4MRIA

Human brain aspartoacylase mutant f295s complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEASAKTTKLTLNAKSIRCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mriA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mriA01
2PJ2A 3B7IA 1YW6A 3ISXA 4A37A 5K8NA 2FVGA 2O53A 1ELMP 3BXMA 3NFZA 1VHEA 3WC6A 1YSJA 4A39A 3BI1A 2AFUA 4OMEA 3DGVA 4PXEA 2CF4A 4R8FA 5IB9A 4DJLA 3CT9A 1PCAA 4NJQA 1EE3P 5THWA 2F8HA 3KQXA 4F9UA 4PXCA 1JQGA 4X2TA 4R7MA 1ARLA 3MN8A 4P4IA 1QQ9A 4ZY1A 2PJ5A 3PB7X 3BHXA 3RZAA 4BD9A 3LMSA 3B3SA 4OKOA 3IIBA 3KASA 2EK8A 4MRIA 1ELLP 2ANPA 5I4MA 2EWBA 1CP7A 1LFWA 3S9MA 5LRGA 4UIAA 4F8ZA 3FH4A 3H8FA 2V8VA 3B3CA 3PFOA 2XEJA 4RUHA 5D8NA 3IEHA 5HVHA 3FEEA 1TKFA 2JEWA 4ZX8A 4B6ZA 4Q7AA 4EMEA 3B3VA 1TF8A 1OBRA 4NGQA 3GB0A 3ISZA 3SI2A 1ZG7A 1RTQA 3NH5A 2Q4ZA 3IWWA 4UF4A 2BO9A 1XJOA 4MCRA 2ZENA 1Z5RA 4MHPA 5DS0A 1BAVA 4FUUA 2RFHA 4TWEA 4AXVA 3IJ3A 3CPAA 2C6CA 3SJGA 2ABZA 3WC5A 1YMEA 1HDQA 4NGPA 5ELYA 4P4EA 4EFDA 1CPXA 2ZOGA 4IAVA 4JZ0A 3FX6A 5F09A 2JBJA 3VATA 3LWUA 1AYEA 4UEZA 2HB6A 3B3WA 1UWYA 1IGBA 4P4BA 3KI9A 1ZLIA 5K8OA 3FEDA 3S9LA 1VHOA 8CPAA 1TF9A 1LAMA 3H8EA 4YU9A 4OC3A 2ZEDA 3D7HA 4UIBA 2PJ0A 1XFOA 1Y0RA 4PXDA 5LRJA 3CDXA 4W9YA 2IJZA 3PB8X 4FBEA 4P10A 4NGRA 2I3CA 1Y7EA 4ZX9A 3V38A 2PJ4A 2Q43A 2V8DA 5JGFA 3FECA 4ONWA 3D67A 5LYDA 4P44A 4P4JA 3NH8A 3BI0A 2V8GA 5JM6A 4A94A 3KHZA 2ZEFA 4YWYA 3HLPA 4MXUA 3KQZA 3RAMA 4OC2A 1TKJA 2PJ8A 2ZEPA 5LYFA 1BLLE 1LAPA 5LRKA 5D29A 4ZI6A 4PPZA 4P4FA 3V7ZA 1ZG8A 3H8GA 1F2PA 2WYRA 4ZY0A 3FVLA 3NH4A 3PEIA 5CBMA 3RBUA 2PVVA 1R43A 3PBBA 4MHNA 4K3NA 3TX8A 3QNVA 3PFEA 3KGQA 3L2NA 4MCPA 4PXBA 5HVGA 3GUXA 5HXDA 7CPAA 4OIWA 2GREA 2PJ6A 5K8PA 3KHXA 1M4LA 3K9TA 3NA6A 3PBEA 2NSMA 5CPAA 3FF3A 2QJ8A 1IY7A 1VIXA 4EWTA 4Z65A 5LYLA 3N5FA 1F57A 1CP6A 3DLJA 2PIZA 2DEAA 1PYTB 3SJEA 4MMOA 2RB7A 2C6GA 3SJXA 1HEEA 1CX8A 5K8MA 2BOAA 2EK9A 4PQAA 2VL1A 1ARMA 1Q7LA 4ZYQA 2C6PA 1YLOA 4MCSA 3VARA 2Q51A 2XEIA 3PB6X 2WZNA 1QMUA 5HVFA 4F9VA 1NSAA 1FNOA 4H2KA 2XEGA 1AMPA 4IK2A 4JYWA 4ZY2A 1VGYA 3PB9X 4X3RA 2CTBA 2PE3A 1H8LA 3B35A 3D66A 4NJRA 4MCQA 5LYIA 3WC7A 1XRYA 2PJBA 3D4UA 3T8WA 4TNUA 1CBXA 3HUVA 1XBUA 1LOKA 4OIDA 4NGNA 2PIYA 1BPMA 2AFMA 2NYQA 2AFXA 4KSIA 1TXRA 1LCPA 3FMCA 1XMBA 3KZWA 3D7FA 3KL9A 4P4DA 4UEEA 2PCUA 1R3NA 1LANA 1TKHA 2XEFA 2PJ9A 1BPNA 3MRUA 4DUKA 3D7GA 4CPAA 4WJBA 4NFRA 3JRUA 1GYTA 4OC0A 4IHMA 4LQGA 1F2OA 2ZEEA 1DE4C 4FAIA 2HC9A 3IO1A 2AFOA 2BCOA 4OC4A 2QVPA 1Y0YA 2IMOA 4P6YA 2C1CA 2GLFA 2ZOFA 4A38A 3PRTA 4MHZA 4WWVA 1HDUA 4X8IA 2PJ1A 2PJ3A 2PJCA 2F7VA 3IFEA 3KR5A 2OOTA 3VH9A 4NGTA 3KR4A 1YW4A 3K2KA 3D68A 4NGSA 2AFWA 3D7DA 5JH9A 2PJ7A 1DTDA 3SJFA 2PRQA 2PJAA 2AFSA 4UEFA 4G1PA 2ZEGA 1ZLHA 2POKA 2AFZA 4R76A 3I1UA 2PVWA 3WT4A 3SI1A 2OR4A 2QYVA 4OC1A 3TC8A 4FWUA 3WABA 4P45A 3CPXA 1KWMA 4MHYA 3FJUA 2GU2A 1CPSA 4OC5A 2O4HA 1Z2LA 3GLJA 1FT7A 2J9AA 3SI0A 2G9DA 2ZEOA 3S9NA 2V8HA 4GM5A 6CPAA 2CIJA 3B2YA 4R6TA 4O23A 2IQ6A 3B3TA 1ZG9A 2JBKA 4NGMA 4DYOA 2ZELA 3IC1A 1CG2A 2CTCA 2ZEHA 4OP4A 2ZEMA 3PB4X 5J1QA 2GLJA 1Z8LA 2V77A
chains in the Genus database with same CATH superfamily
2R92I 3FRMA 3ISXA 1K9M2 1VKCA 3BXMA 3GTJI 1YSJA 5CNPA 3BI1A 2AFUA 1Z4EA 1YHQ1 1K83I 4A30A 1N2FA 2KI7B 3C26A 1VLAA 3M3YI 3NDIA 2B63I 4UCPA 1TWHI 3FIXA 1YITZ 3HOWI 2OZGA 5D1OA 2R93I 4R7MA 4J3GA 4PSXA 1BO4A 1P4NA 1QQ9A 1J4JA 3PB7X 3RZAA 3B3SA 4OLLA 3TE5B 2ANPA 2OH1A 5I4MA 2EWBA 2QEX1 4M85A 3F3PC 1Z8XA 5EBVA 3B3CA 4R57A 3N7ZA 5D8NA 5HVHA 1AUGA 3FEEA 3J80b 2Z3PA 3GTGI 3TT2A 5C3EI 5AGEA 3KKWA 4AG7A 3CCVZ 3SI2A 2GTHA 1ZG7A 1Q861 4E30A 1PFTA 3DR8A 3CC41 3FBUA 5DS0A 1VQM1 1M1K2 3LUSA 3CPAA 2HUZA 3D2PA 4CAFA 2V8KA 2ABZA 3FB3A 2FCKA 1YMEA 3E0KA 5F49A 2NVQI 4P4EA 5ELYA 1Y9WA 5AG6A 4RN7A 5FVJA 2EBJA 1KUXA 2JBJA 4PK2A 4UFWA 2HB6A 3B3WA 1UWYA 1IGBA 2JDDA 3KI9A 1ZLIA 2Z0ZA 5K8OA 1NJI2 3FEDA 3KIHA 1VHOA 2DE7A 1Y0RA 4PXDA 1NE9A 3P2HA 2CXAA 4Y52I 3PB8X 2WPWA 4FBEA 3D3SA 4P10A 1Z01A 2EO8A 1Y7EA 2JA7I 3CCQ1 2OOXB 2PJ4A 4ZBGA 3SHPA 4QUSA 2VZZA 1XEBA 4NBGA 2E9HA 4P44A 1Y8CA 3NH8A 3RZOI 2V8GA 5KTAA 2JIPA 4A94A 4CGNA 3KHZA 4Q36A 2VI7A 2YNDA 4MI4A 3S14I 4MXUA 2QMLA 3RAMA 4OC2A 2QECA 3G71Z 2PJ8A 2ZEPA 4HNXB 1YJ91 1WK4A 3FKII 4KOTA 4ZI6A 4CAWA 4PPZA 4NBEA 3V7ZA 1F2PA 4ZY0A 3FXTA 3I9SA 3S1QI 2PVVA 3QNVA 3CCLZ 4NF1A 2R1IA 3S16I 2B5GB 3GTLI 7CPAA 2KPIA 3BLNA 5IP9I 2O28A 3S2HI 2JDCA 4HKFA 1YUAA 3TDHB 4DNCA 2ZPAA 3PO3I 4MFPA 3PBEA 1VQNZ 5CPAA 1MK4A 1VQ9Z 3I55Z 4E2AA 4EWTA 4Z65A 4S1TA 4RV9A 1K732 1VQ6Z 2ZW7A 2RB7A 2C6GA 4GXHA 1VQ7Z 5F47A 3H3VJ 1XOVA 2B58A 2Y0SA 1YHQZ 4HGZA 2JR6A 2ODFA 3EXNA 4MJ8A 3NE8A 3ZZIA 4MD7A 2Z10A 1YJNZ 2LEXA 2Q51A 2XEIA 3PB6X 1NSAA 2YGWA 4QTUA 2G0BA 4IUSA 2XEGA 1AMPA 2JIRA 4ZY2A 3PB9X 3I56Z 3PZJA 1N8R2 2JA8I 5IT9f 4R9MA 1YGHA 1DL6A 1JWHC 1TWAI 4KUAA 2Z11A 1QF8A 3CZXA 1QVGY 2DF5A 5J8CA 2Y0MA 1A2ZA 1Q7Y1 4AYBA 4H6ZA 1YI2Z 2NYQA 2AFXA 1Q2DA 1TXRA 1Z8TA 4KSIA 1LCPA 4MY3A 1XMBA 3S2DI 4B10A 2PMZA 3PO2I 3I3GA 4UEEA 3QB8A 2JA6I 4CRYB 4KVME 5A2Qf 1Y7RA 4KOYA 4CPAA 3QAYA 4NFRA 4BBHA 3JRUA 4A3EI 4IHMA 2FS5A 5CM2M 3MZKB 4ZGYB 1K8A2 1RO4A 1WCMI 4CAEA 2HC9A 3CCSZ 3EFAA 3IO1A 2QVPA 1YIT1 1Y0YA 2IMOA 3TOBA 2ZOFA 3IWEA 4A3LI 4XNHB 4DQYB 2PJ1A 4NH1C 2Z3NA 3GTOI 4KLWA 1S60A 3KR5A 2OOTA 3F0AA 1YW4A 3K2KA 3D68A 2AFWA 4RVFA 4X6AI 2OZUA 4ORFA 1Z9UA 2JEVA 2JIMA 1DTDA 2PJAA 2ZEGA 3GCFA 4XX2A 5EMIA 2AFZA 2PVWA 3BG1B 2OR4A 3TC8A 2ZW4A 4R3LA 1OZPA 4CGPA 1Z2LA 5J8FA 2E2JI 1P9NA 3S9NA 2W03A 3B2YA 1XE4A 3B3TA 1ZG9A 1VQO1 4DYOA 5FLXf 2ZEHA 1QSNA 5T64A 4DK1A 3W91A 4YRHA 2ZEMA 3PB4X 5J1QA 2CNTA 4L89A 2F4MA 2PJ2A 4QVTA 5K8NA 2JS4A 2FVGA 4A3CI 3S6FA 3TO7A 1YJ9Z 3RYOA 3JUWA 4A39A 4OMEA 3GKQA 3DGVA 3CQZI 5G21A 3HOVI 1PCAA 3R95A 4NJQA 2R6MA 5THWA 3KQXA 1X10A 4F0XA 4F9UA 4NBFA 2NAPA 1KUYA 4X2TA 2BSWA 4JD6A 1S72Z 1ARLA 2C27A 4B14A 1U6MA 2PJ5A 4KOSA 4NOZA 4F0YA 4OKOA 1M1DA 1ELLP 2R8VA 2QREB 4EWCA 1CP7A 3DSBA 1M902 3HOXI 2B3UA 2XEJA 2GTIA 1Q812 3G3SA 3D6WA 3CXCY 4Q7AA 2VUGA 4EMEA 5D1OB 3G4SZ 1Q2CA 5F46A 1JJ2Y 1ON0A 4NGQA 2AKLA 1UFHA 3S15I 2W04A 4NBAA 3EC4A 2JNYA 2F5IA 3IWWA 2BO9A 5AN9F 3CXQA 4BINA 4AB7A 3GTKI 4PV6A 3CCL1 2OOYB 4C2YA 1I21A 3SJGA 2Z3KA 1QVGZ 1X3ZA 1PUAA 3NDJA 1CPXA 4IAVA 2I00A 3EERA 1VQN1 5F09A 1VQ91 3I551 3LWUA 1AYEA 4UEZA 4FD5A 2ZW5A 1VQ61 3R1KA 2GFQA 4AVBA 1YQEA 4UBRA 3S9LA 5D1PA 1VQ71 4OC3A 2ZEDA 2I79A 2VXKA 4BY7I 3DR6A 1YJN1 1QSMA 4DGLA 1RXTA 2RIQA 4A95A 4NEXA 3V38A 4FD6A 3FECA 4ONWA 3D67A 3I561 4P4JA 4MBUA 1Q821 3JAMb 2WSAA 2QA4Z 4C68A 4E2XA 4JJXA 1CM0A 2P3YA 4BBSI 2RT9A 1LAPA 1IYKA 2Q0YA 5LRKA 4A3BI 1YI21 1L0CA 1QYPA 2EUIA 3FVLA 4GS4A 3PEIA 2Q4VA 1K9M1 3RBUA 2PR8A 4K3NA 3MZLB 3KGQA 3VWDA 4NBBA 4MCPA 4KLVA 4PXBA 3S1MI 5HXDA 3GUXA 4OIWA 1BOBA 4YFJA 4A33A 4RVHA 5A28A 5K8PA 3KHXA 2A4NA 4Q38A 4A3KI 1ML8A 1VQOZ 3JTKA 4LQ6A 3CCS1 2H5MA 1F57A 1CP6A 4MFJA 4UWJA 5KTCA 3P2FA 3SXOA 5H86A 1HEEA 4R3KA 3GTMI 5K8MA 4CL1A 1TFIA 3H5ZA 1ARMA 1Q7LA 4ZYQA 1W2BZ 2C6PA 3F3FC 1USPA 2Z3MA 5G1ZA 2VQYA 1QMUA 3RZDI 1I3QI 4IK2A 4JYWA 4E31A 2CTBA 3B35A 3EO4A 3WC7A 4UFVA 4M3SA 4XPDC 1I1DA 1XRYA 1Y1VI 2PJBA 4MHDA 1Z02A 3T8WA 3DNSA 1CBXA 1LOKA 1VQ4Z 2PIYA 1BPMA 1YLEA 2PRBA 3CXCZ 2WUUA 3LD2A 3KZWA 2DE6A 1JJ2Z 3D2LA 3D7FA 4JXRA 1LANA 4Y49B 2PJ9A 1BPNA 1QVFZ 1RO2A 3HOZI 3ESWA 2Z3LA 1KC82 1GYTA 4F6AA 4JWPA 1NJI1 4XPLA 3I4MI 1F2OA 4AVAA 3HKZA 1V0CA 2Q04A 1NSLA 4M6GA 4FAIA 4OC4A 4MY0A 2F4OA 1S721 1K4JA 4A38A 3CC7Z 4WWVA 3EEDA 1WZNA 4U9YA 2RPRA 3G6EZ 3F8KA 3VH9A 4NGTA 1Q16A 4PK3A 3OWCA 2R98A 2OTJZ 3CCUZ 2NVXI 3SXNA 2WB1A 4NBDA 4KUBA 3VMIA 2REFA 5FLMI 2K5RA 1IOFA 2CNSA 2D4PA 2AFSA 4G1PA 4H89A 1ZLHA 3GIUA 5AG4A 4R76A 4UA3A 3SI1A 3G4S1 2J8NA 3WABA 1B6BA 3GTQI 5I0CA 4MHYA 3VB9A 1CPSA 4OC5A 3GLJA 4UCMA 1FT7A 2G9DA 5AG7A 4B5PA 1Z8WA 5IV0A 2GANA 4O23A 3BJ7A 2J8MA 1CG2A 1TWGI 1R9TI 2J8RA 3CCRZ 4OADA 3R9FA 1NP6A 2GLJA 3K7AI 4II9A 3CME1 1YW6A 4A37A 4CGLA 4KSFA 1ELMP 1L1OC 3NFZA 1VHEA 3I07A 1KRLA 1K731 1M44A 2YNCC 2DXQA 2RC4A 3T9YA 3CT9A 1WIIA 2AJ6A 5C82A 1EE3P 2JUBA 3IF8A 3J81b 1KQSY 4P4IA 4ZY1A 2IZ3A 5A27A 2EK8A 4MRIA 4Y7NI 4UCNA 4YGOA 5LRGA 4UIAA 3FH4A 3H8FA 2V8VA 3PFOA 2NMTA 4RUHA 3S6GA 3T4NB 2QA41 4KORA 4ZX8A 4B6ZA 2PDOA 3B3VA 3CD6Z 1TF8A 3GB0A 1YUKA 2JA5I 4KOXA 1X12A 3ISZA 5IB0A 1S7KA 4KVXA 3FYNA 3GY9A 3NH5A 2Q4ZA 2V3VA 4BXXI 1ZB8A 2AYDA 1IIDA 1XJOA 5IT9b 1YJWZ 1M4IA 1Z5RA 3CMAZ 1BAVA 4U5YA 4FUUA 4TWEA 4AXVA 4A32A 3IJ3A 5T6BA 1I6HI 3CCJZ 4KOVA 2R7HA 3WC5A 2K3RA 4NXYA 5G22A 4C2XA 1HDQA 3IFUA 4A3II 2JIOA 2ZOGA 1VQK1 2V8IA 4NB9A 1RLYA 2YU9I 4RVDA 2FSRA 3CXSA 2PC1A 4RVGA 4P4BA 5A2Qb 2VPXA 2R7ZI 1YR0A 1SIWA 8CPAA 4UIBA 2PJ0A 1S7NA 3CPWY 5LRJA 1VQPZ 3RNZA 2QRDB 4W9YA 1RQFA 2NVTI 1W2BY 3EY5A 1YREA 4NGRA 2H85A 4KVOE 3I4NI 2I3CA 5DWNA 2EGTA 2V8DA 4CGMA 4HGYA 2YNEA 3VMGA 4M6IA 5LYDA 3QWUA 4JXQA 4XPDB 3UY5A 1X3WA 4YWYA 1KD12 4HNYB 1ZH1A 4A3FI 3HLPA 1Y9KA 5HH1A 1TKJA 5LYFA 1BLLE 1VQ41 5D29A 3NE7A 4P4FA 3MGDA 1ZG8A 3H8GA 2WYRA 4KOWA 3CCMZ 3PBBA 5G20A 4MHNA 2BUEA 1M4GA 1QVFY 5FLXb 2D4OA 1M4LA 3MONA 3K9TA 3NA6A 2NSMA 3FF3A 2FIAA 2REEA 3N5FA 4H6UA 4E33A 3DLJA 1IOIA 2PIZA 3GKRA 2DEAA 1CJWA 3IGRA 3CMEZ 3CC71 4B5OA 2OB0A 2BOAA 2IV2X 1S7MA 3G6E1 1MJAA 4NSQA 3P5JB 2P6GA 2VL1A 2FE7A 1M901 3J80f 2OTJ1 4MCSA 1AA6A 3VARA 3CCU1 3LACA 3PO3S 2WZNA 5AG5A 2V45A 4NB8A 1KQSZ 4H2KA 1WW9A 2QIRA 3QAHA 4X3RA 2PE3A 1H8LA 3D66A 2RHBA 5JQ4A 4NJRA 4MCQA 5LYIA 3D8PA 3D4UA 2HF1A 2Q4YA 1NMTA 4TNUA 5T67A 3BJ8A 4OIDA 2OZHA 1USPB 2IZ4A 3PGPA 5JPHA 2VPZA 1B87A 3CXPA 3FMCA 1Q862 3CCR1 3KL9A 4P4DA 1R3NA 2VEZA 4DUKA 1XIXA 5BWAB 2B4DA 4XNHC 5C4XI 4LQGA 1YX0A 2IL4A 4CAVA 3B8GA 1M4DA 2BCOA 4NBHA 5ISVA 4M6HA 5IP7I 2GLFA 5LL6f 3PRTA 4MHZA 1RNIA 1WJ2A 1VQKZ 2FL4A 3TE4A 2PJCA 3IFEA 3H0GI 3KR4A 2G2KA 4NGSA 3PP9A 3D7DA 4U9ZA 4IF5A 2DPTA 1ZB9A 3SJFA 2PRQA 1Z03A 1IB1E 4LX9A 3DDDA 3CPWZ 4LUAA 3WT4A 4E2ZA 4L8AA 2QYVA 4FWUA 3CD61 1TWFI 1KWMA 3CPXA 2P0WA 4B11A 5C44I 1IYLA 1WWZA 4ONUA 4A3JI 2ZEOA 2Q44A 2V8HA 4OAEA 3LODA 4AG9A 2CIJA 6CPAA 3RO0A 4R6TA 1YJW1 2IQ6A 2JBKA 2ATRA 2ZELA 4PSWA 2NVYI 2CTCA 4QC6A 3CMA1 2RBLA 4AVCA 4MFKA 4MFZA 2DE5A 1Z8LA 3CCJ1 2VPYA 2YNCA 3B7IA 3OW2Z 2O53A 3Q87A 1M1K1 3WC6A 2P28A 1QSOA 4RS2A 4A93I 3CC2Z 4PXEA 2B4BA 2J6AA 2CF4A 1I50I 1N71A 2Z3OA 4R8FA 5IB9A 3CCE1 4DJLA 1MJ9A 4B5PB 3FNCA 4CS0B 4E32A 2F8HA 4PXCA 1JQGA 3IWGA 1VQ51 3MN8A 4MD9A 2B3VA 3TO6A 1VQP1 1XF8A 3BHXA 4BD9A 3LMSA 4BY1I 4K30A 2X7BA 3IIBA 3KASA 3TO9A 1IU8A 4EVYA 1YIJZ 4CYNA 2JMOA 1VQ8Z 1LFWA 3S9MA 4F8ZA 2ZW6A 3IU2A 4RI1A 1Z4RA 1KZFA 1VQLZ 1JWQA 2EVNA 3IEHA 2OU2A 5E96A 1TKFA 2JEWA 3FQMA 1LRZA 1OBRA 1IICA 3R96A 1R57A 1QSTA 5C4JI 1RTQA 1I12A 3J81f 1SFOI 4UF4A 3S6HA 4MCRA 3CCM1 1QXFA 2ZENA 1TWCI 4R87A 4MHPA 2P6FA 2RFHA 1Q7Y2 3R9EA 2OTLZ 2C6CA 2K5TA 1S5KA 1KC81 1MJBA 4NGPA 4EFDA 4JZ0A 1QSRA 3TFYA 3FQQA 3FX6A 2V8JA 3V8IA 1PU9A 5H84A 1GHEA 2E7ZA 3VATA 4E0AA 5F48A 4B12A 4QBJA 3ZJ0A 4FD4A 1S3ZA 4MONA 4BBRI 1TF9A 2ZAEB 1LAMA 3H8EA 4YU9A 3D7HA 3IR7A 1XFOA 3HOUI 3K9UA 3CDXA 3W6SA 2Q7BA 2VBQA 2PK7A 4JLYA 2IJZA 1S7FA 2QEXZ 2QR1B 3T90A 4C7IA 2M6NA 1RO5A 4MFQA 3VWEA 4ZX9A 5EC4A 3WR7A 2Q43A 3IX0A 5JGFA 3VTNA 4MD8A 2B5GA 2FT0A 3BI0A 5JM6A 4XPKA 2ZEFA 2AE6A 4QB9A 3KQZA 4B13A 5HMNA 3TCVA 1N8R1 4CRZB 3A9LA 3GYAA 4NCZA 3IU1A 2HV2A 4MFLA 3NH4A 5CBMA 3CC4Z 4UFXA 1R43A 2WAQA 1VQMZ 1SQHA 2CY2A 5KTDA 3TX8A 3PFEA 3L2NA 5HVGA 2E2II 2QLVB 2GREA 2VPWA 2PJ6A 2BL1A 4HH4A 3GTPI 4X5KA 2QKDA 2E2HI 4CYOA 2QJ8A 1IY7A 1VIXA 5LYLA 3S17I 2JLMA 1FDIA 1S7LA 1Y1WI 4HNWB 4FD7A 4E2WA 1PYTB 3SJEA 4MMOA 2GIVA 1K8A1 3SJXA 2DPSA 2VF1A 4A31A 1CX8A 4KSAA 4A2ZA 3F5BA 1ZO0A 2EK9A 2GE3A 4C7HA 2PM9A 4PQAA 3TOAA 4UWIA 2PR1A 3D9XA 3CCEZ 1YLOA 3CCV1 4QTTA 2P6EA 3S6KA 5HVFA 4F9VA 2G3TA 3CCQZ 1FNOA 4C2ZA 1VQ5Z 2LFUA 1VGYA 1NUIA 4CYPA 2VUMI 2LIYA 2BJOA 1TIQA 3GTMS 1X0TA 1Q2YA 4Y49C 3HUVA 4A3GI 1XBUA 2OZKA 2FIWA 4KOUA 4NBCA 3TTHA 3BG0B 4NGNA 2JIQA 2G3AA 2Q7SA 3JVNA 1KUVA 2AFMA 4CAXA 2HQYA 1XMTA 3D2MA 3J7A4 2ZXVA 2VZYA 2PCUA 1TKHA 2PSWA 4A3DI 2XEFA 3MRUA 3OW2Y 3D7GA 2CNMA 4WJBA 3CC21 2FXFA 2BEIA 1FY7A 1Y1VS 5GCNA 4OC0A 3S1RI 3M4OI 5C88A 4RS4A 1RO0A 1YVKA 4CYQA 2ZEEA 1YVOA 1DE4C 3U50C 2AFOA 2ARHA 4MH4A 4P6YA 2C1CA 1VHSA 1HDUA 4CGOA 4X8IA 2PJ3A 3W6XA 2F7VA 4HPSA 1YIJ1 2HU9A 1VQ81 1LQLA 3JAMf 3R9GA 3G711 1P0HA 2B4DB 2KCWA 5JH9A 2PJ7A 4E8OA 4UEFA 1VQL1 4A3MI 3G8WA 3HOYI 1KD11 2M48A 2POKA 5DWMA 3I1UA 4I49A 2WPXA 4KZTA 1FDOA 4OC1A 4P45A 2PQ8A 1Q811 3FJUA 1Q822 2GU2A 2O4HA 2J9AA 3SI0A 4BMHA 3KIFA 5IX3A 4GM5A 1YK3A 4NGMA 3H4QA 3IC1A 3S1NI 2YADA 4E2YA 4OP4A 2QRCB 4KS9A 2OTL1 2V77A 3VMHA
chains in the Genus database with same CATH topology
2F4MA 2R92I 2PJ2A 3K7AI 3B7IA 3CME1 1YW6A 3ISXA 4A37A 1K9M2 5K8NA 3OW2Z 2JS4A 2FVGA 2O53A 4A3CI 1ELMP 3BXMA 1L1OC 3NFZA 3GTJI 1VHEA 3Q87A 1YJ9Z 1M1K1 1YSJA 2P28A 3WC6A 4A39A 3BI1A 2AFUA 4OMEA 1YHQ1 4A93I 3I07A 3CC2Z 1K83I 1KRLA 3GKQA 3DGVA 1K731 4PXEA 3CQZI 2J6AA 2CF4A 1I50I 1N2FA 4R8FA 5IB9A 3HOVI 3CCE1 4DJLA 2KI7B 3CT9A 1VLAA 1WIIA 1PCAA 3M3YI 3NDIA 2B63I 4NJQA 1TWHI 2R6MA 4E32A 1EE3P 5THWA 2JUBA 3IF8A 1YITZ 2F8HA 3KQXA 4F9UA 3HOWI 4NBFA 3J81b 4PXCA 1JQGA 4X2TA 5D1OA 2R93I 4R7MA 1KQSY 1S72Z 1VQ51 1ARLA 3MN8A 4P4IA 4MD9A 1QQ9A 4ZY1A 2PJ5A 2IZ3A 3PB7X 1VQP1 3BHXA 3RZAA 4BD9A 3LMSA 4BY1I 4NOZA 3B3SA 4OKOA 3IIBA 3KASA 3TE5B 2EK8A 4MRIA 4Y7NI 1ELLP 1YIJZ 2ANPA 2QREB 5I4MA 2EWBA 2QEX1 4EWCA 2JMOA 1VQ8Z 1CP7A 1LFWA 3S9MA 3F3PC 5LRGA 4UIAA 4F8ZA 3FH4A 3H8FA 2V8VA 3B3CA 3PFOA 1M902 3HOXI 2XEJA 2GTIA 1Q812 4RUHA 1VQLZ 5D8NA 3IEHA 5HVHA 3FEEA 1TKFA 2JEWA 3D6WA 3T4NB 2QA41 4ZX8A 3J80b 4B6ZA 3CXCY 4Q7AA 3GTGI 2VUGA 4EMEA 5D1OB 3G4SZ 5C3EI 3FQMA 1JJ2Y 3B3VA 3CD6Z 1TF8A 1OBRA 4NGQA 3GB0A 1YUKA 2JA5I 2AKLA 3S15I 3CCVZ 3ISZA 2W04A 2GTHA 5C4JI 3SI2A 1ZG7A 4NBAA 1Q861 2JNYA 1RTQA 4E30A 1PFTA 3NH5A 3J81f 2Q4ZA 1SFOI 3IWWA 4BXXI 1ZB8A 4UF4A 2BO9A 1XJOA 4MCRA 5IT9b 5AN9F 3CCM1 1YJWZ 2ZENA 1TWCI 3CC41 1Z5RA 4MHPA 5DS0A 3CMAZ 1BAVA 1VQM1 1M1K2 4FUUA 2RFHA 4TWEA 3LUSA 4AXVA 3IJ3A 1Q7Y2 3CPAA 5T6BA 3GTKI 2OTLZ 3CCL1 2C6CA 1I6HI 3CCJZ 2OOYB 1KC81 3SJGA 2V8KA 2ABZA 3WC5A 2K3RA 1X3ZA 1QVGZ 3NDJA 1YMEA 1HDQA 4NGPA 3IFUA 2NVQI 4P4EA 5ELYA 4A3II 1CPXA 4EFDA 2ZOGA 4IAVA 1VQK1 4JZ0A 2V8IA 3FQQA 4NB9A 3FX6A 2V8JA 1RLYA 3EERA 2YU9I 1VQN1 5F09A 1VQ91 2JBJA 4RVDA 3I551 3VATA 3LWUA 1AYEA 4UEZA 2HB6A 3B3WA 1UWYA 1IGBA 4RVGA 4P4BA 5A2Qb 3KI9A 1VQ61 1ZLIA 5K8OA 1NJI2 3FEDA 2R7ZI 4MONA 3S9LA 3KIHA 4BBRI 1VHOA 8CPAA 1TF9A 2ZAEB 5D1PA 1LAMA 1VQ71 3H8EA 4OC3A 4YU9A 2ZEDA 3D7HA 4UIBA 2PJ0A 1XFOA 3HOUI 2DE7A 3CPWY 1Y0RA 4PXDA 5LRJA 1VQPZ 3CDXA 2QRDB 4W9YA 4BY7I 2PK7A 2IJZA 4Y52I 3PB8X 1RQFA 2QEXZ 2NVTI 1W2BY 2QR1B 4FBEA 1YJN1 4P10A 4NGRA 2H85A 4DGLA 3I4NI 2I3CA 1Z01A 2M6NA 2RIQA 1Y7EA 2JA7I 3CCQ1 2EGTA 2OOXB 4ZX9A 3V38A 2PJ4A 2Q43A 2V8DA 4DYOA 3IX0A 4HGYA 5JGFA 3VTNA 3FECA 4ONWA 3D67A 4NBGA 2E9HA 3VMGA 3I561 4MD8A 5LYDA 3QWUA 4P44A 3RZOI 3NH8A 4P4JA 3BI0A 1Q821 3JAMb 2QA4Z 2V8GA 5JM6A 4A94A 3KHZA 4E2XA 1X3WA 2ZEFA 4YWYA 1KD12 1ZH1A 4A3FI 3S14I 3HLPA 4MXUA 3KQZA 3RAMA 4OC2A 3G71Z 1TKJA 2PJ8A 2ZEPA 5LYFA 2P3YA 1BLLE 1YJ91 1N8R1 4BBSI 2RT9A 1VQ41 1LAPA 3FKII 5LRKA 4A3BI 5D29A 4ZI6A 4PPZA 4P4FA 4NBEA 1YI21 3V7ZA 1ZG8A 1QYPA 3H8GA 1F2PA 2WYRA 4ZY0A 3CCMZ 3FVLA 3NH4A 3PEIA 5CBMA 3CC4Z 1K9M1 3S1QI 3RBUA 2PVVA 1R43A 3PBBA 2WAQA 1VQMZ 4MHNA 4K3NA 3TX8A 3QNVA 3MZLB 3KGQA 3PFEA 4NBBA 3L2NA 3CCLZ 4MCPA 4PXBA 3S1MI 3S16I 5HVGA 3GUXA 3GTLI 5HXDA 7CPAA 2E2II 2KPIA 1QVFY 5IP9I 4OIWA 2QLVB 3S2HI 2GREA 2PJ6A 1YUAA 4RVHA 3TDHB 5FLXb 5K8PA 4HH4A 3KHXA 1M4LA 3MONA 3GTPI 3PO3I 3K9TA 2QKDA 3NA6A 2E2HI 3PBEA 4A3KI 1ML8A 1VQOZ 2NSMA 1VQNZ 5CPAA 3FF3A 2QJ8A 1VQ9Z 1IY7A 3I55Z 1VIXA 4EWTA 3CCS1 4Z65A 5LYLA 3N5FA 4S1TA 3S17I 1F57A 1CP6A 4RV9A 4E33A 1K732 3DLJA 1VQ6Z 2PIZA 1Y1WI 2DEAA 4E2WA 1PYTB 3SJEA 3CMEZ 4MMOA 2RB7A 2C6GA 1K8A1 1HEEA 3SJXA 2VF1A 1VQ7Z 1CX8A 3GTMI 3CC71 5K8MA 3H3VJ 2BOAA 2EK9A 1S7MA 3G6E1 2PM9A 4PQAA 2Y0SA 1YHQZ 4CL1A 4HGZA 3P5JB 1TFIA 2JR6A 2VL1A 1M901 3D9XA 3J80f 1ARMA 1Q7LA 4ZYQA 1W2BZ 3CCEZ 4MD7A 1YLOA 3CCV1 3F3FC 2C6PA 2OTJ1 1USPA 1YJNZ 4MCSA 3VARA 3CCU1 2Q51A 2XEIA 4QTTA 3PB6X 3PO3S 2WZNA 1QMUA 5HVFA 4F9VA 1NSAA 3RZDI 4QTUA 3CCQZ 4NB8A 1KQSZ 1I3QI 1FNOA 4H2KA 1WW9A 2XEGA 1AMPA 4IK2A 4JYWA 1VQ5Z 2LFUA 4E31A 1VGYA 3PB9X 1NUIA 4ZY2A 4X3RA 3I56Z 2CTBA 2VUMI 2PE3A 1N8R2 1H8LA 2JA8I 3B35A 3D66A 2LIYA 5IT9f 2BJOA 2RHBA 4NJRA 4MCQA 5LYIA 3WC7A 1XRYA 1Y1VI 1DL6A 1JWHC 3GTMS 2PJBA 3D4UA 2HF1A 1TWAI 1X0TA 1Z02A 3T8WA 1QF8A 4TNUA 1QVGY 5T67A 1CBXA 4A3GI 1XBUA 1LOKA 3HUVA 2OZKA 1VQ4Z 4OIDA 4NBCA 1Q7Y1 3BG0B 4NGNA 2PIYA 1BPMA 4AYBA 1USPB 1YI2Z 2IZ4A 2AFMA 2NYQA 2AFXA 4KSIA 1TXRA 1LCPA 3CXCZ 3FMCA 1Q862 3CCR1 1XMBA 3S2DI 3J7A4 3KZWA 2PMZA 3PO2I 2DE6A 1JJ2Z 3D7FA 3KL9A 4P4DA 4UEEA 2PCUA 1R3NA 1LANA 1TKHA 4A3DI 2XEFA 2JA6I 2PJ9A 1BPNA 3MRUA 4DUKA 5A2Qf 3OW2Y 1QVFZ 3D7GA 1RO2A 3HOZI 3ESWA 4CPAA 4WJBA 4NFRA 3CC21 1Y1VS 1KC82 4A3EI 1GYTA 3JRUA 4OC0A 5C4XI 3S1RI 3M4OI 4IHMA 5CM2M 4LQGA 3MZKB 1NJI1 1K8A2 3I4MI 1F2OA 3HKZA 4RS4A 1RO0A 1RO4A 2ZEEA 1DE4C 1WCMI 4FAIA 2HC9A 3CCSZ 3U50C 3IO1A 2AFOA 4NBHA 2BCOA 4OC4A 2QVPA 2F4OA 1YIT1 1Y0YA 2IMOA 4MH4A 4P6YA 2C1CA 1S721 5IP7I 2GLFA 2ZOFA 5LL6f 4A38A 4A3LI 3PRTA 3CC7Z 4MHZA 1RNIA 4WWVA 3EEDA 1HDUA 4X8IA 4DQYB 2RPRA 1VQKZ 3G6EZ 2PJ1A 2PJ3A 2PJCA 4NH1C 2F7VA 1YIJ1 3GTOI 3IFEA 2HU9A 3KR5A 2OOTA 3VH9A 3H0GI 1VQ81 4NGTA 1LQLA 3JAMf 3KR4A 1YW4A 3K2KA 2G2KA 3D68A 3G711 4NGSA 2OTJZ 2AFWA 3D7DA 4RVFA 3CCUZ 4X6AI 5JH9A 2PJ7A 2NVXI 2WB1A 1ZB9A 4NBDA 3VMIA 1DTDA 3SJFA 2PRQA 5FLMI 2K5RA 2PJAA 2AFSA 4UEFA 1Z03A 1VQL1 4A3MI 4G1PA 3HOYI 1KD11 3GCFA 2ZEGA 3CPWZ 2M48A 1ZLHA 4XX2A 2POKA 2AFZA 4R76A 3I1UA 2PVWA 3WT4A 4E2ZA 3BG1B 3SI1A 2OR4A 3G4S1 2QYVA 4OC1A 3TC8A 4FWUA 3WABA 3CD61 4P45A 3GTQI 1TWFI 1KWMA 3CPXA 1Q811 4MHYA 3FJUA 3VB9A 5C44I 1Q822 2GU2A 1CPSA 4OC5A 2O4HA 1Z2LA 3GLJA 1FT7A 2J9AA 3SI0A 2E2JI 4A3JI 2G9DA 1P9NA 3KIFA 2ZEOA 3S9NA 2V8HA 4GM5A 2W03A 6CPAA 2CIJA 3B2YA 4R6TA 1YJW1 2IQ6A 2JBKA 1ZG9A 1VQO1 3B3TA 4O23A 2ZELA 4NGMA 2NVYI 5FLXf 3S1NI 1CG2A 2CTCA 3IC1A 1TWGI 3CMA1 1R9TI 2ZEHA 5T64A 4DK1A 2YADA 2RBLA 4E2YA 4OP4A 2QRCB 2ZEMA 3PB4X 3CCRZ 5J1QA 2DE5A 2OTL1 1NP6A 2GLJA 1Z8LA 2V77A 3CCJ1 3VMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ2 A;  3B7I A;  1YW6 A;  3ISX A;  4A37 A;  5K8N A;  2FVG A;  2O53 A;  1ELM P;  3BXM A;  3NFZ A;  1VHE A;  3WC6 A;  1YSJ A;  4A39 A;  3BI1 A;  2AFU A;  4OME A;  3DGV A;  4PXE A;  2CF4 A;  4R8F A;  5IB9 A;  4DJL A;  3CT9 A;  1PCA A;  4NJQ A;  1EE3 P;  5THW A;  2F8H A;  3KQX A;  4F9U A;  4PXC A;  1JQG A;  4X2T A;  4R7M A;  1ARL A;  3MN8 A;  4P4I A;  1QQ9 A;  4ZY1 A;  2PJ5 A;  3PB7 X;  3BHX A;  3RZA A;  4BD9 A;  3LMS A;  3B3S A;  4OKO A;  3IIB A;  3KAS A;  2EK8 A;  4MRI A;  1ELL P;  2ANP A;  5I4M A;  2EWB A;  1CP7 A;  1LFW A;  3S9M A;  5LRG A;  4UIA A;  4F8Z A;  3FH4 A;  3H8F A;  2V8V A;  3B3C A;  3PFO A;  2XEJ A;  4RUH A;  5D8N A;  3IEH A;  5HVH A;  3FEE A;  1TKF A;  2JEW A;  4ZX8 A;  4B6Z A;  4Q7A A;  4EME A;  3B3V A;  1TF8 A;  1OBR A;  4NGQ A;  3GB0 A;  3ISZ A;  3SI2 A;  1ZG7 A;  1RTQ A;  3NH5 A;  2Q4Z A;  3IWW A;  4UF4 A;  2BO9 A;  1XJO A;  4MCR A;  2ZEN A;  1Z5R A;  4MHP A;  5DS0 A;  1BAV A;  4FUU A;  2RFH A;  4TWE A;  4AXV A;  3IJ3 A;  3CPA A;  2C6C A;  3SJG A;  2ABZ A;  3WC5 A;  1YME A;  1HDQ A;  4NGP A;  5ELY A;  4P4E A;  4EFD A;  1CPX A;  2ZOG A;  4IAV A;  4JZ0 A;  3FX6 A;  5F09 A;  2JBJ A;  3VAT A;  3LWU A;  1AYE A;  4UEZ A;  2HB6 A;  3B3W A;  1UWY A;  1IGB A;  4P4B A;  3KI9 A;  1ZLI A;  5K8O A;  3FED A;  3S9L A;  1VHO A;  8CPA A;  1TF9 A;  1LAM A;  3H8E A;  4YU9 A;  4OC3 A;  2ZED A;  3D7H A;  4UIB A;  2PJ0 A;  1XFO A;  1Y0R A;  4PXD A;  5LRJ A;  3CDX A;  4W9Y A;  2IJZ A;  3PB8 X;  4FBE A;  4P10 A;  4NGR A;  2I3C A;  1Y7E A;  4ZX9 A;  3V38 A;  2PJ4 A;  2Q43 A;  2V8D A;  5JGF A;  3FEC A;  4ONW A;  3D67 A;  5LYD A;  4P44 A;  4P4J A;  3NH8 A;  3BI0 A;  2V8G A;  5JM6 A;  4A94 A;  3KHZ A;  2ZEF A;  4YWY A;  3HLP A;  4MXU A;  3KQZ A;  3RAM A;  4OC2 A;  1TKJ A;  2PJ8 A;  2ZEP A;  5LYF A;  1BLL E;  1LAP A;  5LRK A;  5D29 A;  4ZI6 A;  4PPZ A;  4P4F A;  3V7Z A;  1ZG8 A;  3H8G A;  1F2P A;  2WYR A;  4ZY0 A;  3FVL A;  3NH4 A;  3PEI A;  5CBM A;  3RBU A;  2PVV A;  1R43 A;  3PBB A;  4MHN A;  4K3N A;  3TX8 A;  3QNV A;  3PFE A;  3KGQ A;  3L2N A;  4MCP A;  4PXB A;  5HVG A;  3GUX A;  5HXD A;  7CPA A;  4OIW A;  2GRE A;  2PJ6 A;  5K8P A;  3KHX A;  1M4L A;  3K9T A;  3NA6 A;  3PBE A;  2NSM A;  5CPA A;  3FF3 A;  2QJ8 A;  1IY7 A;  1VIX A;  4EWT A;  4Z65 A;  5LYL A;  3N5F A;  1F57 A;  1CP6 A;  3DLJ A;  2PIZ A;  2DEA A;  1PYT B;  3SJE A;  4MMO A;  2RB7 A;  2C6G A;  3SJX A;  1HEE A;  1CX8 A;  5K8M A;  2BOA A;  2EK9 A;  4PQA A;  2VL1 A;  1ARM A;  1Q7L A;  4ZYQ A;  2C6P A;  1YLO A;  4MCS A;  3VAR A;  2Q51 A;  2XEI A;  3PB6 X;  2WZN A;  1QMU A;  5HVF A;  4F9V A;  1NSA A;  1FNO A;  4H2K A;  2XEG A;  1AMP A;  4IK2 A;  4JYW A;  4ZY2 A;  1VGY A;  3PB9 X;  4X3R A;  2CTB A;  2PE3 A;  1H8L A;  3B35 A;  3D66 A;  4NJR A;  4MCQ A;  5LYI A;  3WC7 A;  1XRY A;  2PJB A;  3D4U A;  3T8W A;  4TNU A;  1CBX A;  3HUV A;  1XBU A;  1LOK A;  4OID A;  4NGN A;  2PIY A;  1BPM A;  2AFM A;  2NYQ A;  2AFX A;  4KSI A;  1TXR A;  1LCP A;  3FMC A;  1XMB A;  3KZW A;  3D7F A;  3KL9 A;  4P4D A;  4UEE A;  2PCU A;  1R3N A;  1LAN A;  1TKH A;  2XEF A;  2PJ9 A;  1BPN A;  3MRU A;  4DUK A;  3D7G A;  4CPA A;  4WJB A;  4NFR A;  3JRU A;  1GYT A;  4OC0 A;  4IHM A;  4LQG A;  1F2O A;  2ZEE A;  1DE4 C;  4FAI A;  2HC9 A;  3IO1 A;  2AFO A;  2BCO A;  4OC4 A;  2QVP A;  1Y0Y A;  2IMO A;  4P6Y A;  2C1C A;  2GLF A;  2ZOF A;  4A38 A;  3PRT A;  4MHZ A;  4WWV A;  1HDU A;  4X8I A;  2PJ1 A;  2PJ3 A;  2PJC A;  2F7V A;  3IFE A;  3KR5 A;  2OOT A;  3VH9 A;  4NGT A;  3KR4 A;  1YW4 A;  3K2K A;  3D68 A;  4NGS A;  2AFW A;  3D7D A;  5JH9 A;  2PJ7 A;  1DTD A;  3SJF A;  2PRQ A;  2PJA A;  2AFS A;  4UEF A;  4G1P A;  2ZEG A;  1ZLH A;  2POK A;  2AFZ A;  4R76 A;  3I1U A;  2PVW A;  3WT4 A;  3SI1 A;  2OR4 A;  2QYV A;  4OC1 A;  3TC8 A;  4FWU A;  3WAB A;  4P45 A;  3CPX A;  1KWM A;  4MHY A;  3FJU A;  2GU2 A;  1CPS A;  4OC5 A;  2O4H A;  1Z2L A;  3GLJ A;  1FT7 A;  2J9A A;  3SI0 A;  2G9D A;  2ZEO A;  3S9N A;  2V8H A;  4GM5 A;  6CPA A;  2CIJ A;  3B2Y A;  4R6T A;  4O23 A;  2IQ6 A;  3B3T A;  1ZG9 A;  2JBK A;  4NGM A;  4DYO A;  2ZEL A;  3IC1 A;  1CG2 A;  2CTC A;  2ZEH A;  4OP4 A;  2ZEM A;  3PB4 X;  5J1Q A;  2GLJ A;  1Z8L A;  2V77 A; 
#chains in the Genus database with same CATH topology
 2R92 I;  3FRM A;  3ISX A;  1K9M 2;  1VKC A;  3BXM A;  3GTJ I;  1YSJ A;  5CNP A;  3BI1 A;  2AFU A;  1Z4E A;  1YHQ 1;  1K83 I;  4A30 A;  1N2F A;  2KI7 B;  3C26 A;  1VLA A;  3M3Y I;  3NDI A;  2B63 I;  4UCP A;  1TWH I;  3FIX A;  1YIT Z;  3HOW I;  2OZG A;  5D1O A;  2R93 I;  4R7M A;  4J3G A;  4PSX A;  1BO4 A;  1P4N A;  1QQ9 A;  1J4J A;  3PB7 X;  3RZA A;  3B3S A;  4OLL A;  3TE5 B;  2ANP A;  2OH1 A;  5I4M A;  2EWB A;  2QEX 1;  4M85 A;  3F3P C;  1Z8X A;  5EBV A;  3B3C A;  4R57 A;  3N7Z A;  5D8N A;  5HVH A;  1AUG A;  3FEE A;  3J80 b;  2Z3P A;  3GTG I;  3TT2 A;  5C3E I;  5AGE A;  3KKW A;  4AG7 A;  3CCV Z;  3SI2 A;  2GTH A;  1ZG7 A;  1Q86 1;  4E30 A;  1PFT A;  3DR8 A;  3CC4 1;  3FBU A;  5DS0 A;  1VQM 1;  1M1K 2;  3LUS A;  3CPA A;  2HUZ A;  3D2P A;  4CAF A;  2V8K A;  2ABZ A;  3FB3 A;  2FCK A;  1YME A;  3E0K A;  5F49 A;  2NVQ I;  4P4E A;  5ELY A;  1Y9W A;  5AG6 A;  4RN7 A;  5FVJ A;  2EBJ A;  1KUX A;  2JBJ A;  4PK2 A;  4UFW A;  2HB6 A;  3B3W A;  1UWY A;  1IGB A;  2JDD A;  3KI9 A;  1ZLI A;  2Z0Z A;  5K8O A;  1NJI 2;  3FED A;  3KIH A;  1VHO A;  2DE7 A;  1Y0R A;  4PXD A;  1NE9 A;  3P2H A;  2CXA A;  4Y52 I;  3PB8 X;  2WPW A;  4FBE A;  3D3S A;  4P10 A;  1Z01 A;  2EO8 A;  1Y7E A;  2JA7 I;  3CCQ 1;  2OOX B;  2PJ4 A;  4ZBG A;  3SHP A;  4QUS A;  2VZZ A;  1XEB A;  4NBG A;  2E9H A;  4P44 A;  1Y8C A;  3NH8 A;  3RZO I;  2V8G A;  5KTA A;  2JIP A;  4A94 A;  4CGN A;  3KHZ A;  4Q36 A;  2VI7 A;  2YND A;  4MI4 A;  3S14 I;  4MXU A;  2QML A;  3RAM A;  4OC2 A;  2QEC A;  3G71 Z;  2PJ8 A;  2ZEP A;  4HNX B;  1YJ9 1;  1WK4 A;  3FKI I;  4KOT A;  4ZI6 A;  4CAW A;  4PPZ A;  4NBE A;  3V7Z A;  1F2P A;  4ZY0 A;  3FXT A;  3I9S A;  3S1Q I;  2PVV A;  3QNV A;  3CCL Z;  4NF1 A;  2R1I A;  3S16 I;  2B5G B;  3GTL I;  7CPA A;  2KPI A;  3BLN A;  5IP9 I;  2O28 A;  3S2H I;  2JDC A;  4HKF A;  1YUA A;  3TDH B;  4DNC A;  2ZPA A;  3PO3 I;  4MFP A;  3PBE A;  1VQN Z;  5CPA A;  1MK4 A;  1VQ9 Z;  3I55 Z;  4E2A A;  4EWT A;  4Z65 A;  4S1T A;  4RV9 A;  1K73 2;  1VQ6 Z;  2ZW7 A;  2RB7 A;  2C6G A;  4GXH A;  1VQ7 Z;  5F47 A;  3H3V J;  1XOV A;  2B58 A;  2Y0S A;  1YHQ Z;  4HGZ A;  2JR6 A;  2ODF A;  3EXN A;  4MJ8 A;  3NE8 A;  3ZZI A;  4MD7 A;  2Z10 A;  1YJN Z;  2LEX A;  2Q51 A;  2XEI A;  3PB6 X;  1NSA A;  2YGW A;  4QTU A;  2G0B A;  4IUS A;  2XEG A;  1AMP A;  2JIR A;  4ZY2 A;  3PB9 X;  3I56 Z;  3PZJ A;  1N8R 2;  2JA8 I;  5IT9 f;  4R9M A;  1YGH A;  1DL6 A;  1JWH C;  1TWA I;  4KUA A;  2Z11 A;  1QF8 A;  3CZX A;  1QVG Y;  2DF5 A;  5J8C A;  2Y0M A;  1A2Z A;  1Q7Y 1;  4AYB A;  4H6Z A;  1YI2 Z;  2NYQ A;  2AFX A;  1Q2D A;  1TXR A;  1Z8T A;  4KSI A;  1LCP A;  4MY3 A;  1XMB A;  3S2D I;  4B10 A;  2PMZ A;  3PO2 I;  3I3G A;  4UEE A;  3QB8 A;  2JA6 I;  4CRY B;  4KVM E;  5A2Q f;  1Y7R A;  4KOY A;  4CPA A;  3QAY A;  4NFR A;  4BBH A;  3JRU A;  4A3E I;  4IHM A;  2FS5 A;  5CM2 M;  3MZK B;  4ZGY B;  1K8A 2;  1RO4 A;  1WCM I;  4CAE A;  2HC9 A;  3CCS Z;  3EFA A;  3IO1 A;  2QVP A;  1YIT 1;  1Y0Y A;  2IMO A;  3TOB A;  2ZOF A;  3IWE A;  4A3L I;  4XNH B;  4DQY B;  2PJ1 A;  4NH1 C;  2Z3N A;  3GTO I;  4KLW A;  1S60 A;  3KR5 A;  2OOT A;  3F0A A;  1YW4 A;  3K2K A;  3D68 A;  2AFW A;  4RVF A;  4X6A I;  2OZU A;  4ORF A;  1Z9U A;  2JEV A;  2JIM A;  1DTD A;  2PJA A;  2ZEG A;  3GCF A;  4XX2 A;  5EMI A;  2AFZ A;  2PVW A;  3BG1 B;  2OR4 A;  3TC8 A;  2ZW4 A;  4R3L A;  1OZP A;  4CGP A;  1Z2L A;  5J8F A;  2E2J I;  1P9N A;  3S9N A;  2W03 A;  3B2Y A;  1XE4 A;  3B3T A;  1ZG9 A;  1VQO 1;  4DYO A;  5FLX f;  2ZEH A;  1QSN A;  5T64 A;  4DK1 A;  3W91 A;  4YRH A;  2ZEM A;  3PB4 X;  5J1Q A;  2CNT A;  4L89 A;  2F4M A;  2PJ2 A;  4QVT A;  5K8N A;  2JS4 A;  2FVG A;  4A3C I;  3S6F A;  3TO7 A;  1YJ9 Z;  3RYO A;  3JUW A;  4A39 A;  4OME A;  3GKQ A;  3DGV A;  3CQZ I;  5G21 A;  3HOV I;  1PCA A;  3R95 A;  4NJQ A;  2R6M A;  5THW A;  3KQX A;  1X10 A;  4F0X A;  4F9U A;  4NBF A;  2NAP A;  1KUY A;  4X2T A;  2BSW A;  4JD6 A;  1S72 Z;  1ARL A;  2C27 A;  4B14 A;  1U6M A;  2PJ5 A;  4KOS A;  4NOZ A;  4F0Y A;  4OKO A;  1M1D A;  1ELL P;  2R8V A;  2QRE B;  4EWC A;  1CP7 A;  3DSB A;  1M90 2;  3HOX I;  2B3U A;  2XEJ A;  2GTI A;  1Q81 2;  3G3S A;  3D6W A;  3CXC Y;  4Q7A A;  2VUG A;  4EME A;  5D1O B;  3G4S Z;  1Q2C A;  5F46 A;  1JJ2 Y;  1ON0 A;  4NGQ A;  2AKL A;  1UFH A;  3S15 I;  2W04 A;  4NBA A;  3EC4 A;  2JNY A;  2F5I A;  3IWW A;  2BO9 A;  5AN9 F;  3CXQ A;  4BIN A;  4AB7 A;  3GTK I;  4PV6 A;  3CCL 1;  2OOY B;  4C2Y A;  1I21 A;  3SJG A;  2Z3K A;  1QVG Z;  1X3Z A;  1PUA A;  3NDJ A;  1CPX A;  4IAV A;  2I00 A;  3EER A;  1VQN 1;  5F09 A;  1VQ9 1;  3I55 1;  3LWU A;  1AYE A;  4UEZ A;  4FD5 A;  2ZW5 A;  1VQ6 1;  3R1K A;  2GFQ A;  4AVB A;  1YQE A;  4UBR A;  3S9L A;  5D1P A;  1VQ7 1;  4OC3 A;  2ZED A;  2I79 A;  2VXK A;  4BY7 I;  3DR6 A;  1YJN 1;  1QSM A;  4DGL A;  1RXT A;  2RIQ A;  4A95 A;  4NEX A;  3V38 A;  4FD6 A;  3FEC A;  4ONW A;  3D67 A;  3I56 1;  4P4J A;  4MBU A;  1Q82 1;  3JAM b;  2WSA A;  2QA4 Z;  4C68 A;  4E2X A;  4JJX A;  1CM0 A;  2P3Y A;  4BBS I;  2RT9 A;  1LAP A;  1IYK A;  2Q0Y A;  5LRK A;  4A3B I;  1YI2 1;  1L0C A;  1QYP A;  2EUI A;  3FVL A;  4GS4 A;  3PEI A;  2Q4V A;  1K9M 1;  3RBU A;  2PR8 A;  4K3N A;  3MZL B;  3KGQ A;  3VWD A;  4NBB A;  4MCP A;  4KLV A;  4PXB A;  3S1M I;  5HXD A;  3GUX A;  4OIW A;  1BOB A;  4YFJ A;  4A33 A;  4RVH A;  5A28 A;  5K8P A;  3KHX A;  2A4N A;  4Q38 A;  4A3K I;  1ML8 A;  1VQO Z;  3JTK A;  4LQ6 A;  3CCS 1;  2H5M A;  1F57 A;  1CP6 A;  4MFJ A;  4UWJ A;  5KTC A;  3P2F A;  3SXO A;  5H86 A;  1HEE A;  4R3K A;  3GTM I;  5K8M A;  4CL1 A;  1TFI A;  3H5Z A;  1ARM A;  1Q7L A;  4ZYQ A;  1W2B Z;  2C6P A;  3F3F C;  1USP A;  2Z3M A;  5G1Z A;  2VQY A;  1QMU A;  3RZD I;  1I3Q I;  4IK2 A;  4JYW A;  4E31 A;  2CTB A;  3B35 A;  3EO4 A;  3WC7 A;  4UFV A;  4M3S A;  4XPD C;  1I1D A;  1XRY A;  1Y1V I;  2PJB A;  4MHD A;  1Z02 A;  3T8W A;  3DNS A;  1CBX A;  1LOK A;  1VQ4 Z;  2PIY A;  1BPM A;  1YLE A;  2PRB A;  3CXC Z;  2WUU A;  3LD2 A;  3KZW A;  2DE6 A;  1JJ2 Z;  3D2L A;  3D7F A;  4JXR A;  1LAN A;  4Y49 B;  2PJ9 A;  1BPN A;  1QVF Z;  1RO2 A;  3HOZ I;  3ESW A;  2Z3L A;  1KC8 2;  1GYT A;  4F6A A;  4JWP A;  1NJI 1;  4XPL A;  3I4M I;  1F2O A;  4AVA A;  3HKZ A;  1V0C A;  2Q04 A;  1NSL A;  4M6G A;  4FAI A;  4OC4 A;  4MY0 A;  2F4O A;  1S72 1;  1K4J A;  4A38 A;  3CC7 Z;  4WWV A;  3EED A;  1WZN A;  4U9Y A;  2RPR A;  3G6E Z;  3F8K A;  3VH9 A;  4NGT A;  1Q16 A;  4PK3 A;  3OWC A;  2R98 A;  2OTJ Z;  3CCU Z;  2NVX I;  3SXN A;  2WB1 A;  4NBD A;  4KUB A;  3VMI A;  2REF A;  5FLM I;  2K5R A;  1IOF A;  2CNS A;  2D4P A;  2AFS A;  4G1P A;  4H89 A;  1ZLH A;  3GIU A;  5AG4 A;  4R76 A;  4UA3 A;  3SI1 A;  3G4S 1;  2J8N A;  3WAB A;  1B6B A;  3GTQ I;  5I0C A;  4MHY A;  3VB9 A;  1CPS A;  4OC5 A;  3GLJ A;  4UCM A;  1FT7 A;  2G9D A;  5AG7 A;  4B5P A;  1Z8W A;  5IV0 A;  2GAN A;  4O23 A;  3BJ7 A;  2J8M A;  1CG2 A;  1TWG I;  1R9T I;  2J8R A;  3CCR Z;  4OAD A;  3R9F A;  1NP6 A;  2GLJ A;  3K7A I;  4II9 A;  3CME 1;  1YW6 A;  4A37 A;  4CGL A;  4KSF A;  1ELM P;  1L1O C;  3NFZ A;  1VHE A;  3I07 A;  1KRL A;  1K73 1;  1M44 A;  2YNC C;  2DXQ A;  2RC4 A;  3T9Y A;  3CT9 A;  1WII A;  2AJ6 A;  5C82 A;  1EE3 P;  2JUB A;  3IF8 A;  3J81 b;  1KQS Y;  4P4I A;  4ZY1 A;  2IZ3 A;  5A27 A;  2EK8 A;  4MRI A;  4Y7N I;  4UCN A;  4YGO A;  5LRG A;  4UIA A;  3FH4 A;  3H8F A;  2V8V A;  3PFO A;  2NMT A;  4RUH A;  3S6G A;  3T4N B;  2QA4 1;  4KOR A;  4ZX8 A;  4B6Z A;  2PDO A;  3B3V A;  3CD6 Z;  1TF8 A;  3GB0 A;  1YUK A;  2JA5 I;  4KOX A;  1X12 A;  3ISZ A;  5IB0 A;  1S7K A;  4KVX A;  3FYN A;  3GY9 A;  3NH5 A;  2Q4Z A;  2V3V A;  4BXX I;  1ZB8 A;  2AYD A;  1IID A;  1XJO A;  5IT9 b;  1YJW Z;  1M4I A;  1Z5R A;  3CMA Z;  1BAV A;  4U5Y A;  4FUU A;  4TWE A;  4AXV A;  4A32 A;  3IJ3 A;  5T6B A;  1I6H I;  3CCJ Z;  4KOV A;  2R7H A;  3WC5 A;  2K3R A;  4NXY A;  5G22 A;  4C2X A;  1HDQ A;  3IFU A;  4A3I I;  2JIO A;  2ZOG A;  1VQK 1;  2V8I A;  4NB9 A;  1RLY A;  2YU9 I;  4RVD A;  2FSR A;  3CXS A;  2PC1 A;  4RVG A;  4P4B A;  5A2Q b;  2VPX A;  2R7Z I;  1YR0 A;  1SIW A;  8CPA A;  4UIB A;  2PJ0 A;  1S7N A;  3CPW Y;  5LRJ A;  1VQP Z;  3RNZ A;  2QRD B;  4W9Y A;  1RQF A;  2NVT I;  1W2B Y;  3EY5 A;  1YRE A;  4NGR A;  2H85 A;  4KVO E;  3I4N I;  2I3C A;  5DWN A;  2EGT A;  2V8D A;  4CGM A;  4HGY A;  2YNE A;  3VMG A;  4M6I A;  5LYD A;  3QWU A;  4JXQ A;  4XPD B;  3UY5 A;  1X3W A;  4YWY A;  1KD1 2;  4HNY B;  1ZH1 A;  4A3F I;  3HLP A;  1Y9K A;  5HH1 A;  1TKJ A;  5LYF A;  1BLL E;  1VQ4 1;  5D29 A;  3NE7 A;  4P4F A;  3MGD A;  1ZG8 A;  3H8G A;  2WYR A;  4KOW A;  3CCM Z;  3PBB A;  5G20 A;  4MHN A;  2BUE A;  1M4G A;  1QVF Y;  5FLX b;  2D4O A;  1M4L A;  3MON A;  3K9T A;  3NA6 A;  2NSM A;  3FF3 A;  2FIA A;  2REE A;  3N5F A;  4H6U A;  4E33 A;  3DLJ A;  1IOI A;  2PIZ A;  3GKR A;  2DEA A;  1CJW A;  3IGR A;  3CME Z;  3CC7 1;  4B5O A;  2OB0 A;  2BOA A;  2IV2 X;  1S7M A;  3G6E 1;  1MJA A;  4NSQ A;  3P5J B;  2P6G A;  2VL1 A;  2FE7 A;  1M90 1;  3J80 f;  2OTJ 1;  4MCS A;  1AA6 A;  3VAR A;  3CCU 1;  3LAC A;  3PO3 S;  2WZN A;  5AG5 A;  2V45 A;  4NB8 A;  1KQS Z;  4H2K A;  1WW9 A;  2QIR A;  3QAH A;  4X3R A;  2PE3 A;  1H8L A;  3D66 A;  2RHB A;  5JQ4 A;  4NJR A;  4MCQ A;  5LYI A;  3D8P A;  3D4U A;  2HF1 A;  2Q4Y A;  1NMT A;  4TNU A;  5T67 A;  3BJ8 A;  4OID A;  2OZH A;  1USP B;  2IZ4 A;  3PGP A;  5JPH A;  2VPZ A;  1B87 A;  3CXP A;  3FMC A;  1Q86 2;  3CCR 1;  3KL9 A;  4P4D A;  1R3N A;  2VEZ A;  4DUK A;  1XIX A;  5BWA B;  2B4D A;  4XNH C;  5C4X I;  4LQG A;  1YX0 A;  2IL4 A;  4CAV A;  3B8G A;  1M4D A;  2BCO A;  4NBH A;  5ISV A;  4M6H A;  5IP7 I;  2GLF A;  5LL6 f;  3PRT A;  4MHZ A;  1RNI A;  1WJ2 A;  1VQK Z;  2FL4 A;  3TE4 A;  2PJC A;  3IFE A;  3H0G I;  3KR4 A;  2G2K A;  4NGS A;  3PP9 A;  3D7D A;  4U9Z A;  4IF5 A;  2DPT A;  1ZB9 A;  3SJF A;  2PRQ A;  1Z03 A;  1IB1 E;  4LX9 A;  3DDD A;  3CPW Z;  4LUA A;  3WT4 A;  4E2Z A;  4L8A A;  2QYV A;  4FWU A;  3CD6 1;  1TWF I;  1KWM A;  3CPX A;  2P0W A;  4B11 A;  5C44 I;  1IYL A;  1WWZ A;  4ONU A;  4A3J I;  2ZEO A;  2Q44 A;  2V8H A;  4OAE A;  3LOD A;  4AG9 A;  2CIJ A;  6CPA A;  3RO0 A;  4R6T A;  1YJW 1;  2IQ6 A;  2JBK A;  2ATR A;  2ZEL A;  4PSW A;  2NVY I;  2CTC A;  4QC6 A;  3CMA 1;  2RBL A;  4AVC A;  4MFK A;  4MFZ A;  2DE5 A;  1Z8L A;  3CCJ 1;  2VPY A;  2YNC A;  3B7I A;  3OW2 Z;  2O53 A;  3Q87 A;  1M1K 1;  3WC6 A;  2P28 A;  1QSO A;  4RS2 A;  4A93 I;  3CC2 Z;  4PXE A;  2B4B A;  2J6A A;  2CF4 A;  1I50 I;  1N71 A;  2Z3O A;  4R8F A;  5IB9 A;  3CCE 1;  4DJL A;  1MJ9 A;  4B5P B;  3FNC A;  4CS0 B;  4E32 A;  2F8H A;  4PXC A;  1JQG A;  3IWG A;  1VQ5 1;  3MN8 A;  4MD9 A;  2B3V A;  3TO6 A;  1VQP 1;  1XF8 A;  3BHX A;  4BD9 A;  3LMS A;  4BY1 I;  4K30 A;  2X7B A;  3IIB A;  3KAS A;  3TO9 A;  1IU8 A;  4EVY A;  1YIJ Z;  4CYN A;  2JMO A;  1VQ8 Z;  1LFW A;  3S9M A;  4F8Z A;  2ZW6 A;  3IU2 A;  4RI1 A;  1Z4R A;  1KZF A;  1VQL Z;  1JWQ A;  2EVN A;  3IEH A;  2OU2 A;  5E96 A;  1TKF A;  2JEW A;  3FQM A;  1LRZ A;  1OBR A;  1IIC A;  3R96 A;  1R57 A;  1QST A;  5C4J I;  1RTQ A;  1I12 A;  3J81 f;  1SFO I;  4UF4 A;  3S6H A;  4MCR A;  3CCM 1;  1QXF A;  2ZEN A;  1TWC I;  4R87 A;  4MHP A;  2P6F A;  2RFH A;  1Q7Y 2;  3R9E A;  2OTL Z;  2C6C A;  2K5T A;  1S5K A;  1KC8 1;  1MJB A;  4NGP A;  4EFD A;  4JZ0 A;  1QSR A;  3TFY A;  3FQQ A;  3FX6 A;  2V8J A;  3V8I A;  1PU9 A;  5H84 A;  1GHE A;  2E7Z A;  3VAT A;  4E0A A;  5F48 A;  4B12 A;  4QBJ A;  3ZJ0 A;  4FD4 A;  1S3Z A;  4MON A;  4BBR I;  1TF9 A;  2ZAE B;  1LAM A;  3H8E A;  4YU9 A;  3D7H A;  3IR7 A;  1XFO A;  3HOU I;  3K9U A;  3CDX A;  3W6S A;  2Q7B A;  2VBQ A;  2PK7 A;  4JLY A;  2IJZ A;  1S7F A;  2QEX Z;  2QR1 B;  3T90 A;  4C7I A;  2M6N A;  1RO5 A;  4MFQ A;  3VWE A;  4ZX9 A;  5EC4 A;  3WR7 A;  2Q43 A;  3IX0 A;  5JGF A;  3VTN A;  4MD8 A;  2B5G A;  2FT0 A;  3BI0 A;  5JM6 A;  4XPK A;  2ZEF A;  2AE6 A;  4QB9 A;  3KQZ A;  4B13 A;  5HMN A;  3TCV A;  1N8R 1;  4CRZ B;  3A9L A;  3GYA A;  4NCZ A;  3IU1 A;  2HV2 A;  4MFL A;  3NH4 A;  5CBM A;  3CC4 Z;  4UFX A;  1R43 A;  2WAQ A;  1VQM Z;  1SQH A;  2CY2 A;  5KTD A;  3TX8 A;  3PFE A;  3L2N A;  5HVG A;  2E2I I;  2QLV B;  2GRE A;  2VPW A;  2PJ6 A;  2BL1 A;  4HH4 A;  3GTP I;  4X5K A;  2QKD A;  2E2H I;  4CYO A;  2QJ8 A;  1IY7 A;  1VIX A;  5LYL A;  3S17 I;  2JLM A;  1FDI A;  1S7L A;  1Y1W I;  4HNW B;  4FD7 A;  4E2W A;  1PYT B;  3SJE A;  4MMO A;  2GIV A;  1K8A 1;  3SJX A;  2DPS A;  2VF1 A;  4A31 A;  1CX8 A;  4KSA A;  4A2Z A;  3F5B A;  1ZO0 A;  2EK9 A;  2GE3 A;  4C7H A;  2PM9 A;  4PQA A;  3TOA A;  4UWI A;  2PR1 A;  3D9X A;  3CCE Z;  1YLO A;  3CCV 1;  4QTT A;  2P6E A;  3S6K A;  5HVF A;  4F9V A;  2G3T A;  3CCQ Z;  1FNO A;  4C2Z A;  1VQ5 Z;  2LFU A;  1VGY A;  1NUI A;  4CYP A;  2VUM I;  2LIY A;  2BJO A;  1TIQ A;  3GTM S;  1X0T A;  1Q2Y A;  4Y49 C;  3HUV A;  4A3G I;  1XBU A;  2OZK A;  2FIW A;  4KOU A;  4NBC A;  3TTH A;  3BG0 B;  4NGN A;  2JIQ A;  2G3A A;  2Q7S A;  3JVN A;  1KUV A;  2AFM A;  4CAX A;  2HQY A;  1XMT A;  3D2M A;  3J7A 4;  2ZXV A;  2VZY A;  2PCU A;  1TKH A;  2PSW A;  4A3D I;  2XEF A;  3MRU A;  3OW2 Y;  3D7G A;  2CNM A;  4WJB A;  3CC2 1;  2FXF A;  2BEI A;  1FY7 A;  1Y1V S;  5GCN A;  4OC0 A;  3S1R I;  3M4O I;  5C88 A;  4RS4 A;  1RO0 A;  1YVK A;  4CYQ A;  2ZEE A;  1YVO A;  1DE4 C;  3U50 C;  2AFO A;  2ARH A;  4MH4 A;  4P6Y A;  2C1C A;  1VHS A;  1HDU A;  4CGO A;  4X8I A;  2PJ3 A;  3W6X A;  2F7V A;  4HPS A;  1YIJ 1;  2HU9 A;  1VQ8 1;  1LQL A;  3JAM f;  3R9G A;  3G71 1;  1P0H A;  2B4D B;  2KCW A;  5JH9 A;  2PJ7 A;  4E8O A;  4UEF A;  1VQL 1;  4A3M I;  3G8W A;  3HOY I;  1KD1 1;  2M48 A;  2POK A;  5DWM A;  3I1U A;  4I49 A;  2WPX A;  4KZT A;  1FDO A;  4OC1 A;  4P45 A;  2PQ8 A;  1Q81 1;  3FJU A;  1Q82 2;  2GU2 A;  2O4H A;  2J9A A;  3SI0 A;  4BMH A;  3KIF A;  5IX3 A;  4GM5 A;  1YK3 A;  4NGM A;  3H4Q A;  3IC1 A;  3S1N I;  2YAD A;  4E2Y A;  4OP4 A;  2QRC B;  4KS9 A;  2OTL 1;  2V77 A;  3VMH A; 
#chains in the Genus database with same CATH homology
 2F4M A;  2R92 I;  2PJ2 A;  3K7A I;  3B7I A;  3CME 1;  1YW6 A;  3ISX A;  4A37 A;  1K9M 2;  5K8N A;  3OW2 Z;  2JS4 A;  2FVG A;  2O53 A;  4A3C I;  1ELM P;  3BXM A;  1L1O C;  3NFZ A;  3GTJ I;  1VHE A;  3Q87 A;  1YJ9 Z;  1M1K 1;  1YSJ A;  2P28 A;  3WC6 A;  4A39 A;  3BI1 A;  2AFU A;  4OME A;  1YHQ 1;  4A93 I;  3I07 A;  3CC2 Z;  1K83 I;  1KRL A;  3GKQ A;  3DGV A;  1K73 1;  4PXE A;  3CQZ I;  2J6A A;  2CF4 A;  1I50 I;  1N2F A;  4R8F A;  5IB9 A;  3HOV I;  3CCE 1;  4DJL A;  2KI7 B;  3CT9 A;  1VLA A;  1WII A;  1PCA A;  3M3Y I;  3NDI A;  2B63 I;  4NJQ A;  1TWH I;  2R6M A;  4E32 A;  1EE3 P;  5THW A;  2JUB A;  3IF8 A;  1YIT Z;  2F8H A;  3KQX A;  4F9U A;  3HOW I;  4NBF A;  3J81 b;  4PXC A;  1JQG A;  4X2T A;  5D1O A;  2R93 I;  4R7M A;  1KQS Y;  1S72 Z;  1VQ5 1;  1ARL A;  3MN8 A;  4P4I A;  4MD9 A;  1QQ9 A;  4ZY1 A;  2PJ5 A;  2IZ3 A;  3PB7 X;  1VQP 1;  3BHX A;  3RZA A;  4BD9 A;  3LMS A;  4BY1 I;  4NOZ A;  3B3S A;  4OKO A;  3IIB A;  3KAS A;  3TE5 B;  2EK8 A;  4MRI A;  4Y7N I;  1ELL P;  1YIJ Z;  2ANP A;  2QRE B;  5I4M A;  2EWB A;  2QEX 1;  4EWC A;  2JMO A;  1VQ8 Z;  1CP7 A;  1LFW A;  3S9M A;  3F3P C;  5LRG A;  4UIA A;  4F8Z A;  3FH4 A;  3H8F A;  2V8V A;  3B3C A;  3PFO A;  1M90 2;  3HOX I;  2XEJ A;  2GTI A;  1Q81 2;  4RUH A;  1VQL Z;  5D8N A;  3IEH A;  5HVH A;  3FEE A;  1TKF A;  2JEW A;  3D6W A;  3T4N B;  2QA4 1;  4ZX8 A;  3J80 b;  4B6Z A;  3CXC Y;  4Q7A A;  3GTG I;  2VUG A;  4EME A;  5D1O B;  3G4S Z;  5C3E I;  3FQM A;  1JJ2 Y;  3B3V A;  3CD6 Z;  1TF8 A;  1OBR A;  4NGQ A;  3GB0 A;  1YUK A;  2JA5 I;  2AKL A;  3S15 I;  3CCV Z;  3ISZ A;  2W04 A;  2GTH A;  5C4J I;  3SI2 A;  1ZG7 A;  4NBA A;  1Q86 1;  2JNY A;  1RTQ A;  4E30 A;  1PFT A;  3NH5 A;  3J81 f;  2Q4Z A;  1SFO I;  3IWW A;  4BXX I;  1ZB8 A;  4UF4 A;  2BO9 A;  1XJO A;  4MCR A;  5IT9 b;  5AN9 F;  3CCM 1;  1YJW Z;  2ZEN A;  1TWC I;  3CC4 1;  1Z5R A;  4MHP A;  5DS0 A;  3CMA Z;  1BAV A;  1VQM 1;  1M1K 2;  4FUU A;  2RFH A;  4TWE A;  3LUS A;  4AXV A;  3IJ3 A;  1Q7Y 2;  3CPA A;  5T6B A;  3GTK I;  2OTL Z;  3CCL 1;  2C6C A;  1I6H I;  3CCJ Z;  2OOY B;  1KC8 1;  3SJG A;  2V8K A;  2ABZ A;  3WC5 A;  2K3R A;  1X3Z A;  1QVG Z;  3NDJ A;  1YME A;  1HDQ A;  4NGP A;  3IFU A;  2NVQ I;  4P4E A;  5ELY A;  4A3I I;  1CPX A;  4EFD A;  2ZOG A;  4IAV A;  1VQK 1;  4JZ0 A;  2V8I A;  3FQQ A;  4NB9 A;  3FX6 A;  2V8J A;  1RLY A;  3EER A;  2YU9 I;  1VQN 1;  5F09 A;  1VQ9 1;  2JBJ A;  4RVD A;  3I55 1;  3VAT A;  3LWU A;  1AYE A;  4UEZ A;  2HB6 A;  3B3W A;  1UWY A;  1IGB A;  4RVG A;  4P4B A;  5A2Q b;  3KI9 A;  1VQ6 1;  1ZLI A;  5K8O A;  1NJI 2;  3FED A;  2R7Z I;  4MON A;  3S9L A;  3KIH A;  4BBR I;  1VHO A;  8CPA A;  1TF9 A;  2ZAE B;  5D1P A;  1LAM A;  1VQ7 1;  3H8E A;  4OC3 A;  4YU9 A;  2ZED A;  3D7H A;  4UIB A;  2PJ0 A;  1XFO A;  3HOU I;  2DE7 A;  3CPW Y;  1Y0R A;  4PXD A;  5LRJ A;  1VQP Z;  3CDX A;  2QRD B;  4W9Y A;  4BY7 I;  2PK7 A;  2IJZ A;  4Y52 I;  3PB8 X;  1RQF A;  2QEX Z;  2NVT I;  1W2B Y;  2QR1 B;  4FBE A;  1YJN 1;  4P10 A;  4NGR A;  2H85 A;  4DGL A;  3I4N I;  2I3C A;  1Z01 A;  2M6N A;  2RIQ A;  1Y7E A;  2JA7 I;  3CCQ 1;  2EGT A;  2OOX B;  4ZX9 A;  3V38 A;  2PJ4 A;  2Q43 A;  2V8D A;  4DYO A;  3IX0 A;  4HGY A;  5JGF A;  3VTN A;  3FEC A;  4ONW A;  3D67 A;  4NBG A;  2E9H A;  3VMG A;  3I56 1;  4MD8 A;  5LYD A;  3QWU A;  4P44 A;  3RZO I;  3NH8 A;  4P4J A;  3BI0 A;  1Q82 1;  3JAM b;  2QA4 Z;  2V8G A;  5JM6 A;  4A94 A;  3KHZ A;  4E2X A;  1X3W A;  2ZEF A;  4YWY A;  1KD1 2;  1ZH1 A;  4A3F I;  3S14 I;  3HLP A;  4MXU A;  3KQZ A;  3RAM A;  4OC2 A;  3G71 Z;  1TKJ A;  2PJ8 A;  2ZEP A;  5LYF A;  2P3Y A;  1BLL E;  1YJ9 1;  1N8R 1;  4BBS I;  2RT9 A;  1VQ4 1;  1LAP A;  3FKI I;  5LRK A;  4A3B I;  5D29 A;  4ZI6 A;  4PPZ A;  4P4F A;  4NBE A;  1YI2 1;  3V7Z A;  1ZG8 A;  1QYP A;  3H8G A;  1F2P A;  2WYR A;  4ZY0 A;  3CCM Z;  3FVL A;  3NH4 A;  3PEI A;  5CBM A;  3CC4 Z;  1K9M 1;  3S1Q I;  3RBU A;  2PVV A;  1R43 A;  3PBB A;  2WAQ A;  1VQM Z;  4MHN A;  4K3N A;  3TX8 A;  3QNV A;  3MZL B;  3KGQ A;  3PFE A;  4NBB A;  3L2N A;  3CCL Z;  4MCP A;  4PXB A;  3S1M I;  3S16 I;  5HVG A;  3GUX A;  3GTL I;  5HXD A;  7CPA A;  2E2I I;  2KPI A;  1QVF Y;  5IP9 I;  4OIW A;  2QLV B;  3S2H I;  2GRE A;  2PJ6 A;  1YUA A;  4RVH A;  3TDH B;  5FLX b;  5K8P A;  4HH4 A;  3KHX A;  1M4L A;  3MON A;  3GTP I;  3PO3 I;  3K9T A;  2QKD A;  3NA6 A;  2E2H I;  3PBE A;  4A3K I;  1ML8 A;  1VQO Z;  2NSM A;  1VQN Z;  5CPA A;  3FF3 A;  2QJ8 A;  1VQ9 Z;  1IY7 A;  3I55 Z;  1VIX A;  4EWT A;  3CCS 1;  4Z65 A;  5LYL A;  3N5F A;  4S1T A;  3S17 I;  1F57 A;  1CP6 A;  4RV9 A;  4E33 A;  1K73 2;  3DLJ A;  1VQ6 Z;  2PIZ A;  1Y1W I;  2DEA A;  4E2W A;  1PYT B;  3SJE A;  3CME Z;  4MMO A;  2RB7 A;  2C6G A;  1K8A 1;  1HEE A;  3SJX A;  2VF1 A;  1VQ7 Z;  1CX8 A;  3GTM I;  3CC7 1;  5K8M A;  3H3V J;  2BOA A;  2EK9 A;  1S7M A;  3G6E 1;  2PM9 A;  4PQA A;  2Y0S A;  1YHQ Z;  4CL1 A;  4HGZ A;  3P5J B;  1TFI A;  2JR6 A;  2VL1 A;  1M90 1;  3D9X A;  3J80 f;  1ARM A;  1Q7L A;  4ZYQ A;  1W2B Z;  3CCE Z;  4MD7 A;  1YLO A;  3CCV 1;  3F3F C;  2C6P A;  2OTJ 1;  1USP A;  1YJN Z;  4MCS A;  3VAR A;  3CCU 1;  2Q51 A;  2XEI A;  4QTT A;  3PB6 X;  3PO3 S;  2WZN A;  1QMU A;  5HVF A;  4F9V A;  1NSA A;  3RZD I;  4QTU A;  3CCQ Z;  4NB8 A;  1KQS Z;  1I3Q I;  1FNO A;  4H2K A;  1WW9 A;  2XEG A;  1AMP A;  4IK2 A;  4JYW A;  1VQ5 Z;  2LFU A;  4E31 A;  1VGY A;  3PB9 X;  1NUI A;  4ZY2 A;  4X3R A;  3I56 Z;  2CTB A;  2VUM I;  2PE3 A;  1N8R 2;  1H8L A;  2JA8 I;  3B35 A;  3D66 A;  2LIY A;  5IT9 f;  2BJO A;  2RHB A;  4NJR A;  4MCQ A;  5LYI A;  3WC7 A;  1XRY A;  1Y1V I;  1DL6 A;  1JWH C;  3GTM S;  2PJB A;  3D4U A;  2HF1 A;  1TWA I;  1X0T A;  1Z02 A;  3T8W A;  1QF8 A;  4TNU A;  1QVG Y;  5T67 A;  1CBX A;  4A3G I;  1XBU A;  1LOK A;  3HUV A;  2OZK A;  1VQ4 Z;  4OID A;  4NBC A;  1Q7Y 1;  3BG0 B;  4NGN A;  2PIY A;  1BPM A;  4AYB A;  1USP B;  1YI2 Z;  2IZ4 A;  2AFM A;  2NYQ A;  2AFX A;  4KSI A;  1TXR A;  1LCP A;  3CXC Z;  3FMC A;  1Q86 2;  3CCR 1;  1XMB A;  3S2D I;  3J7A 4;  3KZW A;  2PMZ A;  3PO2 I;  2DE6 A;  1JJ2 Z;  3D7F A;  3KL9 A;  4P4D A;  4UEE A;  2PCU A;  1R3N A;  1LAN A;  1TKH A;  4A3D I;  2XEF A;  2JA6 I;  2PJ9 A;  1BPN A;  3MRU A;  4DUK A;  5A2Q f;  3OW2 Y;  1QVF Z;  3D7G A;  1RO2 A;  3HOZ I;  3ESW A;  4CPA A;  4WJB A;  4NFR A;  3CC2 1;  1Y1V S;  1KC8 2;  4A3E I;  1GYT A;  3JRU A;  4OC0 A;  5C4X I;  3S1R I;  3M4O I;  4IHM A;  5CM2 M;  4LQG A;  3MZK B;  1NJI 1;  1K8A 2;  3I4M I;  1F2O A;  3HKZ A;  4RS4 A;  1RO0 A;  1RO4 A;  2ZEE A;  1DE4 C;  1WCM I;  4FAI A;  2HC9 A;  3CCS Z;  3U50 C;  3IO1 A;  2AFO A;  4NBH A;  2BCO A;  4OC4 A;  2QVP A;  2F4O A;  1YIT 1;  1Y0Y A;  2IMO A;  4MH4 A;  4P6Y A;  2C1C A;  1S72 1;  5IP7 I;  2GLF A;  2ZOF A;  5LL6 f;  4A38 A;  4A3L I;  3PRT A;  3CC7 Z;  4MHZ A;  1RNI A;  4WWV A;  3EED A;  1HDU A;  4X8I A;  4DQY B;  2RPR A;  1VQK Z;  3G6E Z;  2PJ1 A;  2PJ3 A;  2PJC A;  4NH1 C;  2F7V A;  1YIJ 1;  3GTO I;  3IFE A;  2HU9 A;  3KR5 A;  2OOT A;  3VH9 A;  3H0G I;  1VQ8 1;  4NGT A;  1LQL A;  3JAM f;  3KR4 A;  1YW4 A;  3K2K A;  2G2K A;  3D68 A;  3G71 1;  4NGS A;  2OTJ Z;  2AFW A;  3D7D A;  4RVF A;  3CCU Z;  4X6A I;  5JH9 A;  2PJ7 A;  2NVX I;  2WB1 A;  1ZB9 A;  4NBD A;  3VMI A;  1DTD A;  3SJF A;  2PRQ A;  5FLM I;  2K5R A;  2PJA A;  2AFS A;  4UEF A;  1Z03 A;  1VQL 1;  4A3M I;  4G1P A;  3HOY I;  1KD1 1;  3GCF A;  2ZEG A;  3CPW Z;  2M48 A;  1ZLH A;  4XX2 A;  2POK A;  2AFZ A;  4R76 A;  3I1U A;  2PVW A;  3WT4 A;  4E2Z A;  3BG1 B;  3SI1 A;  2OR4 A;  3G4S 1;  2QYV A;  4OC1 A;  3TC8 A;  4FWU A;  3WAB A;  3CD6 1;  4P45 A;  3GTQ I;  1TWF I;  1KWM A;  3CPX A;  1Q81 1;  4MHY A;  3FJU A;  3VB9 A;  5C44 I;  1Q82 2;  2GU2 A;  1CPS A;  4OC5 A;  2O4H A;  1Z2L A;  3GLJ A;  1FT7 A;  2J9A A;  3SI0 A;  2E2J I;  4A3J I;  2G9D A;  1P9N A;  3KIF A;  2ZEO A;  3S9N A;  2V8H A;  4GM5 A;  2W03 A;  6CPA A;  2CIJ A;  3B2Y A;  4R6T A;  1YJW 1;  2IQ6 A;  2JBK A;  1ZG9 A;  1VQO 1;  3B3T A;  4O23 A;  2ZEL A;  4NGM A;  2NVY I;  5FLX f;  3S1N I;  1CG2 A;  2CTC A;  3IC1 A;  1TWG I;  3CMA 1;  1R9T I;  2ZEH A;  5T64 A;  4DK1 A;  2YAD A;  2RBL A;  4E2Y A;  4OP4 A;  2QRC B;  2ZEM A;  3PB4 X;  3CCR Z;  5J1Q A;  2DE5 A;  2OTL 1;  1NP6 A;  2GLJ A;  1Z8L A;  2V77 A;  3CCJ 1;  3VMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...