  1VQ4 Z;  5D29 A;  4NBA A;  2AFO A;  1BAV A;  4NOZ A;  3D7D A;  3FF3 A;  3KQZ A;  3MON A;  3LWU A;  2DE7 A;  4HGY A;  4A3K I;  1Q81 1;  4P10 A;  2PJ0 A;  2ZED A;  1K9M 2;  5HXD A;  3CC4 Z;  5LRK A;  4PXD A;  4BD9 A;  4A3J I;  4NFR A;  2JA7 I;  3BI1 A;  2CIJ A;  1QVF Z;  3CCS 1;  1TWF I;  2JA5 I;  2IZ4 A;  2ABZ A;  4IHM A;  4A37 A;  5CPA A;  3J80 b;  4MRI A;  3JAM f;  1M1K 1;  4MCP A;  2XEJ A;  3CPW Z;  5HVH A;  1VQ9 Z;  1KC8 2;  1WII A;  3GTQ I;  3CXC Y;  1XRY A;  2P3Y A;  2ANP A;  3PBB A;  4E33 A;  1F57 A;  4UEE A;  2C6G A;  2M6N A;  2ZEF A;  2YU9 I;  2HC9 A;  3JRU A;  2V8D A;  3D7H A;  1ZB8 A;  3PBE A;  2IZ3 A;  1ZLH A;  1ZG7 A;  4P4E A;  1CPS A;  2AFM A;  2GTI A;  4P44 A;  1WW9 A;  1IY7 A;  4OC5 A;  2V8H A;  3IJ3 A;  3RZD I;  3NDJ A;  4F9V A;  2PIZ A;  3HLP A;  4RVH A;  1ARL A;  2PK7 A;  2KI7 B;  2RT9 A;  1GYT A;  4NGQ A;  3FQM A;  3FEC A;  4RS4 A;  3CCQ Z;  3VMG A;  4MHP A;  5LYI A;  4RVG A;  3BI0 A;  1TF8 A;  4Y7N I;  4P45 A;  4NH1 C;  4P4J A;  1VQ5 Z;  2XEF A;  1VLA A;  1QQ9 A;  2GLJ A;  4X8I A;  4DYO A;  5IB9 A;  1YUA A;  3S9L A;  4CL1 A;  2QA4 Z;  3PO3 S;  3CXC Z;  1YJ9 Z;  1FT7 A;  5LYD A;  1Z2L A;  2V8K A;  3ISZ A;  5C4X I;  3S1N I;  1QMU A;  3GTJ I;  3NH4 A;  4A39 A;  2ZEG A;  2OOT A;  4MH4 A;  1Z5R A;  1K73 1;  4A3L I;  5D1O B;  3G71 1;  1Z01 A;  4CPA A;  4ZI6 A;  3KIF A;  4NGP A;  1TWH I;  1VIX A;  1P9N A;  3GTM I;  3JAM b;  3KQX A;  4OKO A;  3IWW A;  4ZX9 A;  4DGL A;  2RFH A;  2XEG A;  2OOX B;  3VMH A;  2GLF A;  2ZOG A;  2AFU A;  5HVG A;  1YIJ Z;  2HB6 A;  2GU2 A;  3B3W A;  1CP6 A;  1FNO A;  5FLM I;  3CCS Z;  2PVV A;  3B2Y A;  3G4S Z;  4O23 A;  2IMO A;  5IP7 I;  3B3T A;  1RQF A;  3ESW A;  3S16 I;  3HOV I;  2AFW A;  3L2N A;  4EFD A;  1Y0Y A;  4UIA A;  4ZY2 A;  2VUM I;  3G6E 1;  3MZK B;  1L1O C;  3KHZ A;  1Z8L A;  3I07 A;  4NB9 A;  2RHB A;  4OIW A;  3K7A I;  2QRE B;  3H8E A;  1VQO 1;  4Y52 I;  4RVD A;  3T8W A;  3CPA A;  1VHE A;  2QJ8 A;  2PJ5 A;  4E2Y A;  3BG1 B;  2R6M A;  3ISX A;  1K8A 2;  3D7G A;  1ZG9 A;  3DLJ A;  3RAM A;  2ZEP A;  3S9N A;  3D68 A;  3WC6 A;  5JM6 A;  4PXC A;  1RNI A;  3B3S A;  1TKF A;  1NJI 2;  4EME A;  3FVL A;  3J80 f;  3GTL I;  3K2K A;  4UEF A;  3KL9 A;  2QEX 1;  3NH5 A;  3SI0 A;  1M90 2;  1LOK A;  3KR4 A;  3S14 I;  3HOW I;  4PPZ A;  4RV9 A;  3FED A;  2DEA A;  4OC2 A;  3SJG A;  3VTN A;  2Y0S A;  8CPA A;  5D1P A;  1ELL P;  4QTT A;  3CCU 1;  5THW A;  3SJX A;  5JH9 A;  1YUK A;  2JR6 A;  2HF1 A;  1DTD A;  1TFI A;  2NSM A;  4PXE A;  3G71 Z;  1QF8 A;  1VQK 1;  2RPR A;  4NBD A;  4WWV A;  1X3W A;  2VUG A;  2AFX A;  1QVG Y;  2JUB A;  3S1M I;  1CBX A;  1ARM A;  1AMP A;  5D1O A;  1DL6 A;  5F09 A;  1ZB9 A;  1VQ7 1;  1Y0R A;  1BLL E;  2OTL 1;  3HOU I;  1YHQ Z;  4OC1 A;  3J7A 4;  4OC4 A;  3SJE A;  4MXU A;  4MD9 A;  1IGB A;  2NVT I;  3PO2 I;  2ZOF A;  1M1K 2;  4EWT A;  1XMB A;  3EER A;  5LYF A;  3S1Q I;  1R3N A;  2QRD B;  5C3E I;  2CTC A;  1TXR A;  3G6E Z;  3TDH B;  1VQM 1;  4BBS I;  1XFO A;  4OP4 A;  2VF1 A;  1KQS Y;  3WC5 A;  1CP7 A;  4PXB A;  3SI2 A;  4Z65 A;  4NGM A;  2JBK A;  1VQO Z;  3D66 A;  3WC7 A;  1YI2 Z;  4E2W A;  3PFO A;  3KI9 A;  1Q7Y 1;  5T67 A;  1QVG Z;  2Q43 A;  3IFU A;  4IK2 A;  4UF4 A;  5IT9 f;  2PJ9 A;  4RUH A;  1K83 I;  3CCM 1;  1R43 A;  3CCL 1;  1PFT A;  4XX2 A;  3GTO I;  2PJA A;  1F2O A;  2NVQ I;  3IC1 A;  3NFZ A;  3GTP I;  1Q7L A;  2ZEE A;  2ZEL A;  4JZ0 A;  3NH8 A;  4NBE A;  5D8N A;  1Q82 1;  4AXV A;  1TF9 A;  3PB7 X;  1TWG I;  2C1C A;  3WT4 A;  2HU9 A;  3QNV A;  3D6W A;  3B3C A;  2LFU A;  3IEH A;  3F3F C;  3F3P C;  1KQS Z;  1YLO A;  3S2H I;  2JMO A;  2Q4Z A;  3VB9 A;  1VQ6 1;  3S2D I;  3CCU Z;  3D9X A;  1H8L A;  4NGN A;  1JJ2 Y;  2PJ1 A;  3KIH A;  2C6C A;  2K3R A;  1X3Z A;  1Y1W I;  1K73 2;  1VQK Z;  1LCP A;  4MHZ A;  3TC8 A;  1Y1V I;  2PJC A;  5LRG A;  1M4L A;  1KD1 1;  1TKH A;  1VQP 1;  2DE5 A;  3CC2 1;  6CPA A;  2I3C A;  3I55 1;  3NDI A;  2V8J A;  2OTL Z;  2F7V A;  1I6H I;  1LQL A;  1N8R 1;  4G1P A;  2K5R A;  3HOX I;  2BCO A;  1RO0 A;  2OOY B;  5HVF A;  5CBM A;  4E31 A;  2JBJ A;  4X6A I;  3KHX A;  1VQM Z;  4Q7A A;  1JJ2 Z;  5IT9 b;  5LYL A;  3FKI I;  1WCM I;  4MHN A;  2IQ6 A;  3BXM A;  1KRL A;  2VL1 A;  1HDQ A;  3PRT A;  3CCE 1;  3IX0 A;  1SFO I;  2BJO A;  4FUU A;  4ZX8 A;  2R92 I;  5JGF A;  1NP6 A;  1RLY A;  4NGR A;  1BPM A;  3KR5 A;  2RB7 A;  1USP B;  1YJW 1;  3CCL Z;  3NA6 A;  2PE3 A;  4NGS A;  1VGY A;  3VAR A;  4TWE A;  2P28 A;  4A38 A;  3I56 1;  4ONW A;  4P4D A;  2E2H I;  3GTM S;  2LIY A;  2PVW A;  1YJN 1;  4BBR I;  2W04 A;  3RZA A;  3CQZ I;  3VH9 A;  4NB8 A;  3PB8 X;  4E2X A;  3VAT A;  2W03 A;  2QLV B;  7CPA A;  4P4B A;  4X2T A;  4YU9 A;  1VQ6 Z;  4NGT A;  5IP9 I;  3GTG I;  2NVY I;  3CCJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...