4MXUA

Human brain aspartoacylase mutant k213e complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
301
structure length
301
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGEEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 95
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mxuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mxuA01
2J9AA 3D7HA 1GYTA 4NJRA 1DE4C 2NYQA 3FMCA 4OMEA 4ZY1A 4RUHA 3CPAA 2PE3A 3D67A 4MHPA 4A94A 2ZEEA 3RBUA 1Z2LA 3T8WA 3BHXA 3JRUA 4A38A 2IJZA 1Z8LA 2PIZA 1TF9A 4MCRA 2CF4A 2QYVA 3SJXA 4NGNA 4UEZA 1TKJA 4PXCA 4TNUA 3SJGA 3IJ3A 2CTBA 1ARMA 4F9VA 1HDUA 4PPZA 4Q7AA 4P4FA 2WYRA 3BXMA 5K8NA 3PRTA 5DS0A 1EE3P 1ELMP 4OC4A 3WC5A 3L2NA 5LRKA 4NGTA 4P4EA 4PXDA 3FX6A 2AFMA 1AYEA 3K2KA 3MN8A 4IK2A 1IGBA 2C1CA 1LCPA 2PJCA 4MCPA 4H2KA 4PQAA 1VHEA 3FJUA 4MHZA 1CBXA 1ZG8A 1F2PA 2GREA 5LYIA 5LYFA 3NFZA 2PJ1A 4DUKA 2ZEGA 4WJBA 1LANA 3CPXA 2ZEHA 3PB9X 1CPXA 2JBJA 2WZNA 3KR4A 1AMPA 2PRQA 3H8EA 3PFOA 1ZLIA 5JH9A 4TWEA 2AFZA 6CPAA 3ISXA 3SJFA 2ZEOA 1FNOA 3ISZA 4AXVA 1YW6A 4A37A 3KI9A 1XMBA 2C6CA 3FF3A 2RFHA 1TXRA 3FEEA 2G9DA 3FEDA 2IMOA 3B3VA 2PCUA 4ZY2A 1Y0RA 5CBMA 4P4BA 5ELYA 3S9MA 3VARA 4FAIA 2PJ5A 3SI2A 2V8HA 2EK8A 4NGMA 3N5FA 1ARLA 3I1UA 4OC1A 3GB0A 3CT9A 2HB6A 4P4DA 5JGFA 3B3CA 2F7VA 4MHYA 2V8VA 2OR4A 4EMEA 2AFXA 2XEIA 2PJ4A 2PVVA 3K9TA 3B3TA 3B3SA 3KR5A 3WC7A 2Q4ZA 2ZOGA 1BLLE 7CPAA 1LFWA 3KQXA 2GLFA 2PJ2A 1M4LA 1LOKA 1DTDA 1XRYA 2Q51A 5LYDA 3NH8A 3LMSA 4NGRA 1CG2A 3B2YA 5K8PA 1KWMA 1PYTB 2AFOA 5IB9A 4P44A 1QQ9A 1OBRA 1Y7EA 3D7DA 2XEGA 4JYWA 3LWUA 3PBEA 4ZI6A 2ZEFA 1R3NA 2XEJA 3V38A 4OKOA 4P4IA 1XBUA 2QVPA 4F9UA 3WC6A 4MMOA 3IEHA 2PJ6A 2PJ9A 3IC1A 2V8DA 4OC3A 1PCAA 2PJ8A 2F8HA 4ZX8A 5LRGA 4K3NA 3PB4X 1FT7A 1TKHA 5HVHA 1VGYA 2PJBA 3NH4A 3VATA 1XJOA 2EK9A 2QJ8A 2AFSA 4MCSA 3PB7X 2ABZA 4R7MA 4IHMA 2ZOFA 1LAMA 3PEIA 4NFRA 3D4UA 2PJ3A 4UF4A 5LRJA 5I4MA 2AFUA 3B7IA 4LQGA 2BO9A 4OP4A 4EWTA 2ZELA 4FBEA 3PBBA 2I3CA 2C6GA 2O53A 4G1PA 3PFEA 4ZX9A 3TX8A 4P4JA 4A39A 3GLJA 4BD9A 1TKFA 5LYLA 3KGQA 2VL1A 3S9NA 4FUUA 3D68A 5THWA 4ZYQA 3WABA 3PB8X 3NH5A 2POKA 1Q7LA 3B3WA 4R76A 4YWYA 5JM6A 2JBKA 2ZEPA 3V7ZA 4IAVA 3KHZA 1VIXA 3MRUA 4UIAA 3TC8A 1ELLP 3D7FA 3IIBA 1Z5RA 2CTCA 2ANPA 1RTQA 2PJ7A 4X3RA 5HXDA 3BI1A 4EFDA 3BI0A 3FECA 2BCOA 3S9LA 4ONWA 4OC5A 4R8FA 5HVGA 3NA6A 4MHNA 3SI0A 5HVFA 5K8MA 1YLOA 3HUVA 4F8ZA 3H8FA 3KL9A 4MCQA 3VH9A 4OC2A 4DYOA 4KSIA 1YMEA 4B6ZA 2IQ6A 4Z65A 1NSAA 1JQGA 2ZENA 2NSMA 4X2TA 3KHXA 4OIWA 5D29A 3DLJA 1CX8A 4NGSA 1Y0YA 1H8LA 3IO1A 3FVLA 5F09A 3WT4A 2ZEMA 3PB6X 1BPNA 3FH4A 4P45A 4PXEA 2GU2A 3B35A 2RB7A 1F2OA 3IFEA 4DJLA 1YSJA 3DGVA 2EWBA 3RAMA 4P10A 3KASA 4W9YA 4UEEA 1F57A 1HDQA 5J1QA 1VHOA 1ZG7A 1ZG9A 1CP6A 1BAVA 4OC0A 3RZAA 5K8OA 1HEEA 4X8IA 4ZY0A 3H8GA 4O23A 1BPMA 1TF8A 2PJAA 2V8GA 4MXUA 1UWYA 3KQZA 2Q43A 2DEAA 3SJEA 1IY7A 3CDXA 2HC9A 2ZEDA 4MRIA 2XEFA 2O4HA 2CIJA 4P6YA 4YU9A 2GLJA 3HLPA 5D8NA 2V77A 3SI1A 1XFOA 4GM5A 4UEFA 3KZWA 2JEWA 1R43A 4WWVA 3D66A 1LAPA 4OIDA 4CPAA 1CP7A 4R6TA 2PIYA 1YW4A 2BOAA 2FVGA 4UIBA 1ZLHA 4NJQA 3IWWA 3D7GA 5CPAA 3GUXA 8CPAA 2OOTA 4JZ0A 2C6PA 3QNVA 2PJ0A 1QMUA 2PVWA 4FWUA 4NGPA 4NGQA 2AFWA 1CPSA 4PXBA
chains in the Genus database with same CATH superfamily
5T6BA 1GYTA 3CD61 1DE4C 3IWEA 3CPAA 3HOWI 2W04A 1IB1E 3FBUA 2ZEEA 4QVTA 2JA7I 2ATRA 3JRUA 4A38A 5C4JI 1TF9A 2CF4A 3SJXA 2Z3LA 2BL1A 4NGNA 1NP6A 3MZLB 3IJ3A 3IF8A 2J8NA 3M4OI 2CTBA 3D2LA 1MK4A 4Q7AA 3BXMA 3CPWY 3R9GA 3PRTA 2Z11A 1M902 1TWHI 1ELMP 4A3GI 4PK3A 3L2NA 2DF5A 1TWAI 4P4EA 1YQEA 4PXDA 3FX6A 3VB9A 3GYAA 2J8MA 3K2KA 4S1TA 3I561 4PV6A 2E2HI 1X12A 1KQSY 2Z0ZA 1VHEA 1ZG8A 2VUGA 3K7AI 1K8A2 2G3AA 1Z4EA 3S6KA 2ZEGA 1IYLA 4KVME 1TIQA 3QB8A 3EEDA 3TO9A 1QVFZ 1AMPA 3PFOA 4LQ6A 4CYNA 1VQMZ 2B3UA 2VEZA 4TWEA 3MGDA 1YJWZ 1FNOA 3KI9A 4BBSI 2Z3MA 2C6CA 3FEDA 2RHBA 4DK1A 1BO4A 2PDOA 5H86A 3B3VA 4ZY2A 5ELYA 1S7MA 1FY7A 5HH1A 2V8HA 4NGMA 1ARLA 3GB0A 2QKDA 2HB6A 4NBCA 2V8VA 2OR4A 4EMEA 2AFXA 2XEIA 3GTMI 2HF1A 1Q7Y2 3CCL1 4QC6A 3B3TA 3B3SA 3KR5A 7CPAA 1LFWA 2NVTI 1VQP1 3GCFA 1K732 4J3GA 2G2KA 4LUAA 5LYDA 4MY0A 3NH8A 2CNMA 1SIWA 1KC81 3GTQI 4E0AA 1YHQZ 4P44A 4JYWA 3T4NB 4ZI6A 1KD12 4KLVA 2XEJA 2CY2A 3TTHA 1XBUA 3SXNA 4A2ZA 1KUVA 4PSXA 4MMOA 2CNSA 3IC1A 2PJ8A 4ZX8A 2AJ6A 3PB4X 4K3NA 2M6NA 1TKHA 4M6IA 3CCJZ 4XNHB 2Q0YA 1VGYA 2PJBA 2VPXA 3TE4A 2EK9A 4E2ZA 2QJ8A 3JTKA 4YGOA 4MCSA 3G3SA 3IFUA 4PK2A 4IHMA 1Q821 2X7BA 2WPXA 4R3KA 1NJI2 4UF4A 1K4JA 5LRJA 3TDHB 1YVKA 4EWTA 5G20A 3V8IA 3NE8A 4EWCA 2C6GA 4BMHA 2O53A 4G1PA 2WPWA 3PFEA 1NMTA 2E9HA 4A3II 4ZX9A 2E2II 4A39A 1LRZA 3KGQA 3G4SZ 2OTL1 1YI21 2B5GB 2HU9A 3PB8X 1RO0A 2POKA 3B3WA 5JPHA 2Z10A 4R76A 2JBKA 4RN7A 1VQ7Z 5CNPA 4GS4A 4XPLA 5F47A 1VIXA 3P5JB 4DQYB 4HH4A 2ZXVA 4AYBA 4JXRA 3D7FA 2Y0MA 2RIQA 3IIBA 1VQ51 4CAXA 2PJ7A 4X3RA 2GTHA 4EFDA 3BI0A 2C27A 1XEBA 2BCOA 1ZB8A 4ONWA 1Q2DA 4OC5A 4NXYA 5D1PA 3NA6A 4B10A 5BWAB 3SI0A 1I21A 2JIQA 3CCV1 1YLOA 3KL9A 2E7ZA 3T9YA 4EVYA 5IT9b 4DYOA 4KSIA 1YMEA 4CS0B 4Z65A 4NBEA 4CYQA 3DR8A 3MONA 1PU9A 1PFTA 3SXOA 4KLWA 1YGHA 4II9A 2KI7B 4A3DI 4NGSA 5F09A 4RVGA 1IU8A 3J80b 1ML8A 3TOAA 3FH4A 3NDIA 2GE3A 1QVGZ 1BOBA 1F2OA 3GTGI 4UCMA 3S6HA 1IICA 2I00A 5J1QA 3GTKI 2GTIA 2CXAA 4F0YA 1ZG9A 1CP6A 2OZGA 4OC0A 4FD6A 3G6E1 2VZZA 1HEEA 2ZW6A 1WWZA 3FXTA 4O23A 2OZUA 3LACA 1TF8A 3Q87A 2Q43A 1JJ2Z 4MFPA 3CDXA 3D8PA 1B6BA 4XX2A 4BY7I 1VQK1 4XPKA 1X10A 4YU9A 4UBRA 2JLMA 5FVJA 4CGLA 1Y7RA 3BG1B 5AG6A 1Y1VS 2ZW5A 4A3CI 3W6XA 4UEFA 2YNEA 4WWVA 3D66A 3ZZIA 5CM2M 4CL1A 3PZJA 3CCQZ 3RO0A 3S1NI 3IWWA 3D7GA 5CPAA 2G3TA 8CPAA 3KKWA 1GHEA 5T67A 3G8WA 2PJ0A 2IZ3A 3W6SA 4CRZB 5IP7I 1Q812 4NGPA 4MBUA 2QREB 2AFWA 2PMZA 1Z01A 3I4MI 3KIFA 4M85A 5G1ZA 2GFQA 1S3ZA 4ZY1A 2OH1A 4MHPA 2D4OA 4A94A 3EERA 1DL6A 1QVFY 4HGZA 1Z2LA 3T8WA 3FIXA 2J6AA 3IU2A 1RXTA 2QYVA 4NBFA 2VPZA 1TKJA 4TNUA 3QAYA 1VQ4Z 5FLXf 1B87A 2JEVA 4MY3A 2JDDA 4PPZA 4P4FA 5DS0A 4M3SA 3CC41 1P9NA 1P4NA 1R57A 2Z3OA 1USPA 4NGTA 1QXFA 2NVQI 1WW9A 4PSWA 3IWGA 4MCPA 2FCKA 4PQAA 3FJUA 3RZOI 4F6AA 1F2PA 2FT0A 2P0WA 3GKQA 3NFZA 2PJ1A 5EMIA 3CXQA 3CXSA 1Y8CA 4WJBA 1TWFI 3PB9X 3CCRZ 1KD11 4MFZA 1VQN1 2LFUA 2PRQA 1N8R1 3H8EA 2RT9A 1I50I 2DE6A 4AVBA 2AFZA 3ISXA 3EO4A 3S1MI 4KOVA 5J8CA 3FF3A 2RFHA 3TOBA 1Z03A 1TXRA 2LEXA 3FEEA 3CC2Z 3EC4A 4OAEA 1TWGI 2J8RA 4P4BA 4UFVA 4KOWA 3VARA 4BBHA 2PJ5A 1YK3A 2W03A 3N5FA 4KSAA 2ARHA 3I1UA 2R93I 4OC1A 4QB9A 1R9TI 4UFWA 5F46A 3CXCZ 5DWNA 2F7VA 4MHYA 3S17I 1FDIA 2PJ4A 1M4IA 2FS5A 4R9MA 3NDJA 5J8FA 2Q04A 5AG7A 2ZOGA 1BLLE 1YUAA 3KQXA 1S721 1Z9UA 1WCMI 1KUXA 4Y49B 1XRYA 4B14A 4C2ZA 3LMSA 3CMA1 5K8PA 4CYPA 1QQ9A 3G6EZ 1OBRA 3D7DA 1Z02A 2ODFA 4H6ZA 1M4GA 1XE4A 2EGTA 4IUSA 4U9ZA 4XPDB 4NCZA 2PC1A 4F9UA 2F5IA 4KOSA 3H0GI 3D2PA 5AG4A 2V8IA 1USPB 4C2YA 1FT7A 2YNCA 3U50C 4HNYB 4MD8A 1YIT1 3VATA 1XJOA 2AFSA 1I12A 2F4OA 3OW2Z 4RVFA 1LAMA 2EO8A 3CCMZ 2VXKA 1VQOZ 3J81b 1Y1WI 2ZELA 4FBEA 4A3KI 2I3CA 2PK7A 4NB8A 2QEX1 4P4JA 4KSFA 3GLJA 5LYLA 2B5GA 3SHPA 3D68A 1Y9KA 1Z4RA 3I3GA 2Q7SA 1Q7LA 5IX3A 4E32A 2O28A 5LL6f 3PO2I 5GCNA 3KHZA 4A3FI 4UA3A 3TCVA 3IX0A 1AA6A 4UIAA 1ELLP 4XNHC 4QUSA 3GTLI 5HXDA 3BI1A 5AG5A 4QBJA 3CCE1 1CM0A 2P6FA 2QRDB 1YVOA 3S9LA 4KOUA 4AVCA 4R8FA 1VQ91 2OU2A 4NSQA 3CC4Z 4JJXA 2B4BA 4MHNA 3D3SA 2AKLA 3G71Z 1M1DA 1M44A 4GXHA 1Z8XA 1IYKA 3H8FA 5EBVA 1JJ2Y 2Z3KA 4B6ZA 2IQ6A 1NSAA 3EFAA 1JQGA 2ZENA 2NSMA 4C7HA 4U9YA 1K9M2 3DLJA 5A28A 1H8LA 1M1K2 4CYOA 3WR7A 4NBDA 1VQNZ 3CCU1 2QIRA 3CCS1 5F49A 2P6GA 5C44I 3IFEA 1VQ6Z 2EWBA 4MHDA 4A3BI 3KASA 1VHOA 1ZG7A 1UFHA 1BAVA 1A2ZA 5K8OA 1Q862 4NH1C 4ZY0A 4B12A 2PJAA 4RS4A 2V8GA 1UWYA 2DEAA 3SJEA 1IY7A 3BLNA 5F48A 3IU1A 3S6FA 2CIJA 4P6YA 1RNIA 1Y1VI 3CD6Z 1VQL1 5EC4A 3DNSA 5D8NA 3SI1A 1QSTA 1XFOA 4GM5A 5G22A 3KZWA 2PR1A 2JEWA 1R43A 3H5ZA 2ZAEB 2QRCB 1IIDA 1JWQA 3CPWZ 2FL4A 4UIBA 4NJQA 1Q2CA 2K3RA 3GUXA 2DPTA 3K9UA 4KOYA 2OOTA 2C6PA 2PR8A 1WZNA 1QMUA 5I0CA 2E2JI 4FWUA 3TFYA 3ZJ0A 1CPSA 4PXBA 2ZPAA 3D7HA 4NJRA 5IV0A 2QECA 1YJ91 2H85A 4KUBA 4JWPA 4RUHA 1IOIA 4QTUA 3I56Z 5JQ4A 3R1KA 2VPYA 3RBUA 2REEA 2JNYA 1QSOA 4MCRA 2ZW7A 4NB9A 4UEZA 4PXCA 1XMTA 3CC71 1N2FA 2RPRA 3VMIA 1ARMA 4F9VA 1HDUA 2BUEA 4OC4A 4NOZA 1N71A 3WC5A 5LRKA 4C68A 4CAWA 2IV2X 2BSWA 2AFMA 1AYEA 3D6WA 2WSAA 4IK2A 1IGBA 2C1CA 4H2KA 2K5TA 4A95A 4BINA 2GREA 5LYIA 5A2Qb 3F0AA 4DUKA 3S6GA 3I4NI 3J80f 2VPWA 1Z8TA 1CPXA 2JBJA 2WZNA 3KR4A 2YADA 1YR0A 1ZLIA 2B58A 1M901 3CCEZ 3SJFA 3CCLZ 5KTDA 2ZEOA 3ISZA 1VQ9Z 2OTJ1 3B8GA 1RO5A 1YW6A 4A37A 1VQPZ 1XMBA 3MZKB 2JDCA 2F4MA 3LD2A 4RI1A 1S60A 2PCUA 1KC82 2FSRA 5CBMA 2VI7A 2Q4VA 4FAIA 1K8A1 2QA41 3RYOA 2R8VA 3C26A 2JA8I 2FIWA 4OADA 4A3JI 1YLEA 3B3CA 5JGFA 3F3FC 3OW2Y 3EXNA 1VQM1 3HOZI 2HQYA 3S15I 1W2BZ 3M3YI 4Q38A 1YJW1 2HUZA 4H6UA 3CXPA 2PJ2A 5C4XI 1M4LA 4AG7A 1S7NA 2Q51A 5C88A 1CG2A 4E2WA 1Q822 3HOVI 4A31A 2PM9A 3I9SA 4UCNA 2AFOA 4I49A 4MI4A 1Y7EA 2XEGA 3PBEA 3VMHA 4A3EI 1NUIA 1R3NA 2BJOA 4MFLA 3V38A 4OKOA 2LIYA 4P4IA 4R87A 3WC6A 4RVDA 2PJ6A 3HOUI 2V8JA 2D4PA 2OTLZ 2PJ9A 2V8DA 1YI2Z 2IZ4A 1Q7Y1 1PCAA 5LRGA 2DPSA 3KIHA 2HV2A 4K30A 4ZGYB 1K731 1RLYA 1KRLA 2ABZA 1I6HI 2ZOFA 4ORFA 2AE6A 3PEIA 3D4UA 2V45A 3GTJI 2PJ3A 4H89A 3B7IA 1VQ5Z 1S7KA 5FLMI 3QWUA 3JAMb 3I551 4CAFA 1K9M1 3FQQA 2DXQA 3TX8A 1S5KA 1M1K1 3E0KA 3S14I 4M6HA 4MONA 4CGOA 1X3WA 3CCVZ 3WABA 3NH5A 2R92I 2R6MA 3W91A 2G0BA 2ZEPA 3V7ZA 4IAVA 3MRUA 1V0CA 2BEIA 1NJI1 2V8KA 4NBHA 3TC8A 2Y0SA 3P2FA 1Z5RA 4IF5A 3PO3S 4MFKA 2DE5A 1MJ9A 3R96A 1MJBA 5HVGA 4A30A 4L8AA 2CNTA 5HVFA 4B11A 3JUWA 3HUVA 1YUKA 4E31A 4UFXA 4ZBGA 4OC2A 2WUUA 1VQ71 2FIAA 3LUSA 3S2DI 4A33A 3VWEA 2B4DB 4X2TA 4HPSA 4YFJA 4OIWA 5D29A 4X6AI 1Y0YA 1VQ81 4MH4A 3WT4A 1VQKZ 4HNWB 1BPNA 1YJN1 5HMNA 4P45A 1S7FA 4B5PB 2B63I 2P28A 4NEXA 4DJLA 1L0CA 1YSJA 3DGVA 2VF1A 1RQFA 4DNCA 2OTJZ 2Z3PA 4UEEA 1F57A 5ISVA 3T90A 4JLYA 4KVOE 3RZAA 3PP9A 1Q2YA 4X8IA 2FXFA 4FD4A 3H8GA 1BPMA 2QA4Z 3KQZA 4KVXA 4HGYA 2HC9A 2ZEDA 1K83I 3FKII 4MRIA 2XEFA 3R9EA 2GLJA 4A3MI 1PUAA 3HLPA 2NAPA 1AUGA 3DDDA 3RNZA 4U5YA 4E33A 1Y9WA 1ZH1A 3FYNA 4AG9A 4NBAA 1SFOI 1WK4A 4CPAA 3TE5B 1QVGY 1CP7A 1ON0A 4R6TA 2WB1A 2BOAA 4CAVA 2FVGA 4A93I 1ZLHA 3J81f 3VTNA 1ZB9A 2YNCC 4JZ0A 3CQZI 3QNVA 2VZYA 2PVWA 2JMOA 4MFJA 4AVAA 2J9AA 3D9XA 2I79A 2YNDA 2NYQA 2QMLA 3FMCA 4OMEA 4ONUA 2PE3A 3D67A 3LODA 3HKZA 3ESWA 4UWJA 3BHXA 4Q36A 2IJZA 1Z8LA 2PIZA 3CCQ1 1WJ2A 3HOYI 2OZKA 1VKCA 3QAHA 3SJGA 4JXQA 1I1DA 3TO7A 5E96A 1YIJ1 1Q811 3BJ7A 3I55Z 1N8R2 5C3EI 2WYRA 5K8NA 3GTPI 2GANA 1EE3P 2P3YA 1RO2A 2RC4A 1XOVA 3J7A4 2V3VA 3VWDA 4FD5A 2JA6I 2PRBA 3MN8A 2NMTA 1LCPA 2GIVA 2PJCA 4MHZA 1CBXA 5LYFA 4RV9A 3NE7A 3S1RI 2K5RA 1W2BY 1LANA 3CPXA 1VQ41 2ZEHA 1NE9A 3R9FA 3TT2A 3H4QA 1OZPA 5JH9A 6CPAA 3S1QI 4AXVA 3F5BA 5C82A 1S72Z 3CZXA 2QLVB 1X0TA 3GTOI 2JS4A 4A3LI 1TFIA 2G9DA 3CMAZ 4MFQA 2KPIA 2IMOA 4A32A 1Y0RA 2OB0A 2R7HA 3S9MA 4CGPA 1JWHC 3SI2A 3CME1 2EK8A 3CT9A 2PQ8A 3UY5A 1IOFA 4HNXB 1VQ8Z 4P4DA 1KQSZ 3CCR1 1Z8WA 4FD7A 3OWCA 4CAEA 1YJNZ 5AN9F 4M6GA 2Q4YA 2PVVA 3K9TA 4Y52I 1XIXA 3GTMS 3WC7A 4E2YA 2Q4ZA 1YITZ 2OOXB 1SQHA 2GLFA 4R57A 4NBGA 1LOKA 1DTDA 3DSBA 3CC21 4NGRA 4BXXI 3B2YA 3GKRA 1KWMA 1PYTB 4KOXA 3I07A 2DE7A 5IB9A 3LWUA 4BBRI 2A4NA 1QSRA 1L1OC 2ZEFA 4R3LA 2QEXZ 2P6EA 2QR1B 2QVPA 3BJ8A 4KUAA 1J4JA 2NVXI 3IEHA 1MJAA 2JA5I 3N7ZA 4KORA 2AYDA 4OC3A 2F8HA 5IT9f 1X3ZA 5HVHA 4DGLA 1QSMA 3NH4A 4RVHA 3CXCY 3PB7X 4R7MA 4UCPA 4NFRA 4KZTA 4MJ8A 4MD9A 5I4MA 2AFUA 4LQGA 2EBJA 3IR7A 5G21A 2BO9A 1CJWA 4OP4A 3EY5A 3PBBA 3HOXI 3P2HA 2YU9I 2EVNA 4C2XA 4BD9A 1TKFA 3S2HI 2VL1A 3S9NA 4FUUA 5THWA 2H5MA 1TWCI 2EUIA 4ZYQA 3TO6A 2ZW4A 4YWYA 5D1OA 5JM6A 1VLAA 1Q16A 5A2Qf 5DWMA 4C7IA 1P0HA 1S7LA 2Q7BA 5IP9I 2VQYA 3PO3I 3CCM1 5H84A 3FQMA 2CTCA 2ANPA 5IB0A 2JIRA 1VQO1 1RTQA 4JD6A 2OZHA 4B5OA 5FLXb 3FECA 2R1IA 1XF8A 1YIJZ 3CCUZ 1QF8A 3PGPA 3CCSZ 4X5KA 2JR6A 2KCWA 4L89A 1ZO0A 4KS9A 2NVYI 3DR6A 5K8MA 2B3VA 4AB7A 4F8ZA 4MCQA 2JIMA 3VH9A 2IL4A 2Z3NA 2B4DA 4BY1I 1KZFA 4E2XA 1KUYA 1M4DA 3KHXA 1QSNA 2R98A 1CX8A 1WIIA 3IO1A 3FVLA 4Y7NI 2M48A 2ZEMA 4NBBA 2VBQA 3PB6X 1NSLA 3R95A 4B5PA 4CRYB 4PXEA 1QYPA 2GU2A 3B35A 1FDOA 1YREA 3FRMA 4B13A 1LQLA 1VQLZ 2RB7A 2JIPA 3JVNA 4LX9A 5T64A 3GIUA 3G711 2R7ZI 3RAMA 4P10A 2YGWA 4W9YA 1HDQA 4KOTA 4OLLA 1I3QI 1YHQ1 4CGNA 4CGMA 2JIOA 4RS2A 3RZDI 2PSWA 5A27A 4MXUA 2FE7A 1RO4A 3A9LA 3CMEZ 4Y49C 3IGRA 4YRHA 5AGEA 2OOYB 2RBLA 2O4HA 4NF1A 2JUBA 3S16I 4UWIA 3CCJ1 1YJ9Z 2VUMI 2V77A 5KTAA 4E30A 1VQ61 4XPDC 5D1OB 3VMGA 3FNCA 1LAPA 4OIDA 3F8KA 3D2MA 1YX0A 3GY9A 2WAQA 5KTCA 4MD7A 2PIYA 1Q861 1YW4A 3FB3A 3JAMf 3CC7Z 4E2AA 4F0XA 4HKFA 1U6MA 2Q44A 4QTTA 3H3VJ 2REFA 4NGQA 1VHSA 3BG0B 3F3PC 4E8OA 3G4S1
chains in the Genus database with same CATH topology
3I4MI 2J9AA 3KIFA 5T6BA 3D7HA 1GYTA 4NJRA 3D9XA 3CD61 1YJ91 2H85A 1DE4C 2NYQA 3FMCA 4OMEA 4ZY1A 4RUHA 4QTUA 3CPAA 2PE3A 3HOWI 3I56Z 3D67A 4MHPA 2W04A 4A94A 3EERA 1DL6A 2ZEEA 3RBUA 3HKZA 1QVFY 2JA7I 3ESWA 4HGZA 1Z2LA 3T8WA 3BHXA 2J6AA 3JRUA 4A38A 2JNYA 2IJZA 4PXBA 5C4JI 1Z8LA 2PIZA 1TF9A 3CCQ1 2CF4A 4MCRA 3HOYI 2QYVA 3SJXA 4NBFA 4NGNA 4NB9A 2OZKA 4UEZA 1NP6A 1TKJA 4PXCA 4TNUA 3MZLB 1VQ4Z 5FLXf 3SJGA 3IJ3A 3IF8A 3CC71 1N2FA 3M4OI 2RPRA 2CTBA 3VMIA 1ARMA 1YIJ1 1Q811 4F9VA 1HDUA 3I55Z 1N8R2 4PPZA 4Q7AA 5C3EI 4P4FA 2WYRA 3BXMA 5K8NA 3CPWY 3GTPI 3PRTA 5DS0A 3CC41 1M902 1EE3P 1TWHI 1ELMP 4OC4A 4A3GI 4NOZA 1P9NA 3WC5A 2P3YA 1RO2A 3L2NA 1USPA 3J7A4 1TWAI 5LRKA 4NGTA 4P4EA 2NVQI 4PXDA 2JA6I 3FX6A 3VB9A 2AFMA 1AYEA 3K2KA 3MN8A 1WW9A 3D6WA 4S1TA 4IK2A 3I561 1IGBA 2E2HI 2C1CA 1LCPA 2PJCA 1KQSY 4MCPA 4H2KA 4PQAA 1VHEA 3FJUA 4MHZA 3RZOI 1CBXA 1ZG8A 1F2PA 2VUGA 2GREA 5LYIA 3K7AI 4RV9A 5A2Qb 1K8A2 5LYFA 3GKQA 3NFZA 2PJ1A 3S1RI 2K5RA 1W2BY 4DUKA 2ZEGA 4WJBA 1TWFI 1LANA 3I4NI 3CPXA 1VQ41 2ZEHA 3J80f 3EEDA 3PB9X 3CCRZ 1QVFZ 1KD11 1CPXA 1VQN1 2LFUA 2JBJA 2WZNA 1AMPA 2PRQA 2YADA 1N8R1 2RT9A 3H8EA 3KR4A 1I50I 1VQMZ 3PFOA 2DE6A 1ZLIA 1M901 5JH9A 3CCEZ 4TWEA 2AFZA 6CPAA 3ISXA 3CCLZ 1YJWZ 3SJFA 2ZEOA 3S1QI 1FNOA 3ISZA 4AXVA 1VQ9Z 2OTJ1 1YW6A 4A37A 3KI9A 1VQPZ 4BBSI 1XMBA 1S72Z 3MZKB 3S1MI 2QLVB 2C6CA 1X0TA 3FF3A 3GTOI 2JS4A 2F4MA 4A3LI 2RFHA 1TFIA 1Z03A 1TXRA 3FEEA 2G9DA 3CMAZ 3FEDA 2RHBA 3CC2Z 2KPIA 1TWGI 2IMOA 4DK1A 3B3VA 2PCUA 1KC82 4ZY2A 1Y0RA 5CBMA 4P4BA 5ELYA 1S7MA 3S9MA 3VARA 4FAIA 1K8A1 2QA41 2PJ5A 2W03A 1JWHC 3SI2A 2V8HA 3CME1 2EK8A 3N5FA 4NGMA 1ARLA 3I1UA 2R93I 4OC1A 2JA8I 3GB0A 3CT9A 2QKDA 1R9TI 2HB6A 1VQ8Z 4A3JI 4P4DA 1KQSZ 3CXCZ 5JGFA 3B3CA 4NBCA 3CCR1 2F7VA 4MHYA 2V8VA 3F3FC 3S17I 2OR4A 4EMEA 1YJNZ 3OW2Y 2AFXA 2XEIA 1VQM1 5AN9F 3HOZI 2PJ4A 3GTMI 2HF1A 1Q7Y2 3S15I 1W2BZ 3M3YI 2PVVA 3K9TA 3CCL1 1YJW1 4Y52I 3B3TA 3NDJA 3GTMS 3B3SA 4E2YA 2Q4ZA 3KR5A 3WC7A 1YITZ 2ZOGA 1BLLE 7CPAA 2OOXB 1LFWA 1YUAA 2NVTI 3KQXA 1VQP1 2GLFA 1S721 2PJ2A 5C4XI 1WCMI 4NBGA 3GCFA 1M4LA 1LOKA 1K732 2G2KA 1DTDA 1XRYA 2Q51A 5LYDA 3NH8A 3LMSA 3CMA1 3CC21 4NGRA 1KC81 4BXXI 4E2WA 1CG2A 3B2YA 1Q822 3HOVI 2PM9A 5K8PA 3GTQI 1KWMA 1PYTB 1YHQZ 2AFOA 3I07A 2DE7A 5IB9A 4P44A 1QQ9A 3G6EZ 1OBRA 1Y7EA 1Z02A 2XEGA 3D7DA 4JYWA 3LWUA 4BBRI 3T4NB 3PBEA 3VMHA 4A3EI 4ZI6A 1NUIA 1KD12 1L1OC 1R3NA 2ZEFA 2BJOA 2XEJA 3V38A 4OKOA 2EGTA 2LIYA 4P4IA 1XBUA 2QEXZ 2QR1B 2QVPA 4F9UA 3WC6A 2NVXI 3H0GI 4RVDA 3IEHA 4MMOA 2PJ6A 3HOUI 2V8JA 2JA5I 2V8IA 2OTLZ 2PJ9A 3IC1A 2V8DA 1YI2Z 2IZ4A 1Q7Y1 1PCAA 2F8HA 2PJ8A 4OC3A 4ZX8A 5LRGA 1USPB 3PB4X 4K3NA 5IT9f 1X3ZA 2M6NA 1FT7A 1TKHA 3U50C 3CCJZ 5HVHA 1VGYA 3KIHA 2PJBA 4MD8A 4DGLA 3NH4A 4RVHA 1YIT1 3CXCY 1XJOA 3VATA 2EK9A 4E2ZA 2QJ8A 1K731 2AFSA 4MCSA 1RLYA 2F4OA 3OW2Z 3PB7X 3IFUA 1KRLA 2ABZA 4R7MA 1I6HI 4RVFA 4IHMA 1Q821 2ZOFA 1LAMA 3PEIA 4NFRA 1NJI2 3D4UA 3GTJI 4MD9A 2PJ3A 4UF4A 5LRJA 5I4MA 2AFUA 3B7IA 4LQGA 1VQ5Z 3TDHB 5FLMI 3CCMZ 3QWUA 2BO9A 1VQOZ 4OP4A 3J81b 1Y1WI 3JAMb 2ZELA 4EWTA 4FBEA 4A3KI 3I551 3PBBA 4EWCA 2I3CA 2C6GA 2PK7A 2O53A 1K9M1 4G1PA 3FQQA 4NB8A 3PFEA 3HOXI 2E9HA 2QEX1 4A3II 4ZX9A 3TX8A 2E2II 4P4JA 2YU9I 4A39A 1M1K1 3S14I 3GLJA 4BD9A 1TKFA 5LYLA 3KGQA 3S2HI 2VL1A 3G4SZ 3S9NA 4FUUA 3D68A 2OTL1 5THWA 4MONA 1YI21 1TWCI 1X3WA 3CCVZ 4ZYQA 2HU9A 3WABA 3PB8X 1RO0A 3NH5A 2POKA 1Q7LA 2R92I 3B3WA 4E32A 2R6MA 4R76A 4YWYA 5D1OA 5JM6A 1VLAA 2JBKA 2ZEPA 5LL6f 1VQ7Z 3PO2I 5A2Qf 3V7ZA 4IAVA 3KHZA 4A3FI 3IX0A 1VIXA 3MRUA 3P5JB 4DQYB 1NJI1 4HH4A 4AYBA 2V8KA 5IP9I 4NBHA 4UIAA 3TC8A 3PO3I 1ELLP 3D7FA 2Y0SA 2RIQA 3IIBA 1VQ51 1Z5RA 3CCM1 3FQMA 2CTCA 2ANPA 1VQO1 3GTLI 3PO3S 1RTQA 2PJ7A 4X3RA 3BI1A 2DE5A 2GTHA 5FLXb 4EFDA 5HXDA 3BI0A 3FECA 2BCOA 3CCE1 3CCUZ 1YIJZ 1QF8A 2QRDB 1ZB8A 3CCSZ 3S9LA 4ONWA 4OC5A 4R8FA 2JR6A 5HVGA 1VQ91 5D1PA 3NA6A 1CPSA 3CC4Z 4MHNA 2AKLA 3G71Z 2NVYI 3SI0A 3CCV1 5HVFA 5K8MA 1YLOA 1YUKA 3HUVA 4F8ZA 3H8FA 3KL9A 4E31A 4MCQA 3VH9A 1JJ2Y 4OC2A 5IT9b 4DYOA 4KSIA 1YMEA 4B6ZA 1VQ71 2IQ6A 4BY1I 4Z65A 3LUSA 4NBEA 1NSAA 3MONA 3S2DI 1JQGA 4E2XA 2ZENA 1PFTA 2NSMA 4X2TA 3KHXA 4OIWA 5D29A 1K9M2 2KI7B 4X6AI 3DLJA 1CX8A 1WIIA 4A3DI 1Y0YA 1VQ81 4NGSA 4MH4A 1H8LA 3FVLA 3IO1A 4Y7NI 5F09A 3WT4A 4RVGA 2M48A 2ZEMA 4NBBA 1M1K2 1VQKZ 3PB6X 1BPNA 1YJN1 3J80b 1ML8A 3FH4A 4P45A 3NDIA 4PXEA 1QYPA 2GU2A 4NBDA 1VQNZ 3CCU1 3B35A 1QVGZ 2B63I 2P28A 3CCS1 1LQLA 1VQLZ 2RB7A 1F2OA 5C44I 3IFEA 4DJLA 3GTGI 1YSJA 3DGVA 2VF1A 5T64A 1VQ6Z 1RQFA 2EWBA 3G711 2OTJZ 2R7ZI 3RAMA 4P10A 4A3BI 3KASA 4W9YA 4UEEA 1F57A 1HDQA 5J1QA 3GTKI 1VHOA 1ZG7A 2GTIA 1ZG9A 1CP6A 1BAVA 4OC0A 3RZAA 1I3QI 1YHQ1 5K8OA 1Q862 3G6E1 4NH1C 1HEEA 4X8IA 3RZDI 4ZY0A 3H8GA 4O23A 1BPMA 4RS4A 1TF8A 2QA4Z 2PJAA 2V8GA 4MXUA 1UWYA 3KQZA 1RO4A 3Q87A 4HGYA 3CMEZ 2Q43A 1JJ2Z 2DEAA 3SJEA 1IY7A 3CDXA 2HC9A 2ZEDA 1K83I 3FKII 4XX2A 2OOYB 4BY7I 2RBLA 1VQK1 4MRIA 2XEFA 2O4HA 2CIJA 4P6YA 4YU9A 1RNIA 2JUBA 2GLJA 4A3MI 1Y1VI 3S16I 3BG1B 3CD6Z 3CCJ1 3HLPA 1YJ9Z 1VQL1 2VUMI 1Y1VS 5D8NA 2V77A 3SI1A 4E30A 4E33A 1XFOA 1ZH1A 4A3CI 1VQ61 4GM5A 4UEFA 3KZWA 2JEWA 1R43A 4NBAA 5D1OB 4WWVA 1SFOI 3VMGA 3D66A 1LAPA 2ZAEB 4OIDA 3TE5B 4CPAA 5CM2M 2QRCB 1QVGY 1CP7A 2WAQA 4CL1A 3CCQZ 4MD7A 4R6TA 2PIYA 1Q861 3S1NI 2WB1A 3CPWZ 1YW4A 2BOAA 2FVGA 4UIBA 4A93I 1ZLHA 4NJQA 3IWWA 3J81f 3D7GA 3JAMf 5CPAA 2K3RA 3GUXA 3VTNA 3CC7Z 8CPAA 1ZB9A 2OOTA 4JZ0A 2C6PA 3CQZI 5T67A 3QNVA 4QTTA 3H3VJ 2PJ0A 2IZ3A 1QMUA 5IP7I 1Q812 2PVWA 2E2JI 4FWUA 4NGPA 4NGQA 3BG0B 2JMOA 2QREB 2AFWA 2PMZA 3F3PC 1Z01A 3G4S1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9A A;  3D7H A;  1GYT A;  4NJR A;  1DE4 C;  2NYQ A;  3FMC A;  4OME A;  4ZY1 A;  4RUH A;  3CPA A;  2PE3 A;  3D67 A;  4MHP A;  4A94 A;  2ZEE A;  3RBU A;  1Z2L A;  3T8W A;  3BHX A;  3JRU A;  4A38 A;  2IJZ A;  1Z8L A;  2PIZ A;  1TF9 A;  4MCR A;  2CF4 A;  2QYV A;  3SJX A;  4NGN A;  4UEZ A;  1TKJ A;  4PXC A;  4TNU A;  3SJG A;  3IJ3 A;  2CTB A;  1ARM A;  4F9V A;  1HDU A;  4PPZ A;  4Q7A A;  4P4F A;  2WYR A;  3BXM A;  5K8N A;  3PRT A;  5DS0 A;  1EE3 P;  1ELM P;  4OC4 A;  3WC5 A;  3L2N A;  5LRK A;  4NGT A;  4P4E A;  4PXD A;  3FX6 A;  2AFM A;  1AYE A;  3K2K A;  3MN8 A;  4IK2 A;  1IGB A;  2C1C A;  1LCP A;  2PJC A;  4MCP A;  4H2K A;  4PQA A;  1VHE A;  3FJU A;  4MHZ A;  1CBX A;  1ZG8 A;  1F2P A;  2GRE A;  5LYI A;  5LYF A;  3NFZ A;  2PJ1 A;  4DUK A;  2ZEG A;  4WJB A;  1LAN A;  3CPX A;  2ZEH A;  3PB9 X;  1CPX A;  2JBJ A;  2WZN A;  3KR4 A;  1AMP A;  2PRQ A;  3H8E A;  3PFO A;  1ZLI A;  5JH9 A;  4TWE A;  2AFZ A;  6CPA A;  3ISX A;  3SJF A;  2ZEO A;  1FNO A;  3ISZ A;  4AXV A;  1YW6 A;  4A37 A;  3KI9 A;  1XMB A;  2C6C A;  3FF3 A;  2RFH A;  1TXR A;  3FEE A;  2G9D A;  3FED A;  2IMO A;  3B3V A;  2PCU A;  4ZY2 A;  1Y0R A;  5CBM A;  4P4B A;  5ELY A;  3S9M A;  3VAR A;  4FAI A;  2PJ5 A;  3SI2 A;  2V8H A;  2EK8 A;  4NGM A;  3N5F A;  1ARL A;  3I1U A;  4OC1 A;  3GB0 A;  3CT9 A;  2HB6 A;  4P4D A;  5JGF A;  3B3C A;  2F7V A;  4MHY A;  2V8V A;  2OR4 A;  4EME A;  2AFX A;  2XEI A;  2PJ4 A;  2PVV A;  3K9T A;  3B3T A;  3B3S A;  3KR5 A;  3WC7 A;  2Q4Z A;  2ZOG A;  1BLL E;  7CPA A;  1LFW A;  3KQX A;  2GLF A;  2PJ2 A;  1M4L A;  1LOK A;  1DTD A;  1XRY A;  2Q51 A;  5LYD A;  3NH8 A;  3LMS A;  4NGR A;  1CG2 A;  3B2Y A;  5K8P A;  1KWM A;  1PYT B;  2AFO A;  5IB9 A;  4P44 A;  1QQ9 A;  1OBR A;  1Y7E A;  3D7D A;  2XEG A;  4JYW A;  3LWU A;  3PBE A;  4ZI6 A;  2ZEF A;  1R3N A;  2XEJ A;  3V38 A;  4OKO A;  4P4I A;  1XBU A;  2QVP A;  4F9U A;  3WC6 A;  4MMO A;  3IEH A;  2PJ6 A;  2PJ9 A;  3IC1 A;  2V8D A;  4OC3 A;  1PCA A;  2PJ8 A;  2F8H A;  4ZX8 A;  5LRG A;  4K3N A;  3PB4 X;  1FT7 A;  1TKH A;  5HVH A;  1VGY A;  2PJB A;  3NH4 A;  3VAT A;  1XJO A;  2EK9 A;  2QJ8 A;  2AFS A;  4MCS A;  3PB7 X;  2ABZ A;  4R7M A;  4IHM A;  2ZOF A;  1LAM A;  3PEI A;  4NFR A;  3D4U A;  2PJ3 A;  4UF4 A;  5LRJ A;  5I4M A;  2AFU A;  3B7I A;  4LQG A;  2BO9 A;  4OP4 A;  4EWT A;  2ZEL A;  4FBE A;  3PBB A;  2I3C A;  2C6G A;  2O53 A;  4G1P A;  3PFE A;  4ZX9 A;  3TX8 A;  4P4J A;  4A39 A;  3GLJ A;  4BD9 A;  1TKF A;  5LYL A;  3KGQ A;  2VL1 A;  3S9N A;  4FUU A;  3D68 A;  5THW A;  4ZYQ A;  3WAB A;  3PB8 X;  3NH5 A;  2POK A;  1Q7L A;  3B3W A;  4R76 A;  4YWY A;  5JM6 A;  2JBK A;  2ZEP A;  3V7Z A;  4IAV A;  3KHZ A;  1VIX A;  3MRU A;  4UIA A;  3TC8 A;  1ELL P;  3D7F A;  3IIB A;  1Z5R A;  2CTC A;  2ANP A;  1RTQ A;  2PJ7 A;  4X3R A;  5HXD A;  3BI1 A;  4EFD A;  3BI0 A;  3FEC A;  2BCO A;  3S9L A;  4ONW A;  4OC5 A;  4R8F A;  5HVG A;  3NA6 A;  4MHN A;  3SI0 A;  5HVF A;  5K8M A;  1YLO A;  3HUV A;  4F8Z A;  3H8F A;  3KL9 A;  4MCQ A;  3VH9 A;  4OC2 A;  4DYO A;  4KSI A;  1YME A;  4B6Z A;  2IQ6 A;  4Z65 A;  1NSA A;  1JQG A;  2ZEN A;  2NSM A;  4X2T A;  3KHX A;  4OIW A;  5D29 A;  3DLJ A;  1CX8 A;  4NGS A;  1Y0Y A;  1H8L A;  3IO1 A;  3FVL A;  5F09 A;  3WT4 A;  2ZEM A;  3PB6 X;  1BPN A;  3FH4 A;  4P45 A;  4PXE A;  2GU2 A;  3B35 A;  2RB7 A;  1F2O A;  3IFE A;  4DJL A;  1YSJ A;  3DGV A;  2EWB A;  3RAM A;  4P10 A;  3KAS A;  4W9Y A;  4UEE A;  1F57 A;  1HDQ A;  5J1Q A;  1VHO A;  1ZG7 A;  1ZG9 A;  1CP6 A;  1BAV A;  4OC0 A;  3RZA A;  5K8O A;  1HEE A;  4X8I A;  4ZY0 A;  3H8G A;  4O23 A;  1BPM A;  1TF8 A;  2PJA A;  2V8G A;  4MXU A;  1UWY A;  3KQZ A;  2Q43 A;  2DEA A;  3SJE A;  1IY7 A;  3CDX A;  2HC9 A;  2ZED A;  4MRI A;  2XEF A;  2O4H A;  2CIJ A;  4P6Y A;  4YU9 A;  2GLJ A;  3HLP A;  5D8N A;  2V77 A;  3SI1 A;  1XFO A;  4GM5 A;  4UEF A;  3KZW A;  2JEW A;  1R43 A;  4WWV A;  3D66 A;  1LAP A;  4OID A;  4CPA A;  1CP7 A;  4R6T A;  2PIY A;  1YW4 A;  2BOA A;  2FVG A;  4UIB A;  1ZLH A;  4NJQ A;  3IWW A;  3D7G A;  5CPA A;  3GUX A;  8CPA A;  2OOT A;  4JZ0 A;  2C6P A;  3QNV A;  2PJ0 A;  1QMU A;  2PVW A;  4FWU A;  4NGP A;  4NGQ A;  2AFW A;  1CPS A;  4PXB A; 
#chains in the Genus database with same CATH topology
 5T6B A;  1GYT A;  3CD6 1;  1DE4 C;  3IWE A;  3CPA A;  3HOW I;  2W04 A;  1IB1 E;  3FBU A;  2ZEE A;  4QVT A;  2JA7 I;  2ATR A;  3JRU A;  4A38 A;  5C4J I;  1TF9 A;  2CF4 A;  3SJX A;  2Z3L A;  2BL1 A;  4NGN A;  1NP6 A;  3MZL B;  3IJ3 A;  3IF8 A;  2J8N A;  3M4O I;  2CTB A;  3D2L A;  1MK4 A;  4Q7A A;  3BXM A;  3CPW Y;  3R9G A;  3PRT A;  2Z11 A;  1M90 2;  1TWH I;  1ELM P;  4A3G I;  4PK3 A;  3L2N A;  2DF5 A;  1TWA I;  4P4E A;  1YQE A;  4PXD A;  3FX6 A;  3VB9 A;  3GYA A;  2J8M A;  3K2K A;  4S1T A;  3I56 1;  4PV6 A;  2E2H I;  1X12 A;  1KQS Y;  2Z0Z A;  1VHE A;  1ZG8 A;  2VUG A;  3K7A I;  1K8A 2;  2G3A A;  1Z4E A;  3S6K A;  2ZEG A;  1IYL A;  4KVM E;  1TIQ A;  3QB8 A;  3EED A;  3TO9 A;  1QVF Z;  1AMP A;  3PFO A;  4LQ6 A;  4CYN A;  1VQM Z;  2B3U A;  2VEZ A;  4TWE A;  3MGD A;  1YJW Z;  1FNO A;  3KI9 A;  4BBS I;  2Z3M A;  2C6C A;  3FED A;  2RHB A;  4DK1 A;  1BO4 A;  2PDO A;  5H86 A;  3B3V A;  4ZY2 A;  5ELY A;  1S7M A;  1FY7 A;  5HH1 A;  2V8H A;  4NGM A;  1ARL A;  3GB0 A;  2QKD A;  2HB6 A;  4NBC A;  2V8V A;  2OR4 A;  4EME A;  2AFX A;  2XEI A;  3GTM I;  2HF1 A;  1Q7Y 2;  3CCL 1;  4QC6 A;  3B3T A;  3B3S A;  3KR5 A;  7CPA A;  1LFW A;  2NVT I;  1VQP 1;  3GCF A;  1K73 2;  4J3G A;  2G2K A;  4LUA A;  5LYD A;  4MY0 A;  3NH8 A;  2CNM A;  1SIW A;  1KC8 1;  3GTQ I;  4E0A A;  1YHQ Z;  4P44 A;  4JYW A;  3T4N B;  4ZI6 A;  1KD1 2;  4KLV A;  2XEJ A;  2CY2 A;  3TTH A;  1XBU A;  3SXN A;  4A2Z A;  1KUV A;  4PSX A;  4MMO A;  2CNS A;  3IC1 A;  2PJ8 A;  4ZX8 A;  2AJ6 A;  3PB4 X;  4K3N A;  2M6N A;  1TKH A;  4M6I A;  3CCJ Z;  4XNH B;  2Q0Y A;  1VGY A;  2PJB A;  2VPX A;  3TE4 A;  2EK9 A;  4E2Z A;  2QJ8 A;  3JTK A;  4YGO A;  4MCS A;  3G3S A;  3IFU A;  4PK2 A;  4IHM A;  1Q82 1;  2X7B A;  2WPX A;  4R3K A;  1NJI 2;  4UF4 A;  1K4J A;  5LRJ A;  3TDH B;  1YVK A;  4EWT A;  5G20 A;  3V8I A;  3NE8 A;  4EWC A;  2C6G A;  4BMH A;  2O53 A;  4G1P A;  2WPW A;  3PFE A;  1NMT A;  2E9H A;  4A3I I;  4ZX9 A;  2E2I I;  4A39 A;  1LRZ A;  3KGQ A;  3G4S Z;  2OTL 1;  1YI2 1;  2B5G B;  2HU9 A;  3PB8 X;  1RO0 A;  2POK A;  3B3W A;  5JPH A;  2Z10 A;  4R76 A;  2JBK A;  4RN7 A;  1VQ7 Z;  5CNP A;  4GS4 A;  4XPL A;  5F47 A;  1VIX A;  3P5J B;  4DQY B;  4HH4 A;  2ZXV A;  4AYB A;  4JXR A;  3D7F A;  2Y0M A;  2RIQ A;  3IIB A;  1VQ5 1;  4CAX A;  2PJ7 A;  4X3R A;  2GTH A;  4EFD A;  3BI0 A;  2C27 A;  1XEB A;  2BCO A;  1ZB8 A;  4ONW A;  1Q2D A;  4OC5 A;  4NXY A;  5D1P A;  3NA6 A;  4B10 A;  5BWA B;  3SI0 A;  1I21 A;  2JIQ A;  3CCV 1;  1YLO A;  3KL9 A;  2E7Z A;  3T9Y A;  4EVY A;  5IT9 b;  4DYO A;  4KSI A;  1YME A;  4CS0 B;  4Z65 A;  4NBE A;  4CYQ A;  3DR8 A;  3MON A;  1PU9 A;  1PFT A;  3SXO A;  4KLW A;  1YGH A;  4II9 A;  2KI7 B;  4A3D I;  4NGS A;  5F09 A;  4RVG A;  1IU8 A;  3J80 b;  1ML8 A;  3TOA A;  3FH4 A;  3NDI A;  2GE3 A;  1QVG Z;  1BOB A;  1F2O A;  3GTG I;  4UCM A;  3S6H A;  1IIC A;  2I00 A;  5J1Q A;  3GTK I;  2GTI A;  2CXA A;  4F0Y A;  1ZG9 A;  1CP6 A;  2OZG A;  4OC0 A;  4FD6 A;  3G6E 1;  2VZZ A;  1HEE A;  2ZW6 A;  1WWZ A;  3FXT A;  4O23 A;  2OZU A;  3LAC A;  1TF8 A;  3Q87 A;  2Q43 A;  1JJ2 Z;  4MFP A;  3CDX A;  3D8P A;  1B6B A;  4XX2 A;  4BY7 I;  1VQK 1;  4XPK A;  1X10 A;  4YU9 A;  4UBR A;  2JLM A;  5FVJ A;  4CGL A;  1Y7R A;  3BG1 B;  5AG6 A;  1Y1V S;  2ZW5 A;  4A3C I;  3W6X A;  4UEF A;  2YNE A;  4WWV A;  3D66 A;  3ZZI A;  5CM2 M;  4CL1 A;  3PZJ A;  3CCQ Z;  3RO0 A;  3S1N I;  3IWW A;  3D7G A;  5CPA A;  2G3T A;  8CPA A;  3KKW A;  1GHE A;  5T67 A;  3G8W A;  2PJ0 A;  2IZ3 A;  3W6S A;  4CRZ B;  5IP7 I;  1Q81 2;  4NGP A;  4MBU A;  2QRE B;  2AFW A;  2PMZ A;  1Z01 A;  3I4M I;  3KIF A;  4M85 A;  5G1Z A;  2GFQ A;  1S3Z A;  4ZY1 A;  2OH1 A;  4MHP A;  2D4O A;  4A94 A;  3EER A;  1DL6 A;  1QVF Y;  4HGZ A;  1Z2L A;  3T8W A;  3FIX A;  2J6A A;  3IU2 A;  1RXT A;  2QYV A;  4NBF A;  2VPZ A;  1TKJ A;  4TNU A;  3QAY A;  1VQ4 Z;  5FLX f;  1B87 A;  2JEV A;  4MY3 A;  2JDD A;  4PPZ A;  4P4F A;  5DS0 A;  4M3S A;  3CC4 1;  1P9N A;  1P4N A;  1R57 A;  2Z3O A;  1USP A;  4NGT A;  1QXF A;  2NVQ I;  1WW9 A;  4PSW A;  3IWG A;  4MCP A;  2FCK A;  4PQA A;  3FJU A;  3RZO I;  4F6A A;  1F2P A;  2FT0 A;  2P0W A;  3GKQ A;  3NFZ A;  2PJ1 A;  5EMI A;  3CXQ A;  3CXS A;  1Y8C A;  4WJB A;  1TWF I;  3PB9 X;  3CCR Z;  1KD1 1;  4MFZ A;  1VQN 1;  2LFU A;  2PRQ A;  1N8R 1;  3H8E A;  2RT9 A;  1I50 I;  2DE6 A;  4AVB A;  2AFZ A;  3ISX A;  3EO4 A;  3S1M I;  4KOV A;  5J8C A;  3FF3 A;  2RFH A;  3TOB A;  1Z03 A;  1TXR A;  2LEX A;  3FEE A;  3CC2 Z;  3EC4 A;  4OAE A;  1TWG I;  2J8R A;  4P4B A;  4UFV A;  4KOW A;  3VAR A;  4BBH A;  2PJ5 A;  1YK3 A;  2W03 A;  3N5F A;  4KSA A;  2ARH A;  3I1U A;  2R93 I;  4OC1 A;  4QB9 A;  1R9T I;  4UFW A;  5F46 A;  3CXC Z;  5DWN A;  2F7V A;  4MHY A;  3S17 I;  1FDI A;  2PJ4 A;  1M4I A;  2FS5 A;  4R9M A;  3NDJ A;  5J8F A;  2Q04 A;  5AG7 A;  2ZOG A;  1BLL E;  1YUA A;  3KQX A;  1S72 1;  1Z9U A;  1WCM I;  1KUX A;  4Y49 B;  1XRY A;  4B14 A;  4C2Z A;  3LMS A;  3CMA 1;  5K8P A;  4CYP A;  1QQ9 A;  3G6E Z;  1OBR A;  3D7D A;  1Z02 A;  2ODF A;  4H6Z A;  1M4G A;  1XE4 A;  2EGT A;  4IUS A;  4U9Z A;  4XPD B;  4NCZ A;  2PC1 A;  4F9U A;  2F5I A;  4KOS A;  3H0G I;  3D2P A;  5AG4 A;  2V8I A;  1USP B;  4C2Y A;  1FT7 A;  2YNC A;  3U50 C;  4HNY B;  4MD8 A;  1YIT 1;  3VAT A;  1XJO A;  2AFS A;  1I12 A;  2F4O A;  3OW2 Z;  4RVF A;  1LAM A;  2EO8 A;  3CCM Z;  2VXK A;  1VQO Z;  3J81 b;  1Y1W I;  2ZEL A;  4FBE A;  4A3K I;  2I3C A;  2PK7 A;  4NB8 A;  2QEX 1;  4P4J A;  4KSF A;  3GLJ A;  5LYL A;  2B5G A;  3SHP A;  3D68 A;  1Y9K A;  1Z4R A;  3I3G A;  2Q7S A;  1Q7L A;  5IX3 A;  4E32 A;  2O28 A;  5LL6 f;  3PO2 I;  5GCN A;  3KHZ A;  4A3F I;  4UA3 A;  3TCV A;  3IX0 A;  1AA6 A;  4UIA A;  1ELL P;  4XNH C;  4QUS A;  3GTL I;  5HXD A;  3BI1 A;  5AG5 A;  4QBJ A;  3CCE 1;  1CM0 A;  2P6F A;  2QRD B;  1YVO A;  3S9L A;  4KOU A;  4AVC A;  4R8F A;  1VQ9 1;  2OU2 A;  4NSQ A;  3CC4 Z;  4JJX A;  2B4B A;  4MHN A;  3D3S A;  2AKL A;  3G71 Z;  1M1D A;  1M44 A;  4GXH A;  1Z8X A;  1IYK A;  3H8F A;  5EBV A;  1JJ2 Y;  2Z3K A;  4B6Z A;  2IQ6 A;  1NSA A;  3EFA A;  1JQG A;  2ZEN A;  2NSM A;  4C7H A;  4U9Y A;  1K9M 2;  3DLJ A;  5A28 A;  1H8L A;  1M1K 2;  4CYO A;  3WR7 A;  4NBD A;  1VQN Z;  3CCU 1;  2QIR A;  3CCS 1;  5F49 A;  2P6G A;  5C44 I;  3IFE A;  1VQ6 Z;  2EWB A;  4MHD A;  4A3B I;  3KAS A;  1VHO A;  1ZG7 A;  1UFH A;  1BAV A;  1A2Z A;  5K8O A;  1Q86 2;  4NH1 C;  4ZY0 A;  4B12 A;  2PJA A;  4RS4 A;  2V8G A;  1UWY A;  2DEA A;  3SJE A;  1IY7 A;  3BLN A;  5F48 A;  3IU1 A;  3S6F A;  2CIJ A;  4P6Y A;  1RNI A;  1Y1V I;  3CD6 Z;  1VQL 1;  5EC4 A;  3DNS A;  5D8N A;  3SI1 A;  1QST A;  1XFO A;  4GM5 A;  5G22 A;  3KZW A;  2PR1 A;  2JEW A;  1R43 A;  3H5Z A;  2ZAE B;  2QRC B;  1IID A;  1JWQ A;  3CPW Z;  2FL4 A;  4UIB A;  4NJQ A;  1Q2C A;  2K3R A;  3GUX A;  2DPT A;  3K9U A;  4KOY A;  2OOT A;  2C6P A;  2PR8 A;  1WZN A;  1QMU A;  5I0C A;  2E2J I;  4FWU A;  3TFY A;  3ZJ0 A;  1CPS A;  4PXB A;  2ZPA A;  3D7H A;  4NJR A;  5IV0 A;  2QEC A;  1YJ9 1;  2H85 A;  4KUB A;  4JWP A;  4RUH A;  1IOI A;  4QTU A;  3I56 Z;  5JQ4 A;  3R1K A;  2VPY A;  3RBU A;  2REE A;  2JNY A;  1QSO A;  4MCR A;  2ZW7 A;  4NB9 A;  4UEZ A;  4PXC A;  1XMT A;  3CC7 1;  1N2F A;  2RPR A;  3VMI A;  1ARM A;  4F9V A;  1HDU A;  2BUE A;  4OC4 A;  4NOZ A;  1N71 A;  3WC5 A;  5LRK A;  4C68 A;  4CAW A;  2IV2 X;  2BSW A;  2AFM A;  1AYE A;  3D6W A;  2WSA A;  4IK2 A;  1IGB A;  2C1C A;  4H2K A;  2K5T A;  4A95 A;  4BIN A;  2GRE A;  5LYI A;  5A2Q b;  3F0A A;  4DUK A;  3S6G A;  3I4N I;  3J80 f;  2VPW A;  1Z8T A;  1CPX A;  2JBJ A;  2WZN A;  3KR4 A;  2YAD A;  1YR0 A;  1ZLI A;  2B58 A;  1M90 1;  3CCE Z;  3SJF A;  3CCL Z;  5KTD A;  2ZEO A;  3ISZ A;  1VQ9 Z;  2OTJ 1;  3B8G A;  1RO5 A;  1YW6 A;  4A37 A;  1VQP Z;  1XMB A;  3MZK B;  2JDC A;  2F4M A;  3LD2 A;  4RI1 A;  1S60 A;  2PCU A;  1KC8 2;  2FSR A;  5CBM A;  2VI7 A;  2Q4V A;  4FAI A;  1K8A 1;  2QA4 1;  3RYO A;  2R8V A;  3C26 A;  2JA8 I;  2FIW A;  4OAD A;  4A3J I;  1YLE A;  3B3C A;  5JGF A;  3F3F C;  3OW2 Y;  3EXN A;  1VQM 1;  3HOZ I;  2HQY A;  3S15 I;  1W2B Z;  3M3Y I;  4Q38 A;  1YJW 1;  2HUZ A;  4H6U A;  3CXP A;  2PJ2 A;  5C4X I;  1M4L A;  4AG7 A;  1S7N A;  2Q51 A;  5C88 A;  1CG2 A;  4E2W A;  1Q82 2;  3HOV I;  4A31 A;  2PM9 A;  3I9S A;  4UCN A;  2AFO A;  4I49 A;  4MI4 A;  1Y7E A;  2XEG A;  3PBE A;  3VMH A;  4A3E I;  1NUI A;  1R3N A;  2BJO A;  4MFL A;  3V38 A;  4OKO A;  2LIY A;  4P4I A;  4R87 A;  3WC6 A;  4RVD A;  2PJ6 A;  3HOU I;  2V8J A;  2D4P A;  2OTL Z;  2PJ9 A;  2V8D A;  1YI2 Z;  2IZ4 A;  1Q7Y 1;  1PCA A;  5LRG A;  2DPS A;  3KIH A;  2HV2 A;  4K30 A;  4ZGY B;  1K73 1;  1RLY A;  1KRL A;  2ABZ A;  1I6H I;  2ZOF A;  4ORF A;  2AE6 A;  3PEI A;  3D4U A;  2V45 A;  3GTJ I;  2PJ3 A;  4H89 A;  3B7I A;  1VQ5 Z;  1S7K A;  5FLM I;  3QWU A;  3JAM b;  3I55 1;  4CAF A;  1K9M 1;  3FQQ A;  2DXQ A;  3TX8 A;  1S5K A;  1M1K 1;  3E0K A;  3S14 I;  4M6H A;  4MON A;  4CGO A;  1X3W A;  3CCV Z;  3WAB A;  3NH5 A;  2R92 I;  2R6M A;  3W91 A;  2G0B A;  2ZEP A;  3V7Z A;  4IAV A;  3MRU A;  1V0C A;  2BEI A;  1NJI 1;  2V8K A;  4NBH A;  3TC8 A;  2Y0S A;  3P2F A;  1Z5R A;  4IF5 A;  3PO3 S;  4MFK A;  2DE5 A;  1MJ9 A;  3R96 A;  1MJB A;  5HVG A;  4A30 A;  4L8A A;  2CNT A;  5HVF A;  4B11 A;  3JUW A;  3HUV A;  1YUK A;  4E31 A;  4UFX A;  4ZBG A;  4OC2 A;  2WUU A;  1VQ7 1;  2FIA A;  3LUS A;  3S2D I;  4A33 A;  3VWE A;  2B4D B;  4X2T A;  4HPS A;  4YFJ A;  4OIW A;  5D29 A;  4X6A I;  1Y0Y A;  1VQ8 1;  4MH4 A;  3WT4 A;  1VQK Z;  4HNW B;  1BPN A;  1YJN 1;  5HMN A;  4P45 A;  1S7F A;  4B5P B;  2B63 I;  2P28 A;  4NEX A;  4DJL A;  1L0C A;  1YSJ A;  3DGV A;  2VF1 A;  1RQF A;  4DNC A;  2OTJ Z;  2Z3P A;  4UEE A;  1F57 A;  5ISV A;  3T90 A;  4JLY A;  4KVO E;  3RZA A;  3PP9 A;  1Q2Y A;  4X8I A;  2FXF A;  4FD4 A;  3H8G A;  1BPM A;  2QA4 Z;  3KQZ A;  4KVX A;  4HGY A;  2HC9 A;  2ZED A;  1K83 I;  3FKI I;  4MRI A;  2XEF A;  3R9E A;  2GLJ A;  4A3M I;  1PUA A;  3HLP A;  2NAP A;  1AUG A;  3DDD A;  3RNZ A;  4U5Y A;  4E33 A;  1Y9W A;  1ZH1 A;  3FYN A;  4AG9 A;  4NBA A;  1SFO I;  1WK4 A;  4CPA A;  3TE5 B;  1QVG Y;  1CP7 A;  1ON0 A;  4R6T A;  2WB1 A;  2BOA A;  4CAV A;  2FVG A;  4A93 I;  1ZLH A;  3J81 f;  3VTN A;  1ZB9 A;  2YNC C;  4JZ0 A;  3CQZ I;  3QNV A;  2VZY A;  2PVW A;  2JMO A;  4MFJ A;  4AVA A;  2J9A A;  3D9X A;  2I79 A;  2YND A;  2NYQ A;  2QML A;  3FMC A;  4OME A;  4ONU A;  2PE3 A;  3D67 A;  3LOD A;  3HKZ A;  3ESW A;  4UWJ A;  3BHX A;  4Q36 A;  2IJZ A;  1Z8L A;  2PIZ A;  3CCQ 1;  1WJ2 A;  3HOY I;  2OZK A;  1VKC A;  3QAH A;  3SJG A;  4JXQ A;  1I1D A;  3TO7 A;  5E96 A;  1YIJ 1;  1Q81 1;  3BJ7 A;  3I55 Z;  1N8R 2;  5C3E I;  2WYR A;  5K8N A;  3GTP I;  2GAN A;  1EE3 P;  2P3Y A;  1RO2 A;  2RC4 A;  1XOV A;  3J7A 4;  2V3V A;  3VWD A;  4FD5 A;  2JA6 I;  2PRB A;  3MN8 A;  2NMT A;  1LCP A;  2GIV A;  2PJC A;  4MHZ A;  1CBX A;  5LYF A;  4RV9 A;  3NE7 A;  3S1R I;  2K5R A;  1W2B Y;  1LAN A;  3CPX A;  1VQ4 1;  2ZEH A;  1NE9 A;  3R9F A;  3TT2 A;  3H4Q A;  1OZP A;  5JH9 A;  6CPA A;  3S1Q I;  4AXV A;  3F5B A;  5C82 A;  1S72 Z;  3CZX A;  2QLV B;  1X0T A;  3GTO I;  2JS4 A;  4A3L I;  1TFI A;  2G9D A;  3CMA Z;  4MFQ A;  2KPI A;  2IMO A;  4A32 A;  1Y0R A;  2OB0 A;  2R7H A;  3S9M A;  4CGP A;  1JWH C;  3SI2 A;  3CME 1;  2EK8 A;  3CT9 A;  2PQ8 A;  3UY5 A;  1IOF A;  4HNX B;  1VQ8 Z;  4P4D A;  1KQS Z;  3CCR 1;  1Z8W A;  4FD7 A;  3OWC A;  4CAE A;  1YJN Z;  5AN9 F;  4M6G A;  2Q4Y A;  2PVV A;  3K9T A;  4Y52 I;  1XIX A;  3GTM S;  3WC7 A;  4E2Y A;  2Q4Z A;  1YIT Z;  2OOX B;  1SQH A;  2GLF A;  4R57 A;  4NBG A;  1LOK A;  1DTD A;  3DSB A;  3CC2 1;  4NGR A;  4BXX I;  3B2Y A;  3GKR A;  1KWM A;  1PYT B;  4KOX A;  3I07 A;  2DE7 A;  5IB9 A;  3LWU A;  4BBR I;  2A4N A;  1QSR A;  1L1O C;  2ZEF A;  4R3L A;  2QEX Z;  2P6E A;  2QR1 B;  2QVP A;  3BJ8 A;  4KUA A;  1J4J A;  2NVX I;  3IEH A;  1MJA A;  2JA5 I;  3N7Z A;  4KOR A;  2AYD A;  4OC3 A;  2F8H A;  5IT9 f;  1X3Z A;  5HVH A;  4DGL A;  1QSM A;  3NH4 A;  4RVH A;  3CXC Y;  3PB7 X;  4R7M A;  4UCP A;  4NFR A;  4KZT A;  4MJ8 A;  4MD9 A;  5I4M A;  2AFU A;  4LQG A;  2EBJ A;  3IR7 A;  5G21 A;  2BO9 A;  1CJW A;  4OP4 A;  3EY5 A;  3PBB A;  3HOX I;  3P2H A;  2YU9 I;  2EVN A;  4C2X A;  4BD9 A;  1TKF A;  3S2H I;  2VL1 A;  3S9N A;  4FUU A;  5THW A;  2H5M A;  1TWC I;  2EUI A;  4ZYQ A;  3TO6 A;  2ZW4 A;  4YWY A;  5D1O A;  5JM6 A;  1VLA A;  1Q16 A;  5A2Q f;  5DWM A;  4C7I A;  1P0H A;  1S7L A;  2Q7B A;  5IP9 I;  2VQY A;  3PO3 I;  3CCM 1;  5H84 A;  3FQM A;  2CTC A;  2ANP A;  5IB0 A;  2JIR A;  1VQO 1;  1RTQ A;  4JD6 A;  2OZH A;  4B5O A;  5FLX b;  3FEC A;  2R1I A;  1XF8 A;  1YIJ Z;  3CCU Z;  1QF8 A;  3PGP A;  3CCS Z;  4X5K A;  2JR6 A;  2KCW A;  4L89 A;  1ZO0 A;  4KS9 A;  2NVY I;  3DR6 A;  5K8M A;  2B3V A;  4AB7 A;  4F8Z A;  4MCQ A;  2JIM A;  3VH9 A;  2IL4 A;  2Z3N A;  2B4D A;  4BY1 I;  1KZF A;  4E2X A;  1KUY A;  1M4D A;  3KHX A;  1QSN A;  2R98 A;  1CX8 A;  1WII A;  3IO1 A;  3FVL A;  4Y7N I;  2M48 A;  2ZEM A;  4NBB A;  2VBQ A;  3PB6 X;  1NSL A;  3R95 A;  4B5P A;  4CRY B;  4PXE A;  1QYP A;  2GU2 A;  3B35 A;  1FDO A;  1YRE A;  3FRM A;  4B13 A;  1LQL A;  1VQL Z;  2RB7 A;  2JIP A;  3JVN A;  4LX9 A;  5T64 A;  3GIU A;  3G71 1;  2R7Z I;  3RAM A;  4P10 A;  2YGW A;  4W9Y A;  1HDQ A;  4KOT A;  4OLL A;  1I3Q I;  1YHQ 1;  4CGN A;  4CGM A;  2JIO A;  4RS2 A;  3RZD I;  2PSW A;  5A27 A;  4MXU A;  2FE7 A;  1RO4 A;  3A9L A;  3CME Z;  4Y49 C;  3IGR A;  4YRH A;  5AGE A;  2OOY B;  2RBL A;  2O4H A;  4NF1 A;  2JUB A;  3S16 I;  4UWI A;  3CCJ 1;  1YJ9 Z;  2VUM I;  2V77 A;  5KTA A;  4E30 A;  1VQ6 1;  4XPD C;  5D1O B;  3VMG A;  3FNC A;  1LAP A;  4OID A;  3F8K A;  3D2M A;  1YX0 A;  3GY9 A;  2WAQ A;  5KTC A;  4MD7 A;  2PIY A;  1Q86 1;  1YW4 A;  3FB3 A;  3JAM f;  3CC7 Z;  4E2A A;  4F0X A;  4HKF A;  1U6M A;  2Q44 A;  4QTT A;  3H3V J;  2REF A;  4NGQ A;  1VHS A;  3BG0 B;  3F3P C;  4E8O A;  3G4S 1; 
#chains in the Genus database with same CATH homology
 3I4M I;  2J9A A;  3KIF A;  5T6B A;  3D7H A;  1GYT A;  4NJR A;  3D9X A;  3CD6 1;  1YJ9 1;  2H85 A;  1DE4 C;  2NYQ A;  3FMC A;  4OME A;  4ZY1 A;  4RUH A;  4QTU A;  3CPA A;  2PE3 A;  3HOW I;  3I56 Z;  3D67 A;  4MHP A;  2W04 A;  4A94 A;  3EER A;  1DL6 A;  2ZEE A;  3RBU A;  3HKZ A;  1QVF Y;  2JA7 I;  3ESW A;  4HGZ A;  1Z2L A;  3T8W A;  3BHX A;  2J6A A;  3JRU A;  4A38 A;  2JNY A;  2IJZ A;  4PXB A;  5C4J I;  1Z8L A;  2PIZ A;  1TF9 A;  3CCQ 1;  2CF4 A;  4MCR A;  3HOY I;  2QYV A;  3SJX A;  4NBF A;  4NGN A;  4NB9 A;  2OZK A;  4UEZ A;  1NP6 A;  1TKJ A;  4PXC A;  4TNU A;  3MZL B;  1VQ4 Z;  5FLX f;  3SJG A;  3IJ3 A;  3IF8 A;  3CC7 1;  1N2F A;  3M4O I;  2RPR A;  2CTB A;  3VMI A;  1ARM A;  1YIJ 1;  1Q81 1;  4F9V A;  1HDU A;  3I55 Z;  1N8R 2;  4PPZ A;  4Q7A A;  5C3E I;  4P4F A;  2WYR A;  3BXM A;  5K8N A;  3CPW Y;  3GTP I;  3PRT A;  5DS0 A;  3CC4 1;  1M90 2;  1EE3 P;  1TWH I;  1ELM P;  4OC4 A;  4A3G I;  4NOZ A;  1P9N A;  3WC5 A;  2P3Y A;  1RO2 A;  3L2N A;  1USP A;  3J7A 4;  1TWA I;  5LRK A;  4NGT A;  4P4E A;  2NVQ I;  4PXD A;  2JA6 I;  3FX6 A;  3VB9 A;  2AFM A;  1AYE A;  3K2K A;  3MN8 A;  1WW9 A;  3D6W A;  4S1T A;  4IK2 A;  3I56 1;  1IGB A;  2E2H I;  2C1C A;  1LCP A;  2PJC A;  1KQS Y;  4MCP A;  4H2K A;  4PQA A;  1VHE A;  3FJU A;  4MHZ A;  3RZO I;  1CBX A;  1ZG8 A;  1F2P A;  2VUG A;  2GRE A;  5LYI A;  3K7A I;  4RV9 A;  5A2Q b;  1K8A 2;  5LYF A;  3GKQ A;  3NFZ A;  2PJ1 A;  3S1R I;  2K5R A;  1W2B Y;  4DUK A;  2ZEG A;  4WJB A;  1TWF I;  1LAN A;  3I4N I;  3CPX A;  1VQ4 1;  2ZEH A;  3J80 f;  3EED A;  3PB9 X;  3CCR Z;  1QVF Z;  1KD1 1;  1CPX A;  1VQN 1;  2LFU A;  2JBJ A;  2WZN A;  1AMP A;  2PRQ A;  2YAD A;  1N8R 1;  2RT9 A;  3H8E A;  3KR4 A;  1I50 I;  1VQM Z;  3PFO A;  2DE6 A;  1ZLI A;  1M90 1;  5JH9 A;  3CCE Z;  4TWE A;  2AFZ A;  6CPA A;  3ISX A;  3CCL Z;  1YJW Z;  3SJF A;  2ZEO A;  3S1Q I;  1FNO A;  3ISZ A;  4AXV A;  1VQ9 Z;  2OTJ 1;  1YW6 A;  4A37 A;  3KI9 A;  1VQP Z;  4BBS I;  1XMB A;  1S72 Z;  3MZK B;  3S1M I;  2QLV B;  2C6C A;  1X0T A;  3FF3 A;  3GTO I;  2JS4 A;  2F4M A;  4A3L I;  2RFH A;  1TFI A;  1Z03 A;  1TXR A;  3FEE A;  2G9D A;  3CMA Z;  3FED A;  2RHB A;  3CC2 Z;  2KPI A;  1TWG I;  2IMO A;  4DK1 A;  3B3V A;  2PCU A;  1KC8 2;  4ZY2 A;  1Y0R A;  5CBM A;  4P4B A;  5ELY A;  1S7M A;  3S9M A;  3VAR A;  4FAI A;  1K8A 1;  2QA4 1;  2PJ5 A;  2W03 A;  1JWH C;  3SI2 A;  2V8H A;  3CME 1;  2EK8 A;  3N5F A;  4NGM A;  1ARL A;  3I1U A;  2R93 I;  4OC1 A;  2JA8 I;  3GB0 A;  3CT9 A;  2QKD A;  1R9T I;  2HB6 A;  1VQ8 Z;  4A3J I;  4P4D A;  1KQS Z;  3CXC Z;  5JGF A;  3B3C A;  4NBC A;  3CCR 1;  2F7V A;  4MHY A;  2V8V A;  3F3F C;  3S17 I;  2OR4 A;  4EME A;  1YJN Z;  3OW2 Y;  2AFX A;  2XEI A;  1VQM 1;  5AN9 F;  3HOZ I;  2PJ4 A;  3GTM I;  2HF1 A;  1Q7Y 2;  3S15 I;  1W2B Z;  3M3Y I;  2PVV A;  3K9T A;  3CCL 1;  1YJW 1;  4Y52 I;  3B3T A;  3NDJ A;  3GTM S;  3B3S A;  4E2Y A;  2Q4Z A;  3KR5 A;  3WC7 A;  1YIT Z;  2ZOG A;  1BLL E;  7CPA A;  2OOX B;  1LFW A;  1YUA A;  2NVT I;  3KQX A;  1VQP 1;  2GLF A;  1S72 1;  2PJ2 A;  5C4X I;  1WCM I;  4NBG A;  3GCF A;  1M4L A;  1LOK A;  1K73 2;  2G2K A;  1DTD A;  1XRY A;  2Q51 A;  5LYD A;  3NH8 A;  3LMS A;  3CMA 1;  3CC2 1;  4NGR A;  1KC8 1;  4BXX I;  4E2W A;  1CG2 A;  3B2Y A;  1Q82 2;  3HOV I;  2PM9 A;  5K8P A;  3GTQ I;  1KWM A;  1PYT B;  1YHQ Z;  2AFO A;  3I07 A;  2DE7 A;  5IB9 A;  4P44 A;  1QQ9 A;  3G6E Z;  1OBR A;  1Y7E A;  1Z02 A;  2XEG A;  3D7D A;  4JYW A;  3LWU A;  4BBR I;  3T4N B;  3PBE A;  3VMH A;  4A3E I;  4ZI6 A;  1NUI A;  1KD1 2;  1L1O C;  1R3N A;  2ZEF A;  2BJO A;  2XEJ A;  3V38 A;  4OKO A;  2EGT A;  2LIY A;  4P4I A;  1XBU A;  2QEX Z;  2QR1 B;  2QVP A;  4F9U A;  3WC6 A;  2NVX I;  3H0G I;  4RVD A;  3IEH A;  4MMO A;  2PJ6 A;  3HOU I;  2V8J A;  2JA5 I;  2V8I A;  2OTL Z;  2PJ9 A;  3IC1 A;  2V8D A;  1YI2 Z;  2IZ4 A;  1Q7Y 1;  1PCA A;  2F8H A;  2PJ8 A;  4OC3 A;  4ZX8 A;  5LRG A;  1USP B;  3PB4 X;  4K3N A;  5IT9 f;  1X3Z A;  2M6N A;  1FT7 A;  1TKH A;  3U50 C;  3CCJ Z;  5HVH A;  1VGY A;  3KIH A;  2PJB A;  4MD8 A;  4DGL A;  3NH4 A;  4RVH A;  1YIT 1;  3CXC Y;  1XJO A;  3VAT A;  2EK9 A;  4E2Z A;  2QJ8 A;  1K73 1;  2AFS A;  4MCS A;  1RLY A;  2F4O A;  3OW2 Z;  3PB7 X;  3IFU A;  1KRL A;  2ABZ A;  4R7M A;  1I6H I;  4RVF A;  4IHM A;  1Q82 1;  2ZOF A;  1LAM A;  3PEI A;  4NFR A;  1NJI 2;  3D4U A;  3GTJ I;  4MD9 A;  2PJ3 A;  4UF4 A;  5LRJ A;  5I4M A;  2AFU A;  3B7I A;  4LQG A;  1VQ5 Z;  3TDH B;  5FLM I;  3CCM Z;  3QWU A;  2BO9 A;  1VQO Z;  4OP4 A;  3J81 b;  1Y1W I;  3JAM b;  2ZEL A;  4EWT A;  4FBE A;  4A3K I;  3I55 1;  3PBB A;  4EWC A;  2I3C A;  2C6G A;  2PK7 A;  2O53 A;  1K9M 1;  4G1P A;  3FQQ A;  4NB8 A;  3PFE A;  3HOX I;  2E9H A;  2QEX 1;  4A3I I;  4ZX9 A;  3TX8 A;  2E2I I;  4P4J A;  2YU9 I;  4A39 A;  1M1K 1;  3S14 I;  3GLJ A;  4BD9 A;  1TKF A;  5LYL A;  3KGQ A;  3S2H I;  2VL1 A;  3G4S Z;  3S9N A;  4FUU A;  3D68 A;  2OTL 1;  5THW A;  4MON A;  1YI2 1;  1TWC I;  1X3W A;  3CCV Z;  4ZYQ A;  2HU9 A;  3WAB A;  3PB8 X;  1RO0 A;  3NH5 A;  2POK A;  1Q7L A;  2R92 I;  3B3W A;  4E32 A;  2R6M A;  4R76 A;  4YWY A;  5D1O A;  5JM6 A;  1VLA A;  2JBK A;  2ZEP A;  5LL6 f;  1VQ7 Z;  3PO2 I;  5A2Q f;  3V7Z A;  4IAV A;  3KHZ A;  4A3F I;  3IX0 A;  1VIX A;  3MRU A;  3P5J B;  4DQY B;  1NJI 1;  4HH4 A;  4AYB A;  2V8K A;  5IP9 I;  4NBH A;  4UIA A;  3TC8 A;  3PO3 I;  1ELL P;  3D7F A;  2Y0S A;  2RIQ A;  3IIB A;  1VQ5 1;  1Z5R A;  3CCM 1;  3FQM A;  2CTC A;  2ANP A;  1VQO 1;  3GTL I;  3PO3 S;  1RTQ A;  2PJ7 A;  4X3R A;  3BI1 A;  2DE5 A;  2GTH A;  5FLX b;  4EFD A;  5HXD A;  3BI0 A;  3FEC A;  2BCO A;  3CCE 1;  3CCU Z;  1YIJ Z;  1QF8 A;  2QRD B;  1ZB8 A;  3CCS Z;  3S9L A;  4ONW A;  4OC5 A;  4R8F A;  2JR6 A;  5HVG A;  1VQ9 1;  5D1P A;  3NA6 A;  1CPS A;  3CC4 Z;  4MHN A;  2AKL A;  3G71 Z;  2NVY I;  3SI0 A;  3CCV 1;  5HVF A;  5K8M A;  1YLO A;  1YUK A;  3HUV A;  4F8Z A;  3H8F A;  3KL9 A;  4E31 A;  4MCQ A;  3VH9 A;  1JJ2 Y;  4OC2 A;  5IT9 b;  4DYO A;  4KSI A;  1YME A;  4B6Z A;  1VQ7 1;  2IQ6 A;  4BY1 I;  4Z65 A;  3LUS A;  4NBE A;  1NSA A;  3MON A;  3S2D I;  1JQG A;  4E2X A;  2ZEN A;  1PFT A;  2NSM A;  4X2T A;  3KHX A;  4OIW A;  5D29 A;  1K9M 2;  2KI7 B;  4X6A I;  3DLJ A;  1CX8 A;  1WII A;  4A3D I;  1Y0Y A;  1VQ8 1;  4NGS A;  4MH4 A;  1H8L A;  3FVL A;  3IO1 A;  4Y7N I;  5F09 A;  3WT4 A;  4RVG A;  2M48 A;  2ZEM A;  4NBB A;  1M1K 2;  1VQK Z;  3PB6 X;  1BPN A;  1YJN 1;  3J80 b;  1ML8 A;  3FH4 A;  4P45 A;  3NDI A;  4PXE A;  1QYP A;  2GU2 A;  4NBD A;  1VQN Z;  3CCU 1;  3B35 A;  1QVG Z;  2B63 I;  2P28 A;  3CCS 1;  1LQL A;  1VQL Z;  2RB7 A;  1F2O A;  5C44 I;  3IFE A;  4DJL A;  3GTG I;  1YSJ A;  3DGV A;  2VF1 A;  5T64 A;  1VQ6 Z;  1RQF A;  2EWB A;  3G71 1;  2OTJ Z;  2R7Z I;  3RAM A;  4P10 A;  4A3B I;  3KAS A;  4W9Y A;  4UEE A;  1F57 A;  1HDQ A;  5J1Q A;  3GTK I;  1VHO A;  1ZG7 A;  2GTI A;  1ZG9 A;  1CP6 A;  1BAV A;  4OC0 A;  3RZA A;  1I3Q I;  1YHQ 1;  5K8O A;  1Q86 2;  3G6E 1;  4NH1 C;  1HEE A;  4X8I A;  3RZD I;  4ZY0 A;  3H8G A;  4O23 A;  1BPM A;  4RS4 A;  1TF8 A;  2QA4 Z;  2PJA A;  2V8G A;  4MXU A;  1UWY A;  3KQZ A;  1RO4 A;  3Q87 A;  4HGY A;  3CME Z;  2Q43 A;  1JJ2 Z;  2DEA A;  3SJE A;  1IY7 A;  3CDX A;  2HC9 A;  2ZED A;  1K83 I;  3FKI I;  4XX2 A;  2OOY B;  4BY7 I;  2RBL A;  1VQK 1;  4MRI A;  2XEF A;  2O4H A;  2CIJ A;  4P6Y A;  4YU9 A;  1RNI A;  2JUB A;  2GLJ A;  4A3M I;  1Y1V I;  3S16 I;  3BG1 B;  3CD6 Z;  3CCJ 1;  3HLP A;  1YJ9 Z;  1VQL 1;  2VUM I;  1Y1V S;  5D8N A;  2V77 A;  3SI1 A;  4E30 A;  4E33 A;  1XFO A;  1ZH1 A;  4A3C I;  1VQ6 1;  4GM5 A;  4UEF A;  3KZW A;  2JEW A;  1R43 A;  4NBA A;  5D1O B;  4WWV A;  1SFO I;  3VMG A;  3D66 A;  1LAP A;  2ZAE B;  4OID A;  3TE5 B;  4CPA A;  5CM2 M;  2QRC B;  1QVG Y;  1CP7 A;  2WAQ A;  4CL1 A;  3CCQ Z;  4MD7 A;  4R6T A;  2PIY A;  1Q86 1;  3S1N I;  2WB1 A;  3CPW Z;  1YW4 A;  2BOA A;  2FVG A;  4UIB A;  4A93 I;  1ZLH A;  4NJQ A;  3IWW A;  3J81 f;  3D7G A;  3JAM f;  5CPA A;  2K3R A;  3GUX A;  3VTN A;  3CC7 Z;  8CPA A;  1ZB9 A;  2OOT A;  4JZ0 A;  2C6P A;  3CQZ I;  5T67 A;  3QNV A;  4QTT A;  3H3V J;  2PJ0 A;  2IZ3 A;  1QMU A;  5IP7 I;  1Q81 2;  2PVW A;  2E2J I;  4FWU A;  4NGP A;  4NGQ A;  3BG0 B;  2JMO A;  2QRE B;  2AFW A;  2PMZ A;  3F3P C;  1Z01 A;  3G4S 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...