4MRIA

Human brain aspartoacylase mutant f295s complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEASAKTTKLTLNAKSIRCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mriA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mriA01
2XEJA 3CPAA 2AFSA 4CPAA 4UEZA 3SJFA 8CPAA 3PFEA 2DEAA 3WC5A 4ZYQA 4NGQA 2EWBA 3HUVA 5F09A 3B7IA 5ELYA 4EMEA 2ZEFA 2PCUA 1BLLE 5HXDA 3SI0A 2ZEPA 2RFHA 3K2KA 1Z5RA 1Q7LA 1CG2A 4NJQA 1ZG7A 2PJ6A 5K8NA 4FWUA 3SI1A 2O53A 3PBEA 5JM6A 4FAIA 3D7FA 5LRGA 5LYFA 4Q7AA 4BD9A 1HEEA 4NGPA 2JBKA 3GLJA 1XBUA 3D66A 1Y0YA 2BCOA 3NH4A 4YWYA 5I4MA 3S9MA 1ELMP 2C1CA 3WC7A 4ONWA 3PEIA 3PB6X 2ZENA 3B3SA 4MXUA 2F7VA 4IHMA 1DE4C 6CPAA 3FECA 3TC8A 4MHNA 1ZLIA 3SJGA 2NSMA 2G9DA 5IB9A 2PJAA 4ZI6A 4P4JA 1H8LA 1NSAA 4NJRA 2V8GA 2WZNA 5HVHA 3GUXA 4ZY1A 4LQGA 4NGTA 3VATA 2PVVA 1AMPA 4OKOA 2EK9A 4UEEA 5JGFA 1ARMA 2C6GA 1IY7A 1BPNA 1YW6A 1TF8A 1EE3P 4OC3A 2GLFA 1LANA 2OR4A 3B2YA 3BI0A 3DLJA 3KR4A 3SI2A 3NFZA 3KHXA 3TX8A 3SJEA 2ZEOA 3FH4A 4W9YA 4IK2A 1ARLA 2ZEMA 3KHZA 3DGVA 4PQAA 2AFOA 3MRUA 1TKFA 2ZOFA 4R8FA 3KL9A 2EK8A 1GYTA 2IQ6A 2PJ3A 4K3NA 3HLPA 1LFWA 3NH8A 3PB9X 3N5FA 3B3WA 5THWA 4AXVA 2VL1A 2POKA 4MRIA 2HC9A 1AYEA 2XEIA 4UIAA 4DUKA 5HVFA 2AFXA 4ZX8A 2PJCA 2V8HA 3FEEA 1VGYA 3PBBA 2FVGA 4A38A 2I3CA 3BI1A 2C6CA 4MHPA 2PVWA 1UWYA 2ZEGA 4PXDA 2F8HA 4KSIA 4YU9A 4WJBA 4P4EA 2CF4A 4R7MA 4R6TA 2J9AA 4OC4A 4OC0A 4MHYA 4P44A 2XEFA 1BPMA 1FNOA 2WYRA 1Z2LA 3L2NA 3GB0A 5K8MA 3S9LA 3PRTA 1F57A 2V77A 2ZEEA 1Y0RA 4PXEA 3SJXA 1PCAA 2NYQA 3D4UA 3RZAA 5D8NA 4H2KA 1R43A 4NGNA 3WT4A 4DYOA 1XJOA 2OOTA 3D7DA 2GLJA 2ZEDA 4OP4A 4OIDA 1ZLHA 2BOAA 1ELLP 2ZEHA 2GU2A 4NGSA 1XFOA 4FBEA 2AFUA 1XRYA 3T8WA 2PJ8A 1YW4A 2AFWA 2JEWA 1TKJA 1CP7A 2PJ5A 2Q51A 4NFRA 2PJ2A 3FMCA 3D7HA 2PE3A 1LAMA 5LYIA 1LAPA 5K8PA 5LRKA 2QYVA 3I1UA 4TWEA 4F9VA 1F2PA 3KQXA 3CT9A 4F9UA 3B3VA 3WABA 4MMOA 4JYWA 3FJUA 1KWMA 1QQ9A 2CTBA 5LYLA 2PJ7A 4GM5A 1YSJA 2PJ4A 2PJ9A 4PXCA 4X8IA 4JZ0A 3KR5A 2V8DA 3IEHA 1LCPA 4UF4A 3CPXA 2V8VA 1M4LA 3FEDA 4P4IA 1FT7A 3IJ3A 3CDXA 4A37A 4MCRA 4UEFA 5DS0A 3FVLA 3ISZA 2PRQA 3K9TA 3S9NA 3IIBA 1ZG8A 2HB6A 7CPAA 3IO1A 4P10A 3IWWA 2PIYA 2Q43A 4MHZA 1CX8A 1RTQA 4R76A 3QNVA 4PPZA 3H8EA 4OMEA 3KZWA 4ZY0A 3V7ZA 2IJZA 2XEGA 3NA6A 4F8ZA 3BHXA 3LWUA 3LMSA 2RB7A 4MCQA 4DJLA 4P45A 3PB8X 1VHOA 1Z8LA 3PB7X 4P4DA 1DTDA 1VIXA 2C6PA 4OC5A 3MN8A 1CBXA 3ISXA 1IGBA 2IMOA 2AFZA 4OC1A 3FX6A 1HDQA 3FF3A 1CPSA 3D67A 4TNUA 1OBRA 1F2OA 4RUHA 5K8OA 3PB4X 4O23A 3H8FA 4EWTA 4IAVA 5CPAA 5LYDA 2BO9A 4P4BA 4NGMA 4P4FA 2PJ0A 4G1PA 4EFDA 4Z65A 2ZOGA 1QMUA 1R3NA 4ZY2A 1TXRA 2PJBA 3VARA 2ABZA 1TKHA 4MCPA 4UIBA 5LRJA 3KI9A 2CTCA 1CP6A 2JBJA 3KGQA 1Y7EA 3D7GA 2AFMA 3RAMA 3V38A 2QJ8A 5J1QA 4WWVA 2PJ1A 5CBMA 3KASA 1HDUA 1LOKA 2QVPA 3WC6A 3KQZA 4X3RA 4P6YA 3BXMA 4OIWA 4NGRA 3JRUA 3PFOA 4B6ZA 5D29A 4ZX9A 2CIJA 4MCSA 1XMBA 2ANPA 1BAVA 1VHEA 3B3CA 3D68A 1PYTB 1YMEA 3B3TA 5JH9A 2ZELA 2Q4ZA 3IFEA 4FUUA 1YLOA 1JQGA 2O4HA 3H8GA 4A39A 3B35A 1ZG9A 3VH9A 4OC2A 3RBUA 4PXBA 4A94A 1TF9A 4X2TA 2PIZA 3IC1A 5HVGA 1CPXA 3NH5A 2GREA
chains in the Genus database with same CATH superfamily
2HF1A 3SJFA 3M3YI 2JUBA 3S2HI 2YNCC 3HUVA 3I07A 4MH4A 3FIXA 5ELYA 2RIQA 3I56Z 4EMEA 2Z0ZA 5HXDA 2ZEPA 2RFHA 1Z5RA 4CS0B 1Q7LA 2FXFA 1CG2A 2KCWA 2PJ6A 4FWUA 2PRBA 1Q822 3TOAA 5JM6A 4NBAA 4E33A 5LL6f 3PZJA 5LYFA 4A2ZA 3LUSA 2QRDB 5A27A 3J80f 1IICA 4E30A 1KUYA 3BG1B 1XBUA 1Y0YA 4NCZA 3CCMZ 3R9EA 4YWYA 1ELMP 4RVHA 2C1CA 3PB6X 3FRMA 4HNYB 2OZKA 1YJ9Z 3B3SA 1YJW1 1USPB 2E2HI 1DE4C 3FECA 4NB9A 4LX9A 2NSMA 2G9DA 3NDJA 4P4JA 1M1K2 4F6AA 2Z3NA 1S3ZA 2PVVA 1AMPA 2V8JA 4UEEA 4A33A 5H84A 4Y49C 2VPXA 4OC3A 1TWAI 3CCQZ 3TX8A 3P5JB 1LRZA 3FH4A 5IB0A 1V0CA 3K9UA 2H5MA 4UA3A 5EMIA 5FVJA 1VQOZ 3IFUA 3PB9X 3CCJZ 4AXVA 4Y7NI 2VL1A 1VQ9Z 2DPTA 4BMHA 3CCV1 1VQ41 2V8HA 1TWFI 3FEEA 2BEIA 2WPWA 3IU1A 1NJI1 1ML8A 1Y8CA 2B3UA 2I3CA 3BI1A 4MHPA 2PR8A 4M6HA 3T9YA 2JMOA 1S7NA 3S6HA 2O28A 5IT9f 5EC4A 2PM9A 4ONUA 4WJBA 3CC7Z 2J6AA 2CF4A 2B58A 4P4EA 4OC4A 1W2BZ 4YFJA 1FNOA 1IYKA 3L2NA 3FKII 3GIUA 3GB0A 2EBJA 5K8MA 3S9LA 4NBCA 1F57A 2ZEEA 1L1OC 4E31A 2NYQA 1MJ9A 3FNCA 4A3EI 3CMAZ 1WWZA 1Y1WI 4B13A 3WT4A 1X3ZA 1Z02A 2DPSA 5C44I 1Q862 1ZLHA 5A2Qb 1ELLP 3A9LA 1QVGZ 3U50C 5FLMI 1X10A 3T8WA 3VB9A 1YIT1 2AFWA 2K5TA 3N7ZA 1QXFA 4MFKA 2ZW7A 4NFRA 2FL4A 4U9ZA 1VQLZ 3JAMb 1M902 2YNCA 3D7HA 3C26A 3FQMA 2PE3A 4JLYA 3OW2Y 5K8PA 2ZPAA 2QYVA 3I3GA 3I1UA 1USPA 4K30A 1Y1VI 2VI7A 3RNZA 1F2PA 3CT9A 2V45A 2ATRA 3WABA 4JYWA 1QQ9A 1KZFA 1I12A 2D4OA 2JS4A 4RVGA 4OLLA 3G6E1 1P4NA 1KUVA 3R96A 4PXCA 4CAFA 4CGNA 2IV2X 2PMZA 3CXCY 5IP7I 2QLVB 1LCPA 4AG9A 3RZOI 3LACA 1FT7A 2YNDA 2E7ZA 3W6XA 3GTKI 1QSOA 3CC21 4OADA 5DS0A 2PRQA 4GXHA 1ZG8A 4RVDA 1VQMZ 3F5BA 4P10A 3CPWZ 1CX8A 3QNVA 1L0CA 3KZWA 4ZY0A 2I00A 2P6GA 3IR7A 2QA41 3DR6A 4MD8A 2FS5A 4A3BI 4DJLA 1VHOA 3PB7X 2B4BA 3F3PC 4P4DA 2C6PA 4KOSA 3R95A 3SXNA 2ZW6A 1XEBA 4B10A 4OC1A 4S1TA 1K83I 4NBDA 3TCVA 3FF3A 4TNUA 4XPLA 1RO0A 4BBSI 2G0BA 3EFAA 4AB7A 2OU2A 4IAVA 1M1DA 2BO9A 2PJ0A 3GKRA 4Z65A 3CCEZ 4A32A 1K8A1 4MD7A 3QWUA 3F0AA 1QMUA 1R3NA 2OZHA 1NSLA 4ZY2A 1YR0A 4A3GI 2PJBA 4B12A 2ZAEB 1QVFZ 2J8NA 1ZH1A 2FIAA 1TKHA 2OTJ1 1Y7EA 2AFMA 1N71A 5I0CA 4Y52I 3I4NI 4JXQA 1YK3A 3KASA 1HDUA 1VQKZ 2NAPA 2Y0MA 3KQZA 4OIWA 3R1KA 5EBVA 2HU9A 2VPYA 5A2Qf 1OZPA 1VQNZ 2VZZA 3QAHA 4E2AA 2ANPA 1YJN1 4PK3A 3WR7A 2BJOA 2JA8I 1VHEA 4CGLA 3BJ8A 4KVME 3W6SA 2QECA 3B3TA 3CCRZ 1VQ71 3IFEA 3JAMf 1QSNA 2FE7A 4NBGA 2PIZA 1I1DA 3RZDI 4CAXA 1SFOI 4QTUA 4EWCA 3CPAA 4CPAA 4UEZA 4AG7A 4ZYQA 2EWBA 1VQP1 1Q2CA 3S1MI 2AKLA 1Z4RA 1Z8WA 1BLLE 3CPWY 5F49A 3SI0A 4PSXA 2JR6A 4KORA 1KC81 3SI1A 2O53A 3CD61 4F0YA 2YADA 1B87A 2WAQA 4BD9A 3DNSA 2AYDA 4FD5A 3NH4A 4R87A 3S9MA 4DK1A 3WC7A 3G4SZ 1VHSA 3CCLZ 3S6FA 1XOVA 6CPAA 3TC8A 3TDHB 2JA6I 2VUGA 3EY5A 3TO7A 2V8GA 2WZNA 3TE4A 4UCPA 3GUXA 4MY0A 4ZY1A 5GCNA 2ODFA 1YX0A 2EK9A 1ARMA 3D8PA 4BBRI 2DE7A 1IY7A 1K9M2 3HOWI 2K5RA 1TF8A 1EE3P 2GFQA 1WJ2A 4CRYB 2GLFA 1LANA 3QB8A 3NFZA 1RNIA 4R3LA 4QUSA 1ON0A 3I561 3DGVA 4PQAA 2AFOA 3MRUA 4LQ6A 3MONA 4RI1A 1JWHC 2EK8A 2NVXI 3HLPA 1KD12 5THWA 4RV9A 1K731 2POKA 4MRIA 2XEIA 4NXYA 4UIAA 5HVFA 2AFXA 1FDIA 4I49A 1B6BA 1WCMI 3CCM1 1J4JA 3I55Z 3GTGI 2C6CA 2PVWA 2M48A 2KI7B 2W04A 4E2XA 5C4XI 2OTL1 3GTLI 3J81b 4KSIA 1YI2Z 2REEA 2G2KA 2JIRA 2J9AA 4KOTA 1RO2A 4OC0A 2R6MA 1YQEA 2B4DB 4MHYA 1BPMA 3I4MI 2WYRA 1Z2LA 2JDCA 4NEXA 1Z03A 1RLYA 3S6KA 3KKWA 3RZAA 1Y1VS 2I79A 3G71Z 3FYNA 2QEXZ 3S16I 1SQHA 1TIQA 4NGNA 2P3YA 4C2ZA 3CCQ1 1XJOA 4BY1I 4E8OA 3P2FA 2VPZA 1S60A 4IUSA 4A3MI 3OW2Z 1YW4A 4DQYB 2JEWA 2RHBA 3S1NI 4RS2A 1CP7A 5JQ4A 2PJ5A 3CCJ1 4PSWA 2IL4A 2PJ2A 2DF5A 3FMCA 4MONA 1Q811 1YREA 4BY7I 1VQ81 2OH1A 2YU9I 1RO5A 4B14A 5IV0A 5DWMA 3D2MA 1TWGI 3CXCZ 3JVNA 3TTHA 1X3WA 3GTMI 3CC71 1UFHA 2PJ7A 2E2II 1YUAA 4FD6A 2JA7I 3F8KA 4R57A 2JIPA 3S2DI 3P2HA 4YGOA 4CYNA 1Q2YA 2V8DA 4Y49B 2WSAA 3SHPA 4P4IA 4GS4A 3ESWA 4MCRA 4UEFA 3CMA1 4A3DI 4E32A 2HV2A 2FSRA 2HB6A 4CYPA 2QREB 3FQQA 2Q43A 4QC6A 3D3SA 4R76A 2HQYA 4PPZA 5F47A 3V7ZA 2Z3LA 3EO4A 3BHXA 4QBJA 2FT0A 4ORFA 4OC5A 2Z3KA 4JD6A 1K4JA 3ISXA 1VKCA 4UFXA 1IGBA 2IMOA 2AFZA 3FX6A 4R3KA 2NVTI 5AG7A 1Q7Y1 1CPSA 2VPWA 1YLEA 5H86A 4RUHA 2Z3OA 5K8OA 1N8R2 1I3QI 3RYOA 1VQ4Z 4E2YA 3PB4X 4A95A 3J81f 1IB1E 4A3CI 5CPAA 5LYDA 1P0HA 2B4DA 4NGMA 4NSQA 1S7LA 2BUEA 4G1PA 1TWCI 3LODA 4J3GA 4OAEA 1ZB9A 5AN9F 2GANA 1TXRA 3T90A 2ABZA 2HUZA 2C27A 2NVQI 4MCPA 5LRJA 3KI9A 3KGQA 3UY5A 3RAMA 4FD4A 2JIOA 2Z11A 5J1QA 5AGEA 4DGLA 4A30A 1JJ2Y 3WC6A 4X3RA 4MFLA 4P6YA 1VQM1 5HH1A 2VQYA 5D29A 1QSTA 3VWDA 4MHDA 2CIJA 2LIYA 5D1OB 5KTCA 3CME1 2EGTA 3FBUA 1PYTB 5JH9A 1PFTA 4NBHA 4A3II 2PC1A 4CYOA 4KOWA 2O4HA 3H8GA 4A39A 3B35A 1ZG9A 3RBUA 1YVKA 2XEJA 2AFSA 1XMTA 3VMHA 3FXTA 8CPAA 4A31A 2DEAA 2WUUA 3WC5A 4B5PB 2CXAA 4NGQA 3B7IA 4NOZA 3BLNA 5IP9I 5J8FA 3K2KA 2GE3A 2OZUA 4NJQA 5K8NA 3G6EZ 3VWEA 2OOYB 4FAIA 2G3AA 1P9NA 3D7FA 1U6MA 5LRGA 2DXQA 4Q7AA 2F4OA 2Z10A 4NGPA 1VQK1 3D66A 1NJI2 4KLVA 1RXTA 5I4MA 2JDDA 3PEIA 2ZENA 4C2XA 1TWHI 4MXUA 4IHMA 2VUMI 4KOXA 4MHNA 1XE4A 3SJGA 5IB9A 4M3SA 3CCR1 2BSWA 2QR1B 3Q87A 1GHEA 1NSAA 4NJRA 5HVHA 2RBLA 3VMIA 1X12A 4U9YA 4ZBGA 2VF1A 3KIFA 4OKOA 2R1IA 5JGFA 1YUKA 3S6GA 1FDOA 3GYAA 3GTQI 1BPNA 1YW6A 2EVNA 4XX2A 2OR4A 3DLJA 3BI0A 2P6FA 3KR4A 3HOUI 4AVCA 4W9YA 4IK2A 4HH4A 1ARLA 1S7KA 4UFVA 3KHZA 4RS4A 4R8FA 1Q821 3HOZI 2PJ3A 5AG5A 1LFWA 2YNEA 3E0KA 3B3WA 2NMTA 3N5FA 1AA6A 1AYEA 1QSMA 4PK2A 5J8CA 4ZX8A 2PJCA 2H85A 3RO0A 2BL1A 1YIJ1 3PBBA 4C7IA 3SXOA 3H4QA 4NF1A 2Q44A 4PXDA 2F8HA 4KVOE 4YU9A 3CCSZ 3CCUZ 2W03A 3MZLB 4R6TA 1YJNZ 2ZXVA 1QSRA 3D9XA 1M1K1 2XEFA 1VQ61 2YGWA 1Q16A 4M85A 1VQ51 1XIXA 1VQ7Z 2M6NA 4ZGYB 3NE7A 1PCAA 4A3LI 3JTKA 1R43A 5AG4A 4B5PA 1ZB8A 2LEXA 4HNXB 1KRLA 4DYOA 3GTOI 1IU8A 3D7DA 2VEZA 3GTMS 4RVFA 2JIQA 2CY2A 4OIDA 3GTJI 2RPRA 1XFOA 4A3KI 4XPDC 2G3TA 4MI4A 4FBEA 1XRYA 4IF5A 2PJ8A 2Q04A 1A2ZA 1M44A 2Q51A 3IF8A 2IZ4A 1Y9WA 5G20A 1YHQZ 4MD9A 5LYIA 3CC4Z 4H6UA 3MGDA 4C68A 3CXPA 4TWEA 4F9VA 3I551 3CZXA 1S72Z 4F9UA 3B3VA 4YRHA 3FJUA 1KWMA 1YI21 4XPDB 1R9TI 1QF8A 2CTBA 4GM5A 1K8A2 1Z4EA 1M4DA 4XNHC 1S7FA 2PJ4A 2V8IA 3NE8A 4X8IA 4UWIA 3FB3A 3KR5A 2ZW5A 3IEHA 3CPXA 1N2FA 3GY9A 3D6WA 3FEDA 1M4LA 2QMLA 3CDXA 5FLXb 4EVYA 4KVXA 3G711 3HKZA 1YJ91 3IIBA 2GIVA 1N8R1 7CPAA 3IO1A 2CNTA 4MHZA 1Q861 1RTQA 2LFUA 1KQSY 2P0WA 1AUGA 4MFJA 3NA6A 3R9GA 4XNHB 5KTAA 2PQ8A 3IX0A 4II9A 3NDIA 2RB7A 3LMSA 3EERA 4BXXI 4P45A 3PB8X 2PR1A 3IU2A 1DTDA 1VIXA 3S1QI 3TFYA 2JLMA 4QTTA 4H6ZA 1M901 2PSWA 5D1PA 4M6IA 2WB1A 3IWEA 2NVYI 3GTPI 3PO2I 3GCFA 4EWTA 3EEDA 2QRCB 4P4FA 2Q4VA 4C7HA 2OTLZ 2AE6A 4MFQA 1VQO1 4KSAA 1JJ2Z 1VQ91 3BJ7A 4JXRA 3TE5B 1KC82 2CTCA 1CP6A 2JBJA 1FY7A 3D7GA 3PP9A 2E2JI 1M4GA 4RN7A 3V38A 2QJ8A 1Z8XA 1S5KA 3JUWA 1NE9A 3CXQA 5CBMA 1Y9KA 1CM0A 4CGOA 2J8MA 5A28A 4NGRA 1R57A 4ZX9A 4MCSA 1YJWZ 2A4NA 1BAVA 4HKFA 3B3CA 3D68A 1I50I 5C88A 3W91A 4PV6A 3KIHA 2REFA 4MY3A 1CJWA 4KOUA 2R7HA 2ZELA 4KZTA 2KPIA 2Q0YA 1YLOA 4E0AA 2IZ3A 4A3JI 2VXKA 2JEVA 3VH9A 4OC2A 4PXBA 1TF9A 3IC1A 5HVGA 1CPXA 4NBFA 1Z9UA 4KUBA 1WW9A 2X7BA 3IWGA 3HOVI 1VQ8Z 3PFEA 5F09A 2WPXA 2OB0A 4DNCA 4MFPA 2ZEFA 2PCUA 3HOYI 1WZNA 1RO4A 2VZYA 1ZG7A 1VQL1 3PBEA 2Z3MA 2K3RA 5FLXf 2PK7A 2D4PA 5F48A 1RQFA 1IYLA 1MJAA 1K732 3CCVZ 3H0GI 4HGYA 4JJXA 4AYBA 1HEEA 2JBKA 3PO3I 3GLJA 4QB9A 4CAWA 2BCOA 1Z8TA 1BO4A 4ONWA 4CAEA 2JNYA 4JWPA 2F7VA 4AVBA 2QKDA 2EUIA 4XPKA 4HGZA 1ZLIA 4CRZB 2PJAA 3G3SA 1QYPA 4ZI6A 1H8LA 1PU9A 3T4NB 1TFIA 4LQGA 5CM2M 4NGTA 3VATA 4BBHA 5C4JI 4MBUA 2R8VA 4BINA 4M6GA 1Z01A 5G1ZA 4B11A 2C6GA 3R9FA 5T67A 1WIIA 3B2YA 3SI2A 2B5GB 3KHXA 1DL6A 2FCKA 3SJEA 2ZEOA 1LQLA 2J8RA 2ZEMA 4KOYA 3GKQA 3S14I 2PDOA 1YITZ 1TKFA 2ZOFA 1Q2DA 3KL9A 5KTDA 1GYTA 2IQ6A 3CXSA 4K3NA 4NBBA 3NH8A 2OZGA 4NH1C 2HC9A 4DUKA 4E2ZA 1Q812 4UCNA 1IOFA 5E96A 1VGYA 4KOVA 5DWNA 2FVGA 4UFWA 4A38A 1UWYA 3CCE1 2ZEGA 5AG6A 5CNPA 2V8KA 5HMNA 2P28A 4R7MA 4CGMA 3CMEZ 4KLWA 4P44A 4HPSA 5BWAB 2OOXB 4CAVA 2JA5I 3PRTA 1NUIA 2V77A 1NP6A 1Y0RA 1NMTA 2B3VA 4PXEA 3SJXA 3D4UA 2R7ZI 3CC2Z 5D8NA 4H2KA 2ARHA 1K9M1 2Q7SA 2GTHA 1W2BY 3EC4A 1PUAA 1VQN1 3TOBA 4R9MA 1M4IA 3LD2A 2OOTA 2GLJA 3S15I 2ZEDA 4OP4A 5T6BA 3HOXI 3ZZIA 2RC4A 4L8AA 2BOAA 4AVAA 2ZEHA 2GU2A 2QA4Z 4NGSA 2F4MA 2AFUA 1WK4A 4LUAA 3F3FC 3DDDA 1TKJA 1KD11 3CQZI 3VMGA 1Q7Y2 2DE5A 1LAMA 3ZJ0A 4E2WA 1LAPA 4X6AI 1QVGY 4QVTA 5LRKA 4UBRA 1JWQA 4MFZA 4L89A 3KQXA 2FIWA 2GTIA 4MMOA 5G22A 3CCS1 4HNWB 1SIWA 3CCU1 5LYLA 2E9HA 1YSJA 3H3VJ 2PJ9A 1VLAA 4JZ0A 3IGRA 2OTJZ 1KQSZ 4UF4A 5ISVA 2V8VA 3IJ3A 4B5OA 5IX3A 4UWJA 3QAYA 4A37A 5D1OA 4KSFA 3FVLA 3ISZA 2B5GA 3K9TA 3J80b 3G4S1 3S9NA 4MJ8A 3BG0B 3CCL1 3OWCA 3IWWA 2PIYA 3PGPA 3H8EA 4OMEA 5T64A 2IJZA 2XEGA 4F8ZA 1IOIA 2V3VA 3VTNA 1BOBA 1YVOA 3LWUA 3EXNA 3B8GA 4MCQA 2VBQA 1Z8LA 3K7AI 2R98A 3V8IA 3MN8A 1CBXA 1MJBA 4CYQA 3I9SA 1HDQA 4NBEA 1YHQ1 3S1RI 3D67A 1OBRA 1F2OA 1I6HI 4U5YA 3CC41 4Q36A 4CGPA 2AJ6A 1S7MA 1MK4A 3J7A4 3MZKB 4O23A 3H8FA 2ZW4A 1YIJZ 2R92I 5JPHA 2R93I 3TT2A 4F0XA 1S721 4P4BA 1VQPZ 3D2LA 2Q4YA 4H89A 3TO6A 4EFDA 5C82A 3DSBA 1IIDA 2ZOGA 4KS9A 1KUXA 1ZO0A 3TO9A 3VARA 4A93I 3M4OI 2CNSA 4FD7A 2JIMA 1Y7RA 4UIBA 3CD6Z 1XF8A 1VQ6Z 4X5KA 4UCMA 1VQ5Z 1X0TA 4WWVA 2PJ1A 5F46A 2QVPA 1LOKA 5G21A 1QVFY 2Y0SA 3BXMA 2QIRA 3G8WA 3JRUA 3PFOA 4C2YA 4CL1A 4B6ZA 2Z3PA 2EO8A 1XMBA 4KUAA 2RT9A 2F5IA 3DR8A 5IT9b 1YMEA 2CNMA 4NB8A 4A3FI 3D2PA 2Q4ZA 3H5ZA 1I21A 4FUUA 2DE6A 1JQGA 2P6EA 1YGHA 2Q7BA 3PO3S 3S17I 2B63I 4A94A 2QEX1 4X2TA 5C3EI 3NH5A 4Q38A 2GREA
chains in the Genus database with same CATH topology
4QTUA 4EWCA 1WW9A 2XEJA 2AFSA 3CPAA 4CPAA 2HF1A 3VMHA 4UEZA 3SJFA 3HOVI 8CPAA 1VQ8Z 3M3YI 2JUBA 3PFEA 3S2HI 2DEAA 3WC5A 4ZYQA 4NGQA 2EWBA 3HUVA 5F09A 3I07A 1VQP1 4MH4A 3B7IA 4NOZA 3S1MI 5ELYA 2AKLA 2RIQA 3I56Z 4EMEA 2ZEFA 2PCUA 1BLLE 3HOYI 3CPWY 5IP9I 5HXDA 3SI0A 2ZEPA 2RFHA 1RO4A 1Z5RA 3K2KA 1Q7LA 2JR6A 1CG2A 4NJQA 1ZG7A 1KC81 1VQL1 2PJ6A 4FWUA 5K8NA 3SI1A 3G6EZ 2O53A 1Q822 3PBEA 3CD61 2OOYB 2K3RA 2YADA 2PK7A 4NBAA 5FLXf 4FAIA 1P9NA 5JM6A 4E33A 1RQFA 3D7FA 5LL6f 5LRGA 5LYFA 2WAQA 4Q7AA 1K732 3CCVZ 3H0GI 3LUSA 2QRDB 4HGYA 3J80f 4E30A 2F4OA 4BD9A 4AYBA 1HEEA 4NGPA 2JBKA 3PO3I 3BG1B 3GLJA 1VQK1 1XBUA 3D66A 1Y0YA 1NJI2 3CCMZ 2BCOA 3NH4A 4YWYA 5I4MA 3S9MA 1ELMP 4RVHA 4DK1A 2C1CA 4ONWA 3WC7A 3PEIA 3G4SZ 3PB6X 2OZKA 1YJ9Z 2ZENA 1TWHI 2JNYA 3CCLZ 4MXUA 3B3SA 1YJW1 2F7VA 1USPB 2E2HI 4IHMA 1DE4C 6CPAA 2VUMI 2QKDA 3FECA 3TC8A 4NB9A 4MHNA 4HGZA 1ZLIA 3TDHB 2JA6I 3SJGA 2NSMA 2G9DA 5IB9A 2PJAA 3NDJA 2VUGA 2QR1B 3CCR1 1QYPA 3Q87A 4P4JA 4ZI6A 1H8LA 1M1K2 1NSAA 4NJRA 2V8GA 2WZNA 5HVHA 2RBLA 3GUXA 3T4NB 3VMIA 1TFIA 4ZY1A 4LQGA 5CM2M 4NGTA 3VATA 2VF1A 5C4JI 3KIFA 2PVVA 1AMPA 2V8JA 4OKOA 2EK9A 1Z01A 4UEEA 5JGFA 1YUKA 1ARMA 4BBRI 3GTQI 2C6GA 2DE7A 1IY7A 1BPNA 1K9M2 3HOWI 1YW6A 2K5RA 1TF8A 1EE3P 4XX2A 4OC3A 2GLFA 1LANA 5T67A 1WIIA 2OR4A 1TWAI 3B2YA 3CCQZ 3BI0A 3DLJA 3KR4A 3SI2A 3NFZA 3KHXA 1RNIA 1DL6A 3TX8A 3P5JB 3HOUI 3SJEA 2ZEOA 1LQLA 3FH4A 4W9YA 4IK2A 3I561 4HH4A 1ARLA 2ZEMA 3GKQA 3KHZA 3S14I 3DGVA 4PQAA 2AFOA 3MRUA 4RS4A 1YITZ 1TKFA 2ZOFA 4R8FA 3MONA 3KL9A 1Q821 1JWHC 3HOZI 2EK8A 1GYTA 2IQ6A 2PJ3A 4K3NA 1VQOZ 2NVXI 3HLPA 4NBBA 3NH8A 3IFUA 1KD12 1LFWA 3PB9X 3CCJZ 3N5FA 3B3WA 5THWA 4AXVA 4Y7NI 4NH1C 4RV9A 1K731 2POKA 2VL1A 1VQ9Z 4MRIA 2HC9A 1AYEA 2XEIA 4UIAA 4DUKA 5HVFA 3CCV1 2AFXA 1VQ41 4ZX8A 2PJCA 4E2ZA 2H85A 1Q812 2V8HA 1TWFI 3FEEA 1VGYA 1YIJ1 3PBBA 1NJI1 2FVGA 1ML8A 1WCMI 3CCM1 4A38A 2I3CA 3I55Z 3BI1A 3GTGI 2C6CA 4MHPA 2PVWA 2M48A 1UWYA 2KI7B 2W04A 3CCE1 4E2XA 5C4XI 2ZEGA 2OTL1 4PXDA 3GTLI 3J81b 2F8HA 4KSIA 4YU9A 2V8KA 3CCSZ 1YI2Z 2JMOA 5IT9f 2G2KA 3CCUZ 2W03A 3MZLB 2PM9A 4WJBA 2P28A 3CC7Z 2J6AA 2CF4A 4P4EA 4R6TA 2J9AA 4R7MA 4OC4A 1YJNZ 1RO2A 4OC0A 2R6MA 3CMEZ 4MHYA 4P44A 3D9XA 1W2BZ 1M1K1 2OOXB 1BPMA 2XEFA 1VQ61 2JA5I 3I4MI 1FNOA 2WYRA 1Z2LA 3L2NA 3FKII 3GB0A 1VQ51 5K8MA 3S9LA 4NBCA 3PRTA 1F57A 1NUIA 1VQ7Z 2V77A 1Z03A 2ZEEA 1RLYA 2M6NA 1NP6A 1Y0RA 4PXEA 3SJXA 1L1OC 4E31A 1PCAA 2NYQA 4A3LI 3D4UA 2R7ZI 3CC2Z 3RZAA 1Y1VS 5D8NA 4A3EI 3CMAZ 4H2KA 1R43A 1K9M1 2GTHA 1W2BY 3G71Z 1ZB8A 1Y1WI 1VQN1 2QEXZ 3S16I 4NGNA 3WT4A 1KRLA 1X3ZA 2P3YA 1Z02A 4DYOA 3GTOI 3CCQ1 1XJOA 4BY1I 5C44I 3D7DA 2OOTA 1Q862 2GLJA 3GTMS 3S15I 4RVFA 2ZEDA 4OP4A 5T6BA 4OIDA 3HOXI 3GTJI 1ZLHA 2RPRA 5A2Qb 2BOAA 1ELLP 2ZEHA 2GU2A 2QA4Z 4NGSA 1XFOA 4A3KI 4A3MI 2F4MA 3OW2Z 1QVGZ 3U50C 4FBEA 2AFUA 1XRYA 5FLMI 3T8WA 2PJ8A 3VB9A 1YW4A 3F3FC 4DQYB 1YIT1 2AFWA 2JEWA 2RHBA 1TKJA 3S1NI 1CP7A 1KD11 2PJ5A 3CQZI 2Q51A 3IF8A 4NFRA 3CCJ1 2IZ4A 2PJ2A 3VMGA 1VQLZ 1YHQZ 3JAMb 3FMCA 1M902 3D7HA 4MONA 3FQMA 1Q7Y2 1Q811 4MD9A 2PE3A 2DE5A 1LAMA 4E2WA 1LAPA 5LYIA 4X6AI 3OW2Y 1QVGY 3CC4Z 4BY7I 5K8PA 5LRKA 1VQ81 2QYVA 2YU9I 3I1UA 1USPA 4TWEA 1Y1VI 4F9VA 3I551 1F2PA 3KQXA 3CT9A 2GTIA 1TWGI 1S72Z 4F9UA 3B3VA 3WABA 3CXCZ 4MMOA 4JYWA 3FJUA 1KWMA 3CCS1 1YI21 1R9TI 1QQ9A 1X3WA 3CCU1 3GTMI 1QF8A 2CTBA 5LYLA 3CC71 1K8A2 2PJ7A 4GM5A 2JS4A 4RVGA 2E2II 2E9HA 3G6E1 1YSJA 1YUAA 3H3VJ 2PJ4A 2JA7I 2PJ9A 4PXCA 2V8IA 1VLAA 4JZ0A 4X8IA 3S2DI 3KR5A 2OTJZ 2V8DA 3IEHA 2PMZA 3CXCY 5IP7I 2QLVB 1LCPA 3RZOI 1KQSZ 4UF4A 3CPXA 1N2FA 3D6WA 2V8VA 1M4LA 3FEDA 4P4IA 1FT7A 3IJ3A 3CDXA 3ESWA 5FLXb 4A37A 3GTKI 5D1OA 3CC21 4MCRA 4UEFA 3CMA1 5DS0A 4A3DI 3FVLA 4E32A 3ISZA 3G711 2PRQA 3K9TA 3HKZA 3J80b 3G4S1 3S9NA 1YJ91 3IIBA 3BG0B 3CCL1 1ZG8A 1N8R1 2HB6A 4RVDA 7CPAA 1VQMZ 3IO1A 4P10A 3IWWA 2PIYA 2QREB 3FQQA 3CPWZ 2Q43A 4MHZA 1Q861 1CX8A 1RTQA 4R76A 3QNVA 2LFUA 1KQSY 4PPZA 3H8EA 4OMEA 3KZWA 4ZY0A 5T64A 3V7ZA 2IJZA 2XEGA 3NA6A 4F8ZA 3BHXA 3VTNA 2QA41 3IX0A 3LWUA 4MD8A 3NDIA 2RB7A 3LMSA 4A3BI 4MCQA 3EERA 4BXXI 4DJLA 4P45A 3PB8X 1VHOA 1Z8LA 3PB7X 3K7AI 3F3PC 4P4DA 1DTDA 1VIXA 2C6PA 4OC5A 3S1QI 3MN8A 1CBXA 4QTTA 3ISXA 1IGBA 2IMOA 2AFZA 4OC1A 3FX6A 1M901 2NVTI 4S1TA 1K83I 1HDQA 4NBEA 4NBDA 1Q7Y1 1YHQ1 1CPSA 3FF3A 3S1RI 3D67A 4TNUA 1OBRA 1F2OA 1I6HI 3CC41 5D1PA 4RUHA 2WB1A 5K8OA 1N8R2 1I3QI 1RO0A 1S7MA 1VQ4Z 4E2YA 3J7A4 3PB4X 3MZKB 4BBSI 4O23A 2NVYI 3J81f 3GTPI 3PO2I 3H8FA 1YIJZ 2R92I 3GCFA 4A3CI 4EWTA 4IAVA 2R93I 5CPAA 3EEDA 5LYDA 2QRCB 1S721 2BO9A 4P4BA 1VQPZ 4NGMA 4P4FA 2PJ0A 4G1PA 1TWCI 4EFDA 4Z65A 3CCEZ 1K8A1 4MD7A 2OTLZ 2ZOGA 3QWUA 1ZB9A 1QMUA 1R3NA 5AN9F 4ZY2A 1TXRA 1VQO1 4A3GI 2PJBA 2ZAEB 3VARA 2ABZA 1QVFZ 1JJ2Z 1ZH1A 4A93I 2NVQI 3M4OI 1TKHA 1VQ91 4MCPA 4UIBA 5LRJA 2OTJ1 3TE5B 1KC82 3KI9A 3CD6Z 1CP6A 2CTCA 2JBJA 3KGQA 1Y7EA 1VQ6Z 3D7GA 2AFMA 3RAMA 4Y52I 3I4NI 2E2JI 1VQ5Z 1X0TA 3V38A 2QJ8A 5J1QA 4WWVA 4DGLA 2PJ1A 5CBMA 3KASA 1HDUA 1LOKA 1VQKZ 2QVPA 1QVFY 2Y0SA 1JJ2Y 3WC6A 3KQZA 4X3RA 4P6YA 3BXMA 1VQM1 4OIWA 4NGRA 3JRUA 3PFOA 2HU9A 4CL1A 4B6ZA 5D29A 5A2Qf 4ZX9A 1VQNZ 2CIJA 4MCSA 1YJWZ 2LIYA 1XMBA 5D1OB 2ANPA 1YJN1 1BAVA 3CME1 2BJOA 2JA8I 1VHEA 2RT9A 2EGTA 3B3CA 3D68A 1I50I 5IT9b 1PYTB 1YMEA 3KIHA 3CCRZ 3B3TA 4NB8A 5JH9A 1PFTA 4NBHA 4A3FI 1VQ71 2ZELA 2Q4ZA 3IFEA 2KPIA 4FUUA 3JAMf 1YLOA 2IZ3A 4A3II 2DE6A 1JQGA 4A3JI 2O4HA 3H8GA 4A39A 3B35A 1ZG9A 3VH9A 3PO3S 4OC2A 3RBUA 3S17I 2B63I 4PXBA 4A94A 4NBGA 2QEX1 1TF9A 4X2TA 2PIZA 3IC1A 5HVGA 1CPXA 4NBFA 5C3EI 3NH5A 3RZDI 1SFOI 2GREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEJ A;  3CPA A;  2AFS A;  4CPA A;  4UEZ A;  3SJF A;  8CPA A;  3PFE A;  2DEA A;  3WC5 A;  4ZYQ A;  4NGQ A;  2EWB A;  3HUV A;  5F09 A;  3B7I A;  5ELY A;  4EME A;  2ZEF A;  2PCU A;  1BLL E;  5HXD A;  3SI0 A;  2ZEP A;  2RFH A;  3K2K A;  1Z5R A;  1Q7L A;  1CG2 A;  4NJQ A;  1ZG7 A;  2PJ6 A;  5K8N A;  4FWU A;  3SI1 A;  2O53 A;  3PBE A;  5JM6 A;  4FAI A;  3D7F A;  5LRG A;  5LYF A;  4Q7A A;  4BD9 A;  1HEE A;  4NGP A;  2JBK A;  3GLJ A;  1XBU A;  3D66 A;  1Y0Y A;  2BCO A;  3NH4 A;  4YWY A;  5I4M A;  3S9M A;  1ELM P;  2C1C A;  3WC7 A;  4ONW A;  3PEI A;  3PB6 X;  2ZEN A;  3B3S A;  4MXU A;  2F7V A;  4IHM A;  1DE4 C;  6CPA A;  3FEC A;  3TC8 A;  4MHN A;  1ZLI A;  3SJG A;  2NSM A;  2G9D A;  5IB9 A;  2PJA A;  4ZI6 A;  4P4J A;  1H8L A;  1NSA A;  4NJR A;  2V8G A;  2WZN A;  5HVH A;  3GUX A;  4ZY1 A;  4LQG A;  4NGT A;  3VAT A;  2PVV A;  1AMP A;  4OKO A;  2EK9 A;  4UEE A;  5JGF A;  1ARM A;  2C6G A;  1IY7 A;  1BPN A;  1YW6 A;  1TF8 A;  1EE3 P;  4OC3 A;  2GLF A;  1LAN A;  2OR4 A;  3B2Y A;  3BI0 A;  3DLJ A;  3KR4 A;  3SI2 A;  3NFZ A;  3KHX A;  3TX8 A;  3SJE A;  2ZEO A;  3FH4 A;  4W9Y A;  4IK2 A;  1ARL A;  2ZEM A;  3KHZ A;  3DGV A;  4PQA A;  2AFO A;  3MRU A;  1TKF A;  2ZOF A;  4R8F A;  3KL9 A;  2EK8 A;  1GYT A;  2IQ6 A;  2PJ3 A;  4K3N A;  3HLP A;  1LFW A;  3NH8 A;  3PB9 X;  3N5F A;  3B3W A;  5THW A;  4AXV A;  2VL1 A;  2POK A;  4MRI A;  2HC9 A;  1AYE A;  2XEI A;  4UIA A;  4DUK A;  5HVF A;  2AFX A;  4ZX8 A;  2PJC A;  2V8H A;  3FEE A;  1VGY A;  3PBB A;  2FVG A;  4A38 A;  2I3C A;  3BI1 A;  2C6C A;  4MHP A;  2PVW A;  1UWY A;  2ZEG A;  4PXD A;  2F8H A;  4KSI A;  4YU9 A;  4WJB A;  4P4E A;  2CF4 A;  4R7M A;  4R6T A;  2J9A A;  4OC4 A;  4OC0 A;  4MHY A;  4P44 A;  2XEF A;  1BPM A;  1FNO A;  2WYR A;  1Z2L A;  3L2N A;  3GB0 A;  5K8M A;  3S9L A;  3PRT A;  1F57 A;  2V77 A;  2ZEE A;  1Y0R A;  4PXE A;  3SJX A;  1PCA A;  2NYQ A;  3D4U A;  3RZA A;  5D8N A;  4H2K A;  1R43 A;  4NGN A;  3WT4 A;  4DYO A;  1XJO A;  2OOT A;  3D7D A;  2GLJ A;  2ZED A;  4OP4 A;  4OID A;  1ZLH A;  2BOA A;  1ELL P;  2ZEH A;  2GU2 A;  4NGS A;  1XFO A;  4FBE A;  2AFU A;  1XRY A;  3T8W A;  2PJ8 A;  1YW4 A;  2AFW A;  2JEW A;  1TKJ A;  1CP7 A;  2PJ5 A;  2Q51 A;  4NFR A;  2PJ2 A;  3FMC A;  3D7H A;  2PE3 A;  1LAM A;  5LYI A;  1LAP A;  5K8P A;  5LRK A;  2QYV A;  3I1U A;  4TWE A;  4F9V A;  1F2P A;  3KQX A;  3CT9 A;  4F9U A;  3B3V A;  3WAB A;  4MMO A;  4JYW A;  3FJU A;  1KWM A;  1QQ9 A;  2CTB A;  5LYL A;  2PJ7 A;  4GM5 A;  1YSJ A;  2PJ4 A;  2PJ9 A;  4PXC A;  4X8I A;  4JZ0 A;  3KR5 A;  2V8D A;  3IEH A;  1LCP A;  4UF4 A;  3CPX A;  2V8V A;  1M4L A;  3FED A;  4P4I A;  1FT7 A;  3IJ3 A;  3CDX A;  4A37 A;  4MCR A;  4UEF A;  5DS0 A;  3FVL A;  3ISZ A;  2PRQ A;  3K9T A;  3S9N A;  3IIB A;  1ZG8 A;  2HB6 A;  7CPA A;  3IO1 A;  4P10 A;  3IWW A;  2PIY A;  2Q43 A;  4MHZ A;  1CX8 A;  1RTQ A;  4R76 A;  3QNV A;  4PPZ A;  3H8E A;  4OME A;  3KZW A;  4ZY0 A;  3V7Z A;  2IJZ A;  2XEG A;  3NA6 A;  4F8Z A;  3BHX A;  3LWU A;  3LMS A;  2RB7 A;  4MCQ A;  4DJL A;  4P45 A;  3PB8 X;  1VHO A;  1Z8L A;  3PB7 X;  4P4D A;  1DTD A;  1VIX A;  2C6P A;  4OC5 A;  3MN8 A;  1CBX A;  3ISX A;  1IGB A;  2IMO A;  2AFZ A;  4OC1 A;  3FX6 A;  1HDQ A;  3FF3 A;  1CPS A;  3D67 A;  4TNU A;  1OBR A;  1F2O A;  4RUH A;  5K8O A;  3PB4 X;  4O23 A;  3H8F A;  4EWT A;  4IAV A;  5CPA A;  5LYD A;  2BO9 A;  4P4B A;  4NGM A;  4P4F A;  2PJ0 A;  4G1P A;  4EFD A;  4Z65 A;  2ZOG A;  1QMU A;  1R3N A;  4ZY2 A;  1TXR A;  2PJB A;  3VAR A;  2ABZ A;  1TKH A;  4MCP A;  4UIB A;  5LRJ A;  3KI9 A;  2CTC A;  1CP6 A;  2JBJ A;  3KGQ A;  1Y7E A;  3D7G A;  2AFM A;  3RAM A;  3V38 A;  2QJ8 A;  5J1Q A;  4WWV A;  2PJ1 A;  5CBM A;  3KAS A;  1HDU A;  1LOK A;  2QVP A;  3WC6 A;  3KQZ A;  4X3R A;  4P6Y A;  3BXM A;  4OIW A;  4NGR A;  3JRU A;  3PFO A;  4B6Z A;  5D29 A;  4ZX9 A;  2CIJ A;  4MCS A;  1XMB A;  2ANP A;  1BAV A;  1VHE A;  3B3C A;  3D68 A;  1PYT B;  1YME A;  3B3T A;  5JH9 A;  2ZEL A;  2Q4Z A;  3IFE A;  4FUU A;  1YLO A;  1JQG A;  2O4H A;  3H8G A;  4A39 A;  3B35 A;  1ZG9 A;  3VH9 A;  4OC2 A;  3RBU A;  4PXB A;  4A94 A;  1TF9 A;  4X2T A;  2PIZ A;  3IC1 A;  5HVG A;  1CPX A;  3NH5 A;  2GRE A; 
#chains in the Genus database with same CATH topology
 2HF1 A;  3SJF A;  3M3Y I;  2JUB A;  3S2H I;  2YNC C;  3HUV A;  3I07 A;  4MH4 A;  3FIX A;  5ELY A;  2RIQ A;  3I56 Z;  4EME A;  2Z0Z A;  5HXD A;  2ZEP A;  2RFH A;  1Z5R A;  4CS0 B;  1Q7L A;  2FXF A;  1CG2 A;  2KCW A;  2PJ6 A;  4FWU A;  2PRB A;  1Q82 2;  3TOA A;  5JM6 A;  4NBA A;  4E33 A;  5LL6 f;  3PZJ A;  5LYF A;  4A2Z A;  3LUS A;  2QRD B;  5A27 A;  3J80 f;  1IIC A;  4E30 A;  1KUY A;  3BG1 B;  1XBU A;  1Y0Y A;  4NCZ A;  3CCM Z;  3R9E A;  4YWY A;  1ELM P;  4RVH A;  2C1C A;  3PB6 X;  3FRM A;  4HNY B;  2OZK A;  1YJ9 Z;  3B3S A;  1YJW 1;  1USP B;  2E2H I;  1DE4 C;  3FEC A;  4NB9 A;  4LX9 A;  2NSM A;  2G9D A;  3NDJ A;  4P4J A;  1M1K 2;  4F6A A;  2Z3N A;  1S3Z A;  2PVV A;  1AMP A;  2V8J A;  4UEE A;  4A33 A;  5H84 A;  4Y49 C;  2VPX A;  4OC3 A;  1TWA I;  3CCQ Z;  3TX8 A;  3P5J B;  1LRZ A;  3FH4 A;  5IB0 A;  1V0C A;  3K9U A;  2H5M A;  4UA3 A;  5EMI A;  5FVJ A;  1VQO Z;  3IFU A;  3PB9 X;  3CCJ Z;  4AXV A;  4Y7N I;  2VL1 A;  1VQ9 Z;  2DPT A;  4BMH A;  3CCV 1;  1VQ4 1;  2V8H A;  1TWF I;  3FEE A;  2BEI A;  2WPW A;  3IU1 A;  1NJI 1;  1ML8 A;  1Y8C A;  2B3U A;  2I3C A;  3BI1 A;  4MHP A;  2PR8 A;  4M6H A;  3T9Y A;  2JMO A;  1S7N A;  3S6H A;  2O28 A;  5IT9 f;  5EC4 A;  2PM9 A;  4ONU A;  4WJB A;  3CC7 Z;  2J6A A;  2CF4 A;  2B58 A;  4P4E A;  4OC4 A;  1W2B Z;  4YFJ A;  1FNO A;  1IYK A;  3L2N A;  3FKI I;  3GIU A;  3GB0 A;  2EBJ A;  5K8M A;  3S9L A;  4NBC A;  1F57 A;  2ZEE A;  1L1O C;  4E31 A;  2NYQ A;  1MJ9 A;  3FNC A;  4A3E I;  3CMA Z;  1WWZ A;  1Y1W I;  4B13 A;  3WT4 A;  1X3Z A;  1Z02 A;  2DPS A;  5C44 I;  1Q86 2;  1ZLH A;  5A2Q b;  1ELL P;  3A9L A;  1QVG Z;  3U50 C;  5FLM I;  1X10 A;  3T8W A;  3VB9 A;  1YIT 1;  2AFW A;  2K5T A;  3N7Z A;  1QXF A;  4MFK A;  2ZW7 A;  4NFR A;  2FL4 A;  4U9Z A;  1VQL Z;  3JAM b;  1M90 2;  2YNC A;  3D7H A;  3C26 A;  3FQM A;  2PE3 A;  4JLY A;  3OW2 Y;  5K8P A;  2ZPA A;  2QYV A;  3I3G A;  3I1U A;  1USP A;  4K30 A;  1Y1V I;  2VI7 A;  3RNZ A;  1F2P A;  3CT9 A;  2V45 A;  2ATR A;  3WAB A;  4JYW A;  1QQ9 A;  1KZF A;  1I12 A;  2D4O A;  2JS4 A;  4RVG A;  4OLL A;  3G6E 1;  1P4N A;  1KUV A;  3R96 A;  4PXC A;  4CAF A;  4CGN A;  2IV2 X;  2PMZ A;  3CXC Y;  5IP7 I;  2QLV B;  1LCP A;  4AG9 A;  3RZO I;  3LAC A;  1FT7 A;  2YND A;  2E7Z A;  3W6X A;  3GTK I;  1QSO A;  3CC2 1;  4OAD A;  5DS0 A;  2PRQ A;  4GXH A;  1ZG8 A;  4RVD A;  1VQM Z;  3F5B A;  4P10 A;  3CPW Z;  1CX8 A;  3QNV A;  1L0C A;  3KZW A;  4ZY0 A;  2I00 A;  2P6G A;  3IR7 A;  2QA4 1;  3DR6 A;  4MD8 A;  2FS5 A;  4A3B I;  4DJL A;  1VHO A;  3PB7 X;  2B4B A;  3F3P C;  4P4D A;  2C6P A;  4KOS A;  3R95 A;  3SXN A;  2ZW6 A;  1XEB A;  4B10 A;  4OC1 A;  4S1T A;  1K83 I;  4NBD A;  3TCV A;  3FF3 A;  4TNU A;  4XPL A;  1RO0 A;  4BBS I;  2G0B A;  3EFA A;  4AB7 A;  2OU2 A;  4IAV A;  1M1D A;  2BO9 A;  2PJ0 A;  3GKR A;  4Z65 A;  3CCE Z;  4A32 A;  1K8A 1;  4MD7 A;  3QWU A;  3F0A A;  1QMU A;  1R3N A;  2OZH A;  1NSL A;  4ZY2 A;  1YR0 A;  4A3G I;  2PJB A;  4B12 A;  2ZAE B;  1QVF Z;  2J8N A;  1ZH1 A;  2FIA A;  1TKH A;  2OTJ 1;  1Y7E A;  2AFM A;  1N71 A;  5I0C A;  4Y52 I;  3I4N I;  4JXQ A;  1YK3 A;  3KAS A;  1HDU A;  1VQK Z;  2NAP A;  2Y0M A;  3KQZ A;  4OIW A;  3R1K A;  5EBV A;  2HU9 A;  2VPY A;  5A2Q f;  1OZP A;  1VQN Z;  2VZZ A;  3QAH A;  4E2A A;  2ANP A;  1YJN 1;  4PK3 A;  3WR7 A;  2BJO A;  2JA8 I;  1VHE A;  4CGL A;  3BJ8 A;  4KVM E;  3W6S A;  2QEC A;  3B3T A;  3CCR Z;  1VQ7 1;  3IFE A;  3JAM f;  1QSN A;  2FE7 A;  4NBG A;  2PIZ A;  1I1D A;  3RZD I;  4CAX A;  1SFO I;  4QTU A;  4EWC A;  3CPA A;  4CPA A;  4UEZ A;  4AG7 A;  4ZYQ A;  2EWB A;  1VQP 1;  1Q2C A;  3S1M I;  2AKL A;  1Z4R A;  1Z8W A;  1BLL E;  3CPW Y;  5F49 A;  3SI0 A;  4PSX A;  2JR6 A;  4KOR A;  1KC8 1;  3SI1 A;  2O53 A;  3CD6 1;  4F0Y A;  2YAD A;  1B87 A;  2WAQ A;  4BD9 A;  3DNS A;  2AYD A;  4FD5 A;  3NH4 A;  4R87 A;  3S9M A;  4DK1 A;  3WC7 A;  3G4S Z;  1VHS A;  3CCL Z;  3S6F A;  1XOV A;  6CPA A;  3TC8 A;  3TDH B;  2JA6 I;  2VUG A;  3EY5 A;  3TO7 A;  2V8G A;  2WZN A;  3TE4 A;  4UCP A;  3GUX A;  4MY0 A;  4ZY1 A;  5GCN A;  2ODF A;  1YX0 A;  2EK9 A;  1ARM A;  3D8P A;  4BBR I;  2DE7 A;  1IY7 A;  1K9M 2;  3HOW I;  2K5R A;  1TF8 A;  1EE3 P;  2GFQ A;  1WJ2 A;  4CRY B;  2GLF A;  1LAN A;  3QB8 A;  3NFZ A;  1RNI A;  4R3L A;  4QUS A;  1ON0 A;  3I56 1;  3DGV A;  4PQA A;  2AFO A;  3MRU A;  4LQ6 A;  3MON A;  4RI1 A;  1JWH C;  2EK8 A;  2NVX I;  3HLP A;  1KD1 2;  5THW A;  4RV9 A;  1K73 1;  2POK A;  4MRI A;  2XEI A;  4NXY A;  4UIA A;  5HVF A;  2AFX A;  1FDI A;  4I49 A;  1B6B A;  1WCM I;  3CCM 1;  1J4J A;  3I55 Z;  3GTG I;  2C6C A;  2PVW A;  2M48 A;  2KI7 B;  2W04 A;  4E2X A;  5C4X I;  2OTL 1;  3GTL I;  3J81 b;  4KSI A;  1YI2 Z;  2REE A;  2G2K A;  2JIR A;  2J9A A;  4KOT A;  1RO2 A;  4OC0 A;  2R6M A;  1YQE A;  2B4D B;  4MHY A;  1BPM A;  3I4M I;  2WYR A;  1Z2L A;  2JDC A;  4NEX A;  1Z03 A;  1RLY A;  3S6K A;  3KKW A;  3RZA A;  1Y1V S;  2I79 A;  3G71 Z;  3FYN A;  2QEX Z;  3S16 I;  1SQH A;  1TIQ A;  4NGN A;  2P3Y A;  4C2Z A;  3CCQ 1;  1XJO A;  4BY1 I;  4E8O A;  3P2F A;  2VPZ A;  1S60 A;  4IUS A;  4A3M I;  3OW2 Z;  1YW4 A;  4DQY B;  2JEW A;  2RHB A;  3S1N I;  4RS2 A;  1CP7 A;  5JQ4 A;  2PJ5 A;  3CCJ 1;  4PSW A;  2IL4 A;  2PJ2 A;  2DF5 A;  3FMC A;  4MON A;  1Q81 1;  1YRE A;  4BY7 I;  1VQ8 1;  2OH1 A;  2YU9 I;  1RO5 A;  4B14 A;  5IV0 A;  5DWM A;  3D2M A;  1TWG I;  3CXC Z;  3JVN A;  3TTH A;  1X3W A;  3GTM I;  3CC7 1;  1UFH A;  2PJ7 A;  2E2I I;  1YUA A;  4FD6 A;  2JA7 I;  3F8K A;  4R57 A;  2JIP A;  3S2D I;  3P2H A;  4YGO A;  4CYN A;  1Q2Y A;  2V8D A;  4Y49 B;  2WSA A;  3SHP A;  4P4I A;  4GS4 A;  3ESW A;  4MCR A;  4UEF A;  3CMA 1;  4A3D I;  4E32 A;  2HV2 A;  2FSR A;  2HB6 A;  4CYP A;  2QRE B;  3FQQ A;  2Q43 A;  4QC6 A;  3D3S A;  4R76 A;  2HQY A;  4PPZ A;  5F47 A;  3V7Z A;  2Z3L A;  3EO4 A;  3BHX A;  4QBJ A;  2FT0 A;  4ORF A;  4OC5 A;  2Z3K A;  4JD6 A;  1K4J A;  3ISX A;  1VKC A;  4UFX A;  1IGB A;  2IMO A;  2AFZ A;  3FX6 A;  4R3K A;  2NVT I;  5AG7 A;  1Q7Y 1;  1CPS A;  2VPW A;  1YLE A;  5H86 A;  4RUH A;  2Z3O A;  5K8O A;  1N8R 2;  1I3Q I;  3RYO A;  1VQ4 Z;  4E2Y A;  3PB4 X;  4A95 A;  3J81 f;  1IB1 E;  4A3C I;  5CPA A;  5LYD A;  1P0H A;  2B4D A;  4NGM A;  4NSQ A;  1S7L A;  2BUE A;  4G1P A;  1TWC I;  3LOD A;  4J3G A;  4OAE A;  1ZB9 A;  5AN9 F;  2GAN A;  1TXR A;  3T90 A;  2ABZ A;  2HUZ A;  2C27 A;  2NVQ I;  4MCP A;  5LRJ A;  3KI9 A;  3KGQ A;  3UY5 A;  3RAM A;  4FD4 A;  2JIO A;  2Z11 A;  5J1Q A;  5AGE A;  4DGL A;  4A30 A;  1JJ2 Y;  3WC6 A;  4X3R A;  4MFL A;  4P6Y A;  1VQM 1;  5HH1 A;  2VQY A;  5D29 A;  1QST A;  3VWD A;  4MHD A;  2CIJ A;  2LIY A;  5D1O B;  5KTC A;  3CME 1;  2EGT A;  3FBU A;  1PYT B;  5JH9 A;  1PFT A;  4NBH A;  4A3I I;  2PC1 A;  4CYO A;  4KOW A;  2O4H A;  3H8G A;  4A39 A;  3B35 A;  1ZG9 A;  3RBU A;  1YVK A;  2XEJ A;  2AFS A;  1XMT A;  3VMH A;  3FXT A;  8CPA A;  4A31 A;  2DEA A;  2WUU A;  3WC5 A;  4B5P B;  2CXA A;  4NGQ A;  3B7I A;  4NOZ A;  3BLN A;  5IP9 I;  5J8F A;  3K2K A;  2GE3 A;  2OZU A;  4NJQ A;  5K8N A;  3G6E Z;  3VWE A;  2OOY B;  4FAI A;  2G3A A;  1P9N A;  3D7F A;  1U6M A;  5LRG A;  2DXQ A;  4Q7A A;  2F4O A;  2Z10 A;  4NGP A;  1VQK 1;  3D66 A;  1NJI 2;  4KLV A;  1RXT A;  5I4M A;  2JDD A;  3PEI A;  2ZEN A;  4C2X A;  1TWH I;  4MXU A;  4IHM A;  2VUM I;  4KOX A;  4MHN A;  1XE4 A;  3SJG A;  5IB9 A;  4M3S A;  3CCR 1;  2BSW A;  2QR1 B;  3Q87 A;  1GHE A;  1NSA A;  4NJR A;  5HVH A;  2RBL A;  3VMI A;  1X12 A;  4U9Y A;  4ZBG A;  2VF1 A;  3KIF A;  4OKO A;  2R1I A;  5JGF A;  1YUK A;  3S6G A;  1FDO A;  3GYA A;  3GTQ I;  1BPN A;  1YW6 A;  2EVN A;  4XX2 A;  2OR4 A;  3DLJ A;  3BI0 A;  2P6F A;  3KR4 A;  3HOU I;  4AVC A;  4W9Y A;  4IK2 A;  4HH4 A;  1ARL A;  1S7K A;  4UFV A;  3KHZ A;  4RS4 A;  4R8F A;  1Q82 1;  3HOZ I;  2PJ3 A;  5AG5 A;  1LFW A;  2YNE A;  3E0K A;  3B3W A;  2NMT A;  3N5F A;  1AA6 A;  1AYE A;  1QSM A;  4PK2 A;  5J8C A;  4ZX8 A;  2PJC A;  2H85 A;  3RO0 A;  2BL1 A;  1YIJ 1;  3PBB A;  4C7I A;  3SXO A;  3H4Q A;  4NF1 A;  2Q44 A;  4PXD A;  2F8H A;  4KVO E;  4YU9 A;  3CCS Z;  3CCU Z;  2W03 A;  3MZL B;  4R6T A;  1YJN Z;  2ZXV A;  1QSR A;  3D9X A;  1M1K 1;  2XEF A;  1VQ6 1;  2YGW A;  1Q16 A;  4M85 A;  1VQ5 1;  1XIX A;  1VQ7 Z;  2M6N A;  4ZGY B;  3NE7 A;  1PCA A;  4A3L I;  3JTK A;  1R43 A;  5AG4 A;  4B5P A;  1ZB8 A;  2LEX A;  4HNX B;  1KRL A;  4DYO A;  3GTO I;  1IU8 A;  3D7D A;  2VEZ A;  3GTM S;  4RVF A;  2JIQ A;  2CY2 A;  4OID A;  3GTJ I;  2RPR A;  1XFO A;  4A3K I;  4XPD C;  2G3T A;  4MI4 A;  4FBE A;  1XRY A;  4IF5 A;  2PJ8 A;  2Q04 A;  1A2Z A;  1M44 A;  2Q51 A;  3IF8 A;  2IZ4 A;  1Y9W A;  5G20 A;  1YHQ Z;  4MD9 A;  5LYI A;  3CC4 Z;  4H6U A;  3MGD A;  4C68 A;  3CXP A;  4TWE A;  4F9V A;  3I55 1;  3CZX A;  1S72 Z;  4F9U A;  3B3V A;  4YRH A;  3FJU A;  1KWM A;  1YI2 1;  4XPD B;  1R9T I;  1QF8 A;  2CTB A;  4GM5 A;  1K8A 2;  1Z4E A;  1M4D A;  4XNH C;  1S7F A;  2PJ4 A;  2V8I A;  3NE8 A;  4X8I A;  4UWI A;  3FB3 A;  3KR5 A;  2ZW5 A;  3IEH A;  3CPX A;  1N2F A;  3GY9 A;  3D6W A;  3FED A;  1M4L A;  2QML A;  3CDX A;  5FLX b;  4EVY A;  4KVX A;  3G71 1;  3HKZ A;  1YJ9 1;  3IIB A;  2GIV A;  1N8R 1;  7CPA A;  3IO1 A;  2CNT A;  4MHZ A;  1Q86 1;  1RTQ A;  2LFU A;  1KQS Y;  2P0W A;  1AUG A;  4MFJ A;  3NA6 A;  3R9G A;  4XNH B;  5KTA A;  2PQ8 A;  3IX0 A;  4II9 A;  3NDI A;  2RB7 A;  3LMS A;  3EER A;  4BXX I;  4P45 A;  3PB8 X;  2PR1 A;  3IU2 A;  1DTD A;  1VIX A;  3S1Q I;  3TFY A;  2JLM A;  4QTT A;  4H6Z A;  1M90 1;  2PSW A;  5D1P A;  4M6I A;  2WB1 A;  3IWE A;  2NVY I;  3GTP I;  3PO2 I;  3GCF A;  4EWT A;  3EED A;  2QRC B;  4P4F A;  2Q4V A;  4C7H A;  2OTL Z;  2AE6 A;  4MFQ A;  1VQO 1;  4KSA A;  1JJ2 Z;  1VQ9 1;  3BJ7 A;  4JXR A;  3TE5 B;  1KC8 2;  2CTC A;  1CP6 A;  2JBJ A;  1FY7 A;  3D7G A;  3PP9 A;  2E2J I;  1M4G A;  4RN7 A;  3V38 A;  2QJ8 A;  1Z8X A;  1S5K A;  3JUW A;  1NE9 A;  3CXQ A;  5CBM A;  1Y9K A;  1CM0 A;  4CGO A;  2J8M A;  5A28 A;  4NGR A;  1R57 A;  4ZX9 A;  4MCS A;  1YJW Z;  2A4N A;  1BAV A;  4HKF A;  3B3C A;  3D68 A;  1I50 I;  5C88 A;  3W91 A;  4PV6 A;  3KIH A;  2REF A;  4MY3 A;  1CJW A;  4KOU A;  2R7H A;  2ZEL A;  4KZT A;  2KPI A;  2Q0Y A;  1YLO A;  4E0A A;  2IZ3 A;  4A3J I;  2VXK A;  2JEV A;  3VH9 A;  4OC2 A;  4PXB A;  1TF9 A;  3IC1 A;  5HVG A;  1CPX A;  4NBF A;  1Z9U A;  4KUB A;  1WW9 A;  2X7B A;  3IWG A;  3HOV I;  1VQ8 Z;  3PFE A;  5F09 A;  2WPX A;  2OB0 A;  4DNC A;  4MFP A;  2ZEF A;  2PCU A;  3HOY I;  1WZN A;  1RO4 A;  2VZY A;  1ZG7 A;  1VQL 1;  3PBE A;  2Z3M A;  2K3R A;  5FLX f;  2PK7 A;  2D4P A;  5F48 A;  1RQF A;  1IYL A;  1MJA A;  1K73 2;  3CCV Z;  3H0G I;  4HGY A;  4JJX A;  4AYB A;  1HEE A;  2JBK A;  3PO3 I;  3GLJ A;  4QB9 A;  4CAW A;  2BCO A;  1Z8T A;  1BO4 A;  4ONW A;  4CAE A;  2JNY A;  4JWP A;  2F7V A;  4AVB A;  2QKD A;  2EUI A;  4XPK A;  4HGZ A;  1ZLI A;  4CRZ B;  2PJA A;  3G3S A;  1QYP A;  4ZI6 A;  1H8L A;  1PU9 A;  3T4N B;  1TFI A;  4LQG A;  5CM2 M;  4NGT A;  3VAT A;  4BBH A;  5C4J I;  4MBU A;  2R8V A;  4BIN A;  4M6G A;  1Z01 A;  5G1Z A;  4B11 A;  2C6G A;  3R9F A;  5T67 A;  1WII A;  3B2Y A;  3SI2 A;  2B5G B;  3KHX A;  1DL6 A;  2FCK A;  3SJE A;  2ZEO A;  1LQL A;  2J8R A;  2ZEM A;  4KOY A;  3GKQ A;  3S14 I;  2PDO A;  1YIT Z;  1TKF A;  2ZOF A;  1Q2D A;  3KL9 A;  5KTD A;  1GYT A;  2IQ6 A;  3CXS A;  4K3N A;  4NBB A;  3NH8 A;  2OZG A;  4NH1 C;  2HC9 A;  4DUK A;  4E2Z A;  1Q81 2;  4UCN A;  1IOF A;  5E96 A;  1VGY A;  4KOV A;  5DWN A;  2FVG A;  4UFW A;  4A38 A;  1UWY A;  3CCE 1;  2ZEG A;  5AG6 A;  5CNP A;  2V8K A;  5HMN A;  2P28 A;  4R7M A;  4CGM A;  3CME Z;  4KLW A;  4P44 A;  4HPS A;  5BWA B;  2OOX B;  4CAV A;  2JA5 I;  3PRT A;  1NUI A;  2V77 A;  1NP6 A;  1Y0R A;  1NMT A;  2B3V A;  4PXE A;  3SJX A;  3D4U A;  2R7Z I;  3CC2 Z;  5D8N A;  4H2K A;  2ARH A;  1K9M 1;  2Q7S A;  2GTH A;  1W2B Y;  3EC4 A;  1PUA A;  1VQN 1;  3TOB A;  4R9M A;  1M4I A;  3LD2 A;  2OOT A;  2GLJ A;  3S15 I;  2ZED A;  4OP4 A;  5T6B A;  3HOX I;  3ZZI A;  2RC4 A;  4L8A A;  2BOA A;  4AVA A;  2ZEH A;  2GU2 A;  2QA4 Z;  4NGS A;  2F4M A;  2AFU A;  1WK4 A;  4LUA A;  3F3F C;  3DDD A;  1TKJ A;  1KD1 1;  3CQZ I;  3VMG A;  1Q7Y 2;  2DE5 A;  1LAM A;  3ZJ0 A;  4E2W A;  1LAP A;  4X6A I;  1QVG Y;  4QVT A;  5LRK A;  4UBR A;  1JWQ A;  4MFZ A;  4L89 A;  3KQX A;  2FIW A;  2GTI A;  4MMO A;  5G22 A;  3CCS 1;  4HNW B;  1SIW A;  3CCU 1;  5LYL A;  2E9H A;  1YSJ A;  3H3V J;  2PJ9 A;  1VLA A;  4JZ0 A;  3IGR A;  2OTJ Z;  1KQS Z;  4UF4 A;  5ISV A;  2V8V A;  3IJ3 A;  4B5O A;  5IX3 A;  4UWJ A;  3QAY A;  4A37 A;  5D1O A;  4KSF A;  3FVL A;  3ISZ A;  2B5G A;  3K9T A;  3J80 b;  3G4S 1;  3S9N A;  4MJ8 A;  3BG0 B;  3CCL 1;  3OWC A;  3IWW A;  2PIY A;  3PGP A;  3H8E A;  4OME A;  5T64 A;  2IJZ A;  2XEG A;  4F8Z A;  1IOI A;  2V3V A;  3VTN A;  1BOB A;  1YVO A;  3LWU A;  3EXN A;  3B8G A;  4MCQ A;  2VBQ A;  1Z8L A;  3K7A I;  2R98 A;  3V8I A;  3MN8 A;  1CBX A;  1MJB A;  4CYQ A;  3I9S A;  1HDQ A;  4NBE A;  1YHQ 1;  3S1R I;  3D67 A;  1OBR A;  1F2O A;  1I6H I;  4U5Y A;  3CC4 1;  4Q36 A;  4CGP A;  2AJ6 A;  1S7M A;  1MK4 A;  3J7A 4;  3MZK B;  4O23 A;  3H8F A;  2ZW4 A;  1YIJ Z;  2R92 I;  5JPH A;  2R93 I;  3TT2 A;  4F0X A;  1S72 1;  4P4B A;  1VQP Z;  3D2L A;  2Q4Y A;  4H89 A;  3TO6 A;  4EFD A;  5C82 A;  3DSB A;  1IID A;  2ZOG A;  4KS9 A;  1KUX A;  1ZO0 A;  3TO9 A;  3VAR A;  4A93 I;  3M4O I;  2CNS A;  4FD7 A;  2JIM A;  1Y7R A;  4UIB A;  3CD6 Z;  1XF8 A;  1VQ6 Z;  4X5K A;  4UCM A;  1VQ5 Z;  1X0T A;  4WWV A;  2PJ1 A;  5F46 A;  2QVP A;  1LOK A;  5G21 A;  1QVF Y;  2Y0S A;  3BXM A;  2QIR A;  3G8W A;  3JRU A;  3PFO A;  4C2Y A;  4CL1 A;  4B6Z A;  2Z3P A;  2EO8 A;  1XMB A;  4KUA A;  2RT9 A;  2F5I A;  3DR8 A;  5IT9 b;  1YME A;  2CNM A;  4NB8 A;  4A3F I;  3D2P A;  2Q4Z A;  3H5Z A;  1I21 A;  4FUU A;  2DE6 A;  1JQG A;  2P6E A;  1YGH A;  2Q7B A;  3PO3 S;  3S17 I;  2B63 I;  4A94 A;  2QEX 1;  4X2T A;  5C3E I;  3NH5 A;  4Q38 A;  2GRE A; 
#chains in the Genus database with same CATH homology
 4QTU A;  4EWC A;  1WW9 A;  2XEJ A;  2AFS A;  3CPA A;  4CPA A;  2HF1 A;  3VMH A;  4UEZ A;  3SJF A;  3HOV I;  8CPA A;  1VQ8 Z;  3M3Y I;  2JUB A;  3PFE A;  3S2H I;  2DEA A;  3WC5 A;  4ZYQ A;  4NGQ A;  2EWB A;  3HUV A;  5F09 A;  3I07 A;  1VQP 1;  4MH4 A;  3B7I A;  4NOZ A;  3S1M I;  5ELY A;  2AKL A;  2RIQ A;  3I56 Z;  4EME A;  2ZEF A;  2PCU A;  1BLL E;  3HOY I;  3CPW Y;  5IP9 I;  5HXD A;  3SI0 A;  2ZEP A;  2RFH A;  1RO4 A;  1Z5R A;  3K2K A;  1Q7L A;  2JR6 A;  1CG2 A;  4NJQ A;  1ZG7 A;  1KC8 1;  1VQL 1;  2PJ6 A;  4FWU A;  5K8N A;  3SI1 A;  3G6E Z;  2O53 A;  1Q82 2;  3PBE A;  3CD6 1;  2OOY B;  2K3R A;  2YAD A;  2PK7 A;  4NBA A;  5FLX f;  4FAI A;  1P9N A;  5JM6 A;  4E33 A;  1RQF A;  3D7F A;  5LL6 f;  5LRG A;  5LYF A;  2WAQ A;  4Q7A A;  1K73 2;  3CCV Z;  3H0G I;  3LUS A;  2QRD B;  4HGY A;  3J80 f;  4E30 A;  2F4O A;  4BD9 A;  4AYB A;  1HEE A;  4NGP A;  2JBK A;  3PO3 I;  3BG1 B;  3GLJ A;  1VQK 1;  1XBU A;  3D66 A;  1Y0Y A;  1NJI 2;  3CCM Z;  2BCO A;  3NH4 A;  4YWY A;  5I4M A;  3S9M A;  1ELM P;  4RVH A;  4DK1 A;  2C1C A;  4ONW A;  3WC7 A;  3PEI A;  3G4S Z;  3PB6 X;  2OZK A;  1YJ9 Z;  2ZEN A;  1TWH I;  2JNY A;  3CCL Z;  4MXU A;  3B3S A;  1YJW 1;  2F7V A;  1USP B;  2E2H I;  4IHM A;  1DE4 C;  6CPA A;  2VUM I;  2QKD A;  3FEC A;  3TC8 A;  4NB9 A;  4MHN A;  4HGZ A;  1ZLI A;  3TDH B;  2JA6 I;  3SJG A;  2NSM A;  2G9D A;  5IB9 A;  2PJA A;  3NDJ A;  2VUG A;  2QR1 B;  3CCR 1;  1QYP A;  3Q87 A;  4P4J A;  4ZI6 A;  1H8L A;  1M1K 2;  1NSA A;  4NJR A;  2V8G A;  2WZN A;  5HVH A;  2RBL A;  3GUX A;  3T4N B;  3VMI A;  1TFI A;  4ZY1 A;  4LQG A;  5CM2 M;  4NGT A;  3VAT A;  2VF1 A;  5C4J I;  3KIF A;  2PVV A;  1AMP A;  2V8J A;  4OKO A;  2EK9 A;  1Z01 A;  4UEE A;  5JGF A;  1YUK A;  1ARM A;  4BBR I;  3GTQ I;  2C6G A;  2DE7 A;  1IY7 A;  1BPN A;  1K9M 2;  3HOW I;  1YW6 A;  2K5R A;  1TF8 A;  1EE3 P;  4XX2 A;  4OC3 A;  2GLF A;  1LAN A;  5T67 A;  1WII A;  2OR4 A;  1TWA I;  3B2Y A;  3CCQ Z;  3BI0 A;  3DLJ A;  3KR4 A;  3SI2 A;  3NFZ A;  3KHX A;  1RNI A;  1DL6 A;  3TX8 A;  3P5J B;  3HOU I;  3SJE A;  2ZEO A;  1LQL A;  3FH4 A;  4W9Y A;  4IK2 A;  3I56 1;  4HH4 A;  1ARL A;  2ZEM A;  3GKQ A;  3KHZ A;  3S14 I;  3DGV A;  4PQA A;  2AFO A;  3MRU A;  4RS4 A;  1YIT Z;  1TKF A;  2ZOF A;  4R8F A;  3MON A;  3KL9 A;  1Q82 1;  1JWH C;  3HOZ I;  2EK8 A;  1GYT A;  2IQ6 A;  2PJ3 A;  4K3N A;  1VQO Z;  2NVX I;  3HLP A;  4NBB A;  3NH8 A;  3IFU A;  1KD1 2;  1LFW A;  3PB9 X;  3CCJ Z;  3N5F A;  3B3W A;  5THW A;  4AXV A;  4Y7N I;  4NH1 C;  4RV9 A;  1K73 1;  2POK A;  2VL1 A;  1VQ9 Z;  4MRI A;  2HC9 A;  1AYE A;  2XEI A;  4UIA A;  4DUK A;  5HVF A;  3CCV 1;  2AFX A;  1VQ4 1;  4ZX8 A;  2PJC A;  4E2Z A;  2H85 A;  1Q81 2;  2V8H A;  1TWF I;  3FEE A;  1VGY A;  1YIJ 1;  3PBB A;  1NJI 1;  2FVG A;  1ML8 A;  1WCM I;  3CCM 1;  4A38 A;  2I3C A;  3I55 Z;  3BI1 A;  3GTG I;  2C6C A;  4MHP A;  2PVW A;  2M48 A;  1UWY A;  2KI7 B;  2W04 A;  3CCE 1;  4E2X A;  5C4X I;  2ZEG A;  2OTL 1;  4PXD A;  3GTL I;  3J81 b;  2F8H A;  4KSI A;  4YU9 A;  2V8K A;  3CCS Z;  1YI2 Z;  2JMO A;  5IT9 f;  2G2K A;  3CCU Z;  2W03 A;  3MZL B;  2PM9 A;  4WJB A;  2P28 A;  3CC7 Z;  2J6A A;  2CF4 A;  4P4E A;  4R6T A;  2J9A A;  4R7M A;  4OC4 A;  1YJN Z;  1RO2 A;  4OC0 A;  2R6M A;  3CME Z;  4MHY A;  4P44 A;  3D9X A;  1W2B Z;  1M1K 1;  2OOX B;  1BPM A;  2XEF A;  1VQ6 1;  2JA5 I;  3I4M I;  1FNO A;  2WYR A;  1Z2L A;  3L2N A;  3FKI I;  3GB0 A;  1VQ5 1;  5K8M A;  3S9L A;  4NBC A;  3PRT A;  1F57 A;  1NUI A;  1VQ7 Z;  2V77 A;  1Z03 A;  2ZEE A;  1RLY A;  2M6N A;  1NP6 A;  1Y0R A;  4PXE A;  3SJX A;  1L1O C;  4E31 A;  1PCA A;  2NYQ A;  4A3L I;  3D4U A;  2R7Z I;  3CC2 Z;  3RZA A;  1Y1V S;  5D8N A;  4A3E I;  3CMA Z;  4H2K A;  1R43 A;  1K9M 1;  2GTH A;  1W2B Y;  3G71 Z;  1ZB8 A;  1Y1W I;  1VQN 1;  2QEX Z;  3S16 I;  4NGN A;  3WT4 A;  1KRL A;  1X3Z A;  2P3Y A;  1Z02 A;  4DYO A;  3GTO I;  3CCQ 1;  1XJO A;  4BY1 I;  5C44 I;  3D7D A;  2OOT A;  1Q86 2;  2GLJ A;  3GTM S;  3S15 I;  4RVF A;  2ZED A;  4OP4 A;  5T6B A;  4OID A;  3HOX I;  3GTJ I;  1ZLH A;  2RPR A;  5A2Q b;  2BOA A;  1ELL P;  2ZEH A;  2GU2 A;  2QA4 Z;  4NGS A;  1XFO A;  4A3K I;  4A3M I;  2F4M A;  3OW2 Z;  1QVG Z;  3U50 C;  4FBE A;  2AFU A;  1XRY A;  5FLM I;  3T8W A;  2PJ8 A;  3VB9 A;  1YW4 A;  3F3F C;  4DQY B;  1YIT 1;  2AFW A;  2JEW A;  2RHB A;  1TKJ A;  3S1N I;  1CP7 A;  1KD1 1;  2PJ5 A;  3CQZ I;  2Q51 A;  3IF8 A;  4NFR A;  3CCJ 1;  2IZ4 A;  2PJ2 A;  3VMG A;  1VQL Z;  1YHQ Z;  3JAM b;  3FMC A;  1M90 2;  3D7H A;  4MON A;  3FQM A;  1Q7Y 2;  1Q81 1;  4MD9 A;  2PE3 A;  2DE5 A;  1LAM A;  4E2W A;  1LAP A;  5LYI A;  4X6A I;  3OW2 Y;  1QVG Y;  3CC4 Z;  4BY7 I;  5K8P A;  5LRK A;  1VQ8 1;  2QYV A;  2YU9 I;  3I1U A;  1USP A;  4TWE A;  1Y1V I;  4F9V A;  3I55 1;  1F2P A;  3KQX A;  3CT9 A;  2GTI A;  1TWG I;  1S72 Z;  4F9U A;  3B3V A;  3WAB A;  3CXC Z;  4MMO A;  4JYW A;  3FJU A;  1KWM A;  3CCS 1;  1YI2 1;  1R9T I;  1QQ9 A;  1X3W A;  3CCU 1;  3GTM I;  1QF8 A;  2CTB A;  5LYL A;  3CC7 1;  1K8A 2;  2PJ7 A;  4GM5 A;  2JS4 A;  4RVG A;  2E2I I;  2E9H A;  3G6E 1;  1YSJ A;  1YUA A;  3H3V J;  2PJ4 A;  2JA7 I;  2PJ9 A;  4PXC A;  2V8I A;  1VLA A;  4JZ0 A;  4X8I A;  3S2D I;  3KR5 A;  2OTJ Z;  2V8D A;  3IEH A;  2PMZ A;  3CXC Y;  5IP7 I;  2QLV B;  1LCP A;  3RZO I;  1KQS Z;  4UF4 A;  3CPX A;  1N2F A;  3D6W A;  2V8V A;  1M4L A;  3FED A;  4P4I A;  1FT7 A;  3IJ3 A;  3CDX A;  3ESW A;  5FLX b;  4A37 A;  3GTK I;  5D1O A;  3CC2 1;  4MCR A;  4UEF A;  3CMA 1;  5DS0 A;  4A3D I;  3FVL A;  4E32 A;  3ISZ A;  3G71 1;  2PRQ A;  3K9T A;  3HKZ A;  3J80 b;  3G4S 1;  3S9N A;  1YJ9 1;  3IIB A;  3BG0 B;  3CCL 1;  1ZG8 A;  1N8R 1;  2HB6 A;  4RVD A;  7CPA A;  1VQM Z;  3IO1 A;  4P10 A;  3IWW A;  2PIY A;  2QRE B;  3FQQ A;  3CPW Z;  2Q43 A;  4MHZ A;  1Q86 1;  1CX8 A;  1RTQ A;  4R76 A;  3QNV A;  2LFU A;  1KQS Y;  4PPZ A;  3H8E A;  4OME A;  3KZW A;  4ZY0 A;  5T64 A;  3V7Z A;  2IJZ A;  2XEG A;  3NA6 A;  4F8Z A;  3BHX A;  3VTN A;  2QA4 1;  3IX0 A;  3LWU A;  4MD8 A;  3NDI A;  2RB7 A;  3LMS A;  4A3B I;  4MCQ A;  3EER A;  4BXX I;  4DJL A;  4P45 A;  3PB8 X;  1VHO A;  1Z8L A;  3PB7 X;  3K7A I;  3F3P C;  4P4D A;  1DTD A;  1VIX A;  2C6P A;  4OC5 A;  3S1Q I;  3MN8 A;  1CBX A;  4QTT A;  3ISX A;  1IGB A;  2IMO A;  2AFZ A;  4OC1 A;  3FX6 A;  1M90 1;  2NVT I;  4S1T A;  1K83 I;  1HDQ A;  4NBE A;  4NBD A;  1Q7Y 1;  1YHQ 1;  1CPS A;  3FF3 A;  3S1R I;  3D67 A;  4TNU A;  1OBR A;  1F2O A;  1I6H I;  3CC4 1;  5D1P A;  4RUH A;  2WB1 A;  5K8O A;  1N8R 2;  1I3Q I;  1RO0 A;  1S7M A;  1VQ4 Z;  4E2Y A;  3J7A 4;  3PB4 X;  3MZK B;  4BBS I;  4O23 A;  2NVY I;  3J81 f;  3GTP I;  3PO2 I;  3H8F A;  1YIJ Z;  2R92 I;  3GCF A;  4A3C I;  4EWT A;  4IAV A;  2R93 I;  5CPA A;  3EED A;  5LYD A;  2QRC B;  1S72 1;  2BO9 A;  4P4B A;  1VQP Z;  4NGM A;  4P4F A;  2PJ0 A;  4G1P A;  1TWC I;  4EFD A;  4Z65 A;  3CCE Z;  1K8A 1;  4MD7 A;  2OTL Z;  2ZOG A;  3QWU A;  1ZB9 A;  1QMU A;  1R3N A;  5AN9 F;  4ZY2 A;  1TXR A;  1VQO 1;  4A3G I;  2PJB A;  2ZAE B;  3VAR A;  2ABZ A;  1QVF Z;  1JJ2 Z;  1ZH1 A;  4A93 I;  2NVQ I;  3M4O I;  1TKH A;  1VQ9 1;  4MCP A;  4UIB A;  5LRJ A;  2OTJ 1;  3TE5 B;  1KC8 2;  3KI9 A;  3CD6 Z;  1CP6 A;  2CTC A;  2JBJ A;  3KGQ A;  1Y7E A;  1VQ6 Z;  3D7G A;  2AFM A;  3RAM A;  4Y52 I;  3I4N I;  2E2J I;  1VQ5 Z;  1X0T A;  3V38 A;  2QJ8 A;  5J1Q A;  4WWV A;  4DGL A;  2PJ1 A;  5CBM A;  3KAS A;  1HDU A;  1LOK A;  1VQK Z;  2QVP A;  1QVF Y;  2Y0S A;  1JJ2 Y;  3WC6 A;  3KQZ A;  4X3R A;  4P6Y A;  3BXM A;  1VQM 1;  4OIW A;  4NGR A;  3JRU A;  3PFO A;  2HU9 A;  4CL1 A;  4B6Z A;  5D29 A;  5A2Q f;  4ZX9 A;  1VQN Z;  2CIJ A;  4MCS A;  1YJW Z;  2LIY A;  1XMB A;  5D1O B;  2ANP A;  1YJN 1;  1BAV A;  3CME 1;  2BJO A;  2JA8 I;  1VHE A;  2RT9 A;  2EGT A;  3B3C A;  3D68 A;  1I50 I;  5IT9 b;  1PYT B;  1YME A;  3KIH A;  3CCR Z;  3B3T A;  4NB8 A;  5JH9 A;  1PFT A;  4NBH A;  4A3F I;  1VQ7 1;  2ZEL A;  2Q4Z A;  3IFE A;  2KPI A;  4FUU A;  3JAM f;  1YLO A;  2IZ3 A;  4A3I I;  2DE6 A;  1JQG A;  4A3J I;  2O4H A;  3H8G A;  4A39 A;  3B35 A;  1ZG9 A;  3VH9 A;  3PO3 S;  4OC2 A;  3RBU A;  3S17 I;  2B63 I;  4PXB A;  4A94 A;  4NBG A;  2QEX 1;  1TF9 A;  4X2T A;  2PIZ A;  3IC1 A;  5HVG A;  1CPX A;  4NBF A;  5C3E I;  3NH5 A;  3RZD I;  1SFO I;  2GRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...