4MRIA

Human brain aspartoacylase mutant f295s complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEASAKTTKLTLNAKSIRCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mriA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mriA01
5HVHA 1PYTB 1DTDA 4OC5A 3NH5A 1LAPA 4IK2A 2PJ8A 2ZENA 3V38A 4PXDA 2ABZA 1BAVA 4MRIA 1HDUA 3PB4X 3HLPA 3LMSA 4ZY2A 4P4IA 1ZG7A 2PVWA 3FVLA 4JZ0A 5THWA 5HVFA 4KSIA 2BOAA 3D68A 3D7GA 3PBEA 3TC8A 3V7ZA 2PVVA 4OC3A 2V8DA 4PQAA 3D4UA 1GYTA 2ZEEA 4PXCA 2NYQA 5K8OA 4MCQA 3FEEA 4ZY1A 1YLOA 2PJBA 4OIWA 1IGBA 1XRYA 2AFSA 1LCPA 3PFOA 3PB9X 2GLJA 3FH4A 1Y0YA 1TKHA 3WC6A 3S9MA 2G9DA 3VATA 5D29A 2F7VA 3FJUA 1LFWA 2WZNA 4MMOA 2PCUA 2DEAA 3HUVA 1Z5RA 4UIAA 1TKFA 3JRUA 1LAMA 3CT9A 2JBKA 4YWYA 4P4FA 3IC1A 3NH8A 1ARMA 2GREA 4YU9A 3IO1A 2PJ2A 1BPMA 2AFOA 1AMPA 1PCAA 6CPAA 2CTCA 3PFEA 4X8IA 4NFRA 1Y7EA 4MCSA 3IIBA 3SJGA 1TF9A 2AFZA 4NJRA 2FVGA 3S9NA 4ZX9A 3LWUA 4OC4A 3RBUA 2HB6A 5LRJA 1CP7A 2CIJA 3GB0A 4RUHA 4NGMA 1FT7A 1CG2A 2PJ5A 2AFXA 2I3CA 4AXVA 3B7IA 2ZEMA 1R43A 4FUUA 2ZEFA 3KQXA 1LOKA 2BO9A 2IJZA 2QVPA 2ZELA 3SI0A 4OKOA 2PJ6A 3NFZA 1JQGA 4DUKA 1VHEA 2ZEOA 3KR4A 4A37A 2GU2A 1QMUA 3IWWA 2F8HA 4LQGA 3SJFA 4A39A 3B3VA 2PJAA 4W9YA 2ZEPA 1R3NA 3B3CA 3K2KA 5LRKA 3D7HA 1F2OA 4UEEA 4PXEA 3BI1A 4Z65A 2OR4A 3PBBA 5JM6A 1TF8A 4MHYA 3K9TA 2PRQA 3MN8A 2XEGA 5K8NA 3VH9A 2QJ8A 4TWEA 1DE4C 3GUXA 1AYEA 1NSAA 1Q7LA 4X3RA 3BXMA 2PE3A 3PEIA 4BD9A 3IJ3A 4TNUA 3D7FA 4OC0A 1KWMA 2O4HA 3NA6A 4JYWA 1YW6A 4A94A 4WWVA 1F57A 2EWBA 3FMCA 2PJCA 1OBRA 3T8WA 1CPXA 1ZLIA 3D7DA 1XBUA 4R6TA 1Z8LA 4MXUA 2PJ9A 1YSJA 5J1QA 4UEZA 3B3SA 2C6GA 1TXRA 4P6YA 3RAMA 1HEEA 4UIBA 5HXDA 4X2TA 1VGYA 4P45A 2PJ7A 4ZYQA 3KASA 3RZAA 4NGPA 5I4MA 5JH9A 3B35A 4PPZA 3KQZA 2NSMA 3PB8X 4MHZA 3GLJA 3VARA 4WJBA 5F09A 2AFMA 5LYDA 3IFEA 4IHMA 1FNOA 5DS0A 3WC7A 5IB9A 2JEWA 3QNVA 1Z2LA 2BCOA 8CPAA 4UEFA 2XEJA 3H8FA 3KHXA 1ELMP 5ELYA 2PJ4A 3B3TA 4EWTA 2AFWA 2V77A 4P4DA 4F9VA 4NGSA 3KGQA 3CPAA 5CPAA 5LYLA 2ZOGA 3CDXA 2VL1A 2HC9A 2ZEDA 4P4EA 1XFOA 2IMOA 4P44A 4IAVA 1BPNA 3PB7X 5LRGA 5D8NA 2J9AA 2PIZA 1Y0RA 4MCRA 4R7MA 3BHXA 2ANPA 4H2KA 4GM5A 4CPAA 4MHPA 2EK8A 1BLLE 5CBMA 1ZG8A 2C6CA 3D66A 1YW4A 2QYVA 4A38A 4FWUA 2ZEGA 3DLJA 3KL9A 2POKA 2PJ0A 3SI2A 1F2PA 4P10A 4NGNA 4O23A 4OC2A 2C6PA 1ZLHA 2ZEHA 4ZI6A 2PJ1A 3WABA 2Q4ZA 5LYIA 2GLFA 4EMEA 3KZWA 2ZOFA 2WYRA 4K3NA 2C1CA 3CPXA 4B6ZA 3ISXA 3KHZA 3NH4A 3L2NA 2V8HA 3BI0A 3N5FA 1XJOA 2OOTA 1H8LA 2IQ6A 3SI1A 4OP4A 4DJLA 1CBXA 2Q43A 3B3WA 4NGRA 1M4LA 2RFHA 2PJ3A 3KR5A 4F9UA 4Q7AA 3TX8A 1QQ9A 1EE3P 2RB7A 4MCPA 3PRTA 3SJEA 1YMEA 4FAIA 4MHNA 5K8PA 4UF4A 3FX6A 1RTQA 3FF3A 1TKJA 7CPAA 2O53A 1IY7A 1VHOA 3IEHA 5JGFA 2V8GA 5K8MA 3SJXA 2EK9A 2CF4A 4OC1A 3WT4A 1CX8A 4EFDA 4ZY0A 4ONWA 4NJQA 4R76A 4PXBA 1CPSA 4ZX8A 1ZG9A 2XEIA 3S9LA 3I1UA 3MRUA 2CTBA 3KI9A 1LANA 3PB6X 2JBJA 1ELLP 4F8ZA 4P4BA 3H8EA 4NGTA 4OMEA 2XEFA 5HVGA 3ISZA 1CP6A 3H8GA 1HDQA 4P4JA 1XMBA 4G1PA 3FEDA 2Q51A 1UWYA 3DGVA 4NGQA 2V8VA 4R8FA 2AFUA 3FECA 3WC5A 2PIYA 5LYFA 1VIXA 4FBEA 1ARLA 4DYOA 3D67A 4OIDA 3B2YA
chains in the Genus database with same CATH superfamily
1PYTB 4OC5A 3D2PA 2J8NA 4CGLA 4M6GA 3HLPA 3LMSA 1WIIA 1YLEA 2P6FA 2P28A 3J80f 5A2Qf 3PBEA 1TWGI 2V8DA 1P9NA 4A3JI 3S6FA 4PQAA 3D4UA 1SIWA 2ZEEA 4PXCA 4HNXB 4A3KI 2YNEA 2PMZA 1Z02A 2PJBA 1LCPA 2B4DA 4A3DI 1YJ91 3FH4A 4UBRA 3VATA 4CYOA 4MMOA 3G4S1 3KIHA 1Z5RA 1TKFA 3NE8A 3JRUA 3GTLI 1LAMA 2QRDB 2WB1A 4NBDA 1J4JA 4XPLA 4P4FA 2GE3A 4NEXA 1BPMA 3D9XA 1M1K1 3G4SZ 1QVFY 2LIYA 2CTCA 3PFEA 4NFRA 2OZHA 4MONA 1Y7EA 3GKRA 3TO9A 3S9NA 2YU9I 2V8JA 1Y9WA 2HB6A 4RUHA 4NGMA 1FT7A 3PP9A 1CG2A 1X12A 4A3GI 1YHQZ 2QEX1 2G3TA 3CCU1 3CCJ1 4KOUA 2G0BA 2LFUA 4OKOA 4B11A 1QVGY 3S1QI 5AG7A 3U50C 4DUKA 3FXTA 2LEXA 1N8R2 2GU2A 1QMUA 1VHSA 2QEXZ 1S721 2RC4A 4A33A 3CCV1 2PJAA 3CCL1 3CCJZ 3D7HA 1F2OA 3TO6A 3BI1A 3I4NI 1WZNA 3K9TA 1YI21 4H89A 4RS4A 3SHPA 4AVAA 1KD11 1S72Z 2NVXI 3CCVZ 3QB8A 1DE4C 3GUXA 3JUWA 3G3SA 4LX9A 4E31A 4X3RA 3PEIA 4UFVA 4AG9A 2JA7I 1UFHA 2ZW5A 3D7FA 4E32A 4CGMA 3NA6A 4JYWA 1YW6A 2EWBA 4XPDC 2REFA 2PJCA 5IB0A 2OOXB 3HOXI 3F5BA 1XBUA 1BOBA 3W91A 4MXUA 1Z9UA 2DE5A 4UA3A 2PR8A 4CAEA 4X5KA 3B3SA 2I79A 1TXRA 4P6YA 3JAMb 3F3PC 5FLMI 3S1RI 4A30A 2PSWA 2Y0MA 4NBAA 4P45A 4MD7A 3GTKI 2WUUA 3HOVI 1ML8A 3RZAA 1TWHI 3MONA 4XNHC 3B35A 5J8CA 2BL1A 1IYLA 2AFMA 3IFEA 3CME1 1YUKA 4C68A 1KUYA 4NOZA 3IFUA 1FNOA 1SQHA 5DS0A 5IB9A 5F47A 3CCQ1 4LQ6A 3QNVA 2BCOA 1VQM1 4ONUA 2Q7BA 4UCMA 1K9M1 1Y7RA 1ELMP 5ELYA 2ATRA 2JNYA 1USPB 4CGOA 2HUZA 3B3TA 5HMNA 2JDCA 2WPXA 2Z10A 3CMEZ 2BSWA 4ORFA 1M44A 2B3UA 3CCQZ 1RO2A 1WCMI 1VQMZ 5LYLA 4OADA 2B58A 1YJW1 1BPNA 4MBUA 2J9AA 1Y0RA 4R7MA 2VI7A 4KOSA 1VQLZ 3H0GI 2WPWA 4M6HA 4GM5A 4QUSA 1IIDA 2JDDA 2EK8A 2R1IA 1YW4A 4A38A 1IICA 2ZEGA 1Q2DA 2YNCA 1X3ZA 3TE5B 2QMLA 2POKA 2DE6A 1Y8CA 4F6AA 2KCWA 5KTCA 4M3SA 4OC2A 3SXOA 1M1DA 1VQ91 5LYIA 3ISXA 4NBFA 2P3YA 4B13A 1VQ41 1I12A 4NBHA 2V8HA 3BI0A 1KC81 1X3WA 4JD6A 2Q43A 3B3WA 3KR5A 1VQ4Z 1QQ9A 1EE3P 2ODFA 3RO0A 1JWQA 4FAIA 1K8A1 1Q16A 4MHNA 3LUSA 4F0XA 2R93I 2QIRA 3IEHA 3SJXA 3HOZI 4Q36A 2DPTA 2REEA 2R98A 4FD5A 2CNMA 1YJN1 5FLXf 1CX8A 3EC4A 1Z4RA 4ZX8A 1MJAA 1P4NA 4CGNA 1X0TA 5CM2M 2CTBA 5KTAA 1K731 1ELLP 2VUGA 1YJNZ 4NGTA 4OMEA 1VQNZ 5HVGA 3S15I 4P4JA 1XMBA 2VBQA 2E2HI 2Q51A 3CXCZ 1SFOI 3GTQI 1KRLA 3IF8A 2GANA 1KQSY 4BMHA 1S7LA 5LYFA 3FIXA 3HOYI 5I0CA 1WW9A 4MJ8A 3D67A 4OIDA 3VTNA 1M4IA 1KD12 3H3VJ 3HKZA 1S7MA 4RV9A 1L1OC 4M85A 5HH1A 1HDUA 3PB4X 4HKFA 2EGTA 1JJ2Z 4HNWB 1AA6A 1ZG7A 1RLYA 4JZ0A 2DPSA 5HVFA 1VKCA 4KSIA 1ZB8A 3D7GA 4A2ZA 2PVVA 2Z3LA 2R7HA 1PFTA 1NMTA 1Z01A 3I3GA 1WJ2A 2NYQA 3R9FA 4ZY1A 1YLOA 1NJI1 2QR1B 2QA41 1IGBA 1XRYA 2X7BA 1GHEA 3FRMA 2GLJA 3LACA 1Y0YA 5D29A 2HU9A 2V8KA 4KOWA 4MD9A 3TDHB 2WZNA 2FIAA 1TWCI 4NSQA 3J81b 3CPWY 2AJ6A 3HUVA 4A3LI 3FQMA 4A3MI 3CT9A 4H6UA 4XNHB 3EFAA 4L89A 3CCM1 4MHDA 4X8IA 4E30A 3IIBA 3SJGA 1TF9A 3QAHA 4ZGYB 2AFZA 1ZH1A 2GIVA 2R92I 3DR8A 3RBUA 1ZB9A 1IU8A 1S5KA 4NB9A 2OB0A 2CXAA 2ZEFA 5C44I 4IF5A 3KQXA 3EO4A 4QB9A 2IJZA 4GXHA 2QVPA 2ZELA 3SI0A 3NFZA 3SXNA 1JQGA 4JXQA 1VHEA 3MGDA 4A37A 2IZ4A 2FIWA 4R3KA 3GTGI 4KUAA 4KVOE 1R3NA 3K2KA 5LRKA 1Q7Y2 4PXEA 4C2XA 5JM6A 5IT9f 5IP9I 2WSAA 2QJ8A 3M4OI 5EBVA 1BO4A 2C27A 2DXQA 3I9SA 4E2WA 2FSRA 4BD9A 4MFQA 4Y49C 3S1NI 3F3FC 2Q4YA 4A94A 2QLVB 2Q44A 1VQKZ 3IR7A 2R7ZI 2AYDA 2Z3KA 4UWJA 1M902 1S7KA 1YSJA 1PUAA 1QXFA 5IV0A 1TIQA 4UEZA 4JLYA 2Q0YA 1TFIA 2ZXVA 1B87A 4H6ZA 1KC82 3RAMA 1IYKA 4C2YA 3R95A 1W2BY 5A28A 4A3FI 1PU9A 3DSBA 3KASA 1QF8A 4NGPA 4M6IA 1YUAA 4PSWA 1YHQ1 4MHZA 3VARA 2JA6I 5FVJA 4DGLA 4WJBA 5F09A 2R6MA 4PSXA 1XEBA 3RNZA 4CAWA 3C26A 4IHMA 2NAPA 3CCS1 1Z2LA 4PK2A 2XEJA 3H8FA 3EERA 2JIMA 3GTOI 3QWUA 2J8RA 2NVTI 3CD6Z 1MK4A 4EWTA 2AFWA 2V77A 2PDOA 4F9VA 3CC7Z 3KGQA 3CCSZ 1CM0A 3PO3S 2ZOGA 2VL1A 2HC9A 2ZEDA 3EEDA 4P4EA 1XFOA 3S2DI 2KPIA 2IMOA 4P44A 4IAVA 4KORA 3GCFA 4BY1I 4MD8A 4RVDA 3PB7X 5D8NA 4HPSA 4K30A 3BJ8A 5AN9F 3GY9A 2HQYA 2B4DB 1BLLE 1USPA 3W6SA 2VPWA 2FL4A 3IGRA 4AYBA 2PJ0A 4CL1A 2Q04A 3SI2A 4NGNA 3CCR1 2H5MA 2ZEHA 1I6HI 3WABA 2K3RA 1Y1VS 5H86A 3CCE1 1KUXA 4AVCA 3KHZA 1NJI2 3CCRZ 3NH4A 3L2NA 3OW2Z 4FD4A 2O28A 1YGHA 1Q811 2IZ3A 3HOUI 5G1ZA 4EWCA 2OOTA 1H8LA 3I551 3ZZIA 1Z4EA 3SI1A 4DJLA 3CCEZ 4KSAA 3FYNA 1RO4A 2H85A 2YGWA 2PJ3A 4XPKA 3GTJI 2GTHA 4F0YA 3TX8A 2V45A 1I1DA 3PRTA 4IUSA 2FXFA 3I55Z 3CXSA 4UF4A 3FX6A 2JIRA 4DQYB 1TKJA 3I4MI 2Z3NA 5K8MA 1Z8XA 4EFDA 1Z8TA 4ONWA 1RXTA 3BG1B 1CPSA 1ZG9A 1JWHC 3GIUA 2OTLZ 4C7HA 3S9LA 4A31A 3MRUA 1Q822 4A3BI 2JBJA 2E2II 1VQL1 2PRBA 1Q2CA 3ISZA 1N2FA 1S7FA 1YK3A 5E96A 2V8VA 2QECA 3H5ZA 2JMOA 2PIYA 3GTPI 5DWNA 3P2HA 1I21A 5HVHA 2FCKA 3JTKA 2JLMA 3S16I 4IK2A 2B63I 2PJ8A 2ZENA 4PXDA 5EMIA 2ABZA 2HV2A 1FDIA 4ZY2A 4Y49B 3IWGA 4A93I 1XOVA 3FVLA 2BOAA 3GTMS 4FD6A 4A3CI 3OW2Y 4OC3A 2RHBA 1GYTA 4KOTA 4KVXA 4B12A 1VQ51 4A32A 2Z3PA 3K7AI 3PFOA 4II9A 5T67A 1X10A 2VPXA 1S60A 4E2YA 5JQ4A 4QTTA 3WC6A 3D6WA 2OZGA 2BJOA 3FJUA 1LFWA 1VQ5Z 2W03A 2PCUA 1VQ61 1TWAI 4MFJA 4UIAA 5C3EI 4MFKA 3A9LA 2JBKA 2OH1A 3IC1A 3NH8A 1ARMA 2GREA 4YU9A 4E8OA 3IO1A 2A4NA 2PJ2A 2ZAEB 5D1PA 1M1K2 1AMPA 1PCAA 2CNSA 2Z11A 4UFXA 6CPAA 1VQ6Z 3IU1A 3NDJA 1FDOA 3MZKB 3Q87A 1Y1VI 4MCSA 4KOVA 1VQN1 3EXNA 4NJRA 2FVGA 2BUEA 1YIJ1 3IX0A 1B6BA 3D2MA 1CP7A 5LRJA 2CIJA 4X6AI 1WK4A 2PJ5A 2I3CA 4AXVA 2VPZA 3B7IA 3DDDA 4FUUA 1I50I 1YIJZ 2BO9A 2NVYI 4E2AA 3QAYA 3G711 1ON0A 3TOBA 2ZEOA 3H4QA 3KR4A 5A27A 3IWEA 3S17I 1N8R1 4RVGA 4BINA 3SJFA 4B14A 4A39A 4MY0A 4U5YA 2ZEPA 4Z65A 2QKDA 1TF8A 3FQQA 4MHYA 3G71Z 2IL4A 2VZYA 2PRQA 3MN8A 1LRZA 2XEGA 4MY3A 4HH4A 3T4NB 1S3ZA 4RS2A 1Q7LA 3NE7A 3BXMA 2PE3A 2GFQA 1XE4A 2ZW7A 2OOYB 2VUMI 2VF1A 4TNUA 2E9HA 4OC0A 3ESWA 3D3SA 4QBJA 2IV2X 1A2ZA 2O4HA 4WWVA 1F57A 4GS4A 1OBRA 3T8WA 1YVOA 1CPXA 4NH1C 2RBLA 4OLLA 1Z8LA 3T9YA 1QSRA 5J1QA 4XX2A 3PGPA 4C7IA 2C6GA 3P5JB 4UWIA 2P6EA 4UCNA 2B5GB 4A95A 2PJ7A 2KI7B 3MZLB 4NCZA 4ZYQA 4E33A 2ZW4A 3S6KA 5JH9A 3GTMI 2EBJA 5C82A 5J8FA 3WR7A 1TWFI 4HGZA 3T90A 4I49A 2PR1A 1OZPA 3PO2I 1KZFA 4CAFA 4OAEA 4CYNA 4RVHA 4UEFA 2YADA 1K9M2 3KHXA 3CXCY 1YREA 2VEZA 5T6BA 1QVFZ 5FLXb 3TO7A 4KVME 3EY5A 1V0CA 3CZXA 1K83I 5CPAA 4KUBA 2OU2A 1RO0A 4R3LA 1NP6A 2RT9A 4NBBA 4BXXI 1R9TI 4KS9A 5G20A 3TCVA 3CXQA 5LRGA 1VQ81 1JJ2Y 3DR6A 2WAQA 2NMTA 2E7ZA 3BHXA 2ARHA 5D1OB 4J3GA 1IB1E 4C2ZA 2W04A 4A3EI 1QVGZ 4MHPA 5CBMA 1DL6A 4CRYB 3D66A 3I561 3TT2A 1VQ8Z 1VQK1 4KLVA 1VQ7Z 3DLJA 2YNDA 1MJ9A 3VMIA 1P0HA 3R9GA 1RQFA 3KKWA 3I56Z 2AE6A 5CNPA 2Q4ZA 2VPYA 2GLFA 4L8AA 4PK3A 4EMEA 5C4XI 3KZWA 4B6ZA 2Z0ZA 4B5PB 2JIOA 5F46A 3JAMf 3S2HI 2FE7A 3GYAA 2J8MA 4KOXA 1AUGA 1XJOA 2IQ6A 5AGEA 2EO8A 5AG6A 4OP4A 2Z3OA 1CBXA 1QSMA 5IX3A 1IOIA 4R9MA 4MCPA 3SJEA 3CC41 1K8A2 4CGPA 1YMEA 1YJ9Z 2QRCB 2JA5I 4PV6A 4NXYA 3CD61 2JIQA 3TTHA 2ZPAA 3CC71 2OTJ1 1VHOA 2V8GA 2EK9A 2JA8I 2CF4A 3CXPA 4OC1A 5EC4A 3CC4Z 5C4JI 1NSLA 1Y9KA 1QYPA 4NJQA 5DWMA 4PXBA 4UCPA 4U9ZA 2OTJZ 2RIQA 4Y52I 4DK1A 3KI9A 1K732 3PB6X 3S6HA 2G2KA 2AKLA 4P4BA 2VXKA 1XIXA 2YNCC 5G22A 5GCNA 1KUVA 2XEFA 1CP6A 4CYQA 2E2JI 4NF1A 2D4PA 1UWYA 4HGYA 3DGVA 4KLWA 3BLNA 2AFUA 5AG5A 1QSNA 1VIXA 3CCUZ 1ARLA 3FBUA 1DTDA 1Z8WA 3NH5A 1LAPA 3V38A 2EVNA 5IT9b 1BAVA 4MRIA 4AB7A 4P4IA 4NBEA 3CCLZ 4NBGA 2PC1A 2PVWA 5THWA 3D68A 3TC8A 3V7ZA 4CAVA 3J80b 5A2Qb 1YI2Z 4QVTA 1Q861 1YR0A 5K8OA 4MCQA 3FEEA 4OIWA 2VQYA 3OWCA 2AFSA 3PB9X 4YFJA 3F0AA 2Y0SA 2M48A 2ZW6A 1TKHA 4LUAA 3S9MA 2G9DA 2DF5A 2F7VA 3K9UA 1YX0A 5F48A 4E0AA 2DEAA 4AG7A 4YWYA 4UFWA 2J6AA 1K4JA 2OTL1 2AFOA 3TE4A 3V8IA 3B8GA 1VLAA 1ZO0A 3ZJ0A 3KIFA 1XMTA 4ZX9A 3LWUA 4OC4A 3R96A 3GB0A 2B3VA 2HF1A 3RYOA 2AFXA 1YQEA 3BG0B 2F4OA 1R43A 2ZEMA 2K5RA 1LOKA 1YVKA 4FD7A 4Y7NI 4CYPA 2PJ6A 3P2FA 4RI1A 2P6GA 1M4GA 4NBCA 3IWWA 1RO5A 3F8KA 2F8HA 4LQGA 2V8IA 3B3VA 4MFZA 4W9YA 2DE7A 3B3CA 2OZKA 4UEEA 5C88A 1Q7Y1 2OR4A 3PBBA 2EUIA 1WWZA 5K8NA 3VH9A 2PM9A 1U6MA 1M4DA 3LD2A 4TWEA 1XF8A 2D4OA 1YJWZ 1AYEA 4ZBGA 1NSAA 4KSFA 1KQSZ 3R1KA 3PO3I 3IJ3A 4BBRI 3DNSA 4CS0B 3IU2A 1KWMA 3VWDA 3FMCA 4B5OA 4YGOA 1ZLIA 3NDIA 1QSTA 3D7DA 4RVFA 4BBSI 4R6TA 3M3YI 4R57A 3JVNA 1QSOA 2PJ9A 1M901 3J81f 1Q2YA 4KZTA 4Q38A 2G3AA 1CJWA 1HEEA 3TOAA 3VMHA 2RPRA 1NE9A 1VQ9Z 4UIBA 5HXDA 5BWAB 4X2TA 2Q7SA 1VGYA 4HNYB 1VQO1 2JUBA 1LQLA 4QTUA 5I4MA 4PPZA 2JIPA 3KQZA 4BBHA 2NSMA 1N71A 3PB8X 4YRHA 3GLJA 4CAXA 3S14I 1YIT1 4EVYA 5G21A 3N7ZA 3CPWZ 2NVQI 1VQOZ 5LYDA 5KTDA 3VMGA 3S1MI 3WC7A 2JEWA 8CPAA 1Y1WI 3GKQA 1YITZ 3UY5A 4E2XA 2PJ4A 4DNCA 4P4DA 4NGSA 2B5GA 3CPAA 3G8WA 3PZJA 3CDXA 2CNTA 4R87A 2I00A 2JR6A 4JXRA 4E2ZA 2PIZA 4MCRA 4MFLA 4B10A 2ANPA 4H2KA 1Z03A 2VZZA 4CPAA 3R9EA 2K5TA 1IOFA 5F49A 1ZG8A 4U9YA 2C6CA 1MJBA 3J7A4 2QYVA 4FWUA 3RZOI 2PK7A 2F4MA 2OZUA 2R8VA 3KL9A 4A3II 2GTIA 1I3QI 5H84A 1F2PA 4P10A 4O23A 2Q4VA 2C6PA 1ZLHA 4ZI6A 2PJ1A 5JPHA 1Q862 2FT0A 4RN7A 4XPDB 4AVBA 2ZOFA 2WYRA 4K3NA 2C1CA 3CPXA 1S7NA 3VWEA 3G6E1 4CRZB 5ISVA 1Q812 2F5IA 3FB3A 5D1OA 1L0CA 3HOWI 2JS4A 3CC21 2PQ8A 3N5FA 4BY7I 3E0KA 3G6EZ 1FY7A 3S6GA 4NGRA 1M4LA 4JJXA 1RNIA 2RFHA 4F9UA 1VQP1 4Q7AA 3CQZI 2RB7A 3LODA 2QA4Z 3CC2Z 3FKII 4NB8A 5K8PA 4KOYA 1RTQA 3VB9A 3FF3A 4QC6A 7CPAA 2O53A 1IY7A 1VQPZ 5JGFA 2Z3MA 1W2BZ 4B5PA 2V3VA 3WT4A 1R57A 2M6NA 5LL6f 5AG4A 4ZY0A 4R76A 3W6XA 2JEVA 2QREB 3RZDI 2XEIA 3CCMZ 3I1UA 2CY2A 3BJ7A 1LANA 1Q821 4F8ZA 3D2LA 3D8PA 2FS5A 4MFPA 3I07A 3H8EA 4MH4A 3TFYA 3FNCA 3CMA1 4S1TA 5IP7I 3H8GA 1HDQA 4G1PA 3FEDA 2B4BA 2BEIA 1VQ71 4NGQA 1NUIA 4R8FA 3FECA 3WC5A 4JWPA 5T64A 3CMAZ 4FBEA 2P0WA 4DYOA 4MI4A 3B2YA
chains in the Genus database with same CATH topology
5HVHA 1PYTB 1DTDA 4OC5A 3VTNA 3NH5A 1KD12 3H3VJ 3S16I 1LAPA 4IK2A 2B63I 2PJ8A 3HKZA 1S7MA 2ZENA 4RV9A 3V38A 1L1OC 4PXDA 5IT9b 2ABZA 1BAVA 4MRIA 1HDUA 3PB4X 3HLPA 3LMSA 2EGTA 4ZY2A 1WIIA 1JJ2Z 4P4IA 4NBEA 4A93I 2P28A 1ZG7A 3CCLZ 4NBGA 1RLYA 2PVWA 3FVLA 4JZ0A 3J80f 5THWA 5A2Qf 5HVFA 4KSIA 1ZB8A 2BOAA 3D68A 3D7GA 3PBEA 3TC8A 3V7ZA 2PVVA 1TWGI 3J80b 3GTMS 5A2Qb 1YI2Z 4A3CI 3OW2Y 4OC3A 2RHBA 1PFTA 1Q861 2V8DA 1P9NA 4A3JI 4PQAA 3D4UA 1Z01A 1GYTA 2ZEEA 4PXCA 2NYQA 4A3KI 2PMZA 5K8OA 4MCQA 3FEEA 1VQ51 4ZY1A 1YLOA 1NJI1 1Z02A 2PJBA 2QR1B 4OIWA 2QA41 1IGBA 1XRYA 3K7AI 2AFSA 1LCPA 3PFOA 3PB9X 5T67A 4A3DI 1YJ91 2GLJA 3FH4A 4E2YA 2Y0SA 1Y0YA 2M48A 4QTTA 1TKHA 3WC6A 3D6WA 3S9MA 2BJOA 2G9DA 3VATA 5D29A 2F7VA 2HU9A 2V8KA 4MD9A 3FJUA 1LFWA 1VQ5Z 3TDHB 2WZNA 4MMOA 1TWCI 2W03A 3J81b 3CPWY 1VQ61 2DEAA 2PCUA 3HUVA 3G4S1 1TWAI 3KIHA 1Z5RA 4UIAA 1TKFA 5C3EI 3JRUA 4A3LI 3GTLI 1LAMA 2QRDB 3FQMA 2WB1A 4A3MI 4NBDA 3CT9A 2JBKA 4YWYA 4P4FA 3IC1A 3NH8A 1ARMA 2GREA 4YU9A 3IO1A 2PJ2A 2ZAEB 5D1PA 1BPMA 2J6AA 2OTL1 1M1K2 2AFOA 3D9XA 3CCM1 1AMPA 1PCAA 1M1K1 6CPAA 1VQ6Z 3NDJA 3G4SZ 2LIYA 1QVFY 2CTCA 1VLAA 3MZKB 3PFEA 4X8IA 3Q87A 4NFRA 1Y1VI 4E30A 4MONA 1Y7EA 4MCSA 3IIBA 3SJGA 1TF9A 1VQN1 2AFZA 3KIFA 4NJRA 2FVGA 1ZH1A 3S9NA 2YU9I 2V8JA 4ZX9A 1YIJ1 3IX0A 3LWUA 4OC4A 2R92I 3RBUA 2HB6A 1ZB9A 5LRJA 1CP7A 2CIJA 3GB0A 4RUHA 4NB9A 4NGMA 1FT7A 4X6AI 2HF1A 1CG2A 2PJ5A 2AFXA 2I3CA 4AXVA 4A3GI 3BG0B 1YHQZ 2F4OA 3B7IA 1R43A 2ZEMA 2ZEFA 4FUUA 2QEX1 1I50I 5C44I 3CCU1 3KQXA 2K5RA 1LOKA 1YIJZ 3CCJ1 2BO9A 2IJZA 2LFUA 2QVPA 2NVYI 2ZELA 4Y7NI 3SI0A 4OKOA 2PJ6A 1QVGY 3NFZA 3S1QI 3G711 3U50C 1JQGA 4DUKA 1VHEA 2ZEOA 4NBCA 3KR4A 1N8R2 4A37A 2GU2A 1QMUA 3S17I 3IWWA 2IZ4A 1N8R1 2F8HA 4RVGA 3GTGI 2QEXZ 1S721 4LQGA 3SJFA 2V8IA 3CCV1 3B3VA 4A39A 2PJAA 4W9YA 2DE7A 2ZEPA 1R3NA 3B3CA 3CCL1 3CCJZ 3K2KA 3D7HA 5LRKA 2OZKA 1Q7Y2 1F2OA 4UEEA 4PXEA 3BI1A 1Q7Y1 3I4NI 2QKDA 2OR4A 4Z65A 3PBBA 5JM6A 1TF8A 3FQQA 4MHYA 3K9TA 3G71Z 1YI21 5IT9f 4RS4A 5IP9I 1KD11 2PRQA 3MN8A 2XEGA 5K8NA 3VH9A 2QJ8A 2PM9A 3M4OI 1S72Z 4TWEA 4HH4A 2NVXI 3T4NB 3CCVZ 1DE4C 3GUXA 1YJWZ 1AYEA 1NSAA 1Q7LA 1KQSZ 4E31A 4X3RA 3BXMA 4E2WA 2PE3A 3PO3I 3PEIA 2OOYB 4BD9A 2VUMI 3IJ3A 2JA7I 2VF1A 4BBRI 4TNUA 3S1NI 3D7FA 2E9HA 4E32A 3F3FC 4OC0A 3ESWA 1KWMA 2O4HA 3NA6A 4JYWA 1YW6A 4A94A 4WWVA 1F57A 2EWBA 3FMCA 2QLVB 2PJCA 1OBRA 3T8WA 1VQKZ 1CPXA 1ZLIA 3NDIA 2OOXB 3HOXI 4NH1C 2R7ZI 3D7DA 4RVFA 2RBLA 1XBUA 4BBSI 4R6TA 1Z8LA 1M902 4MXUA 3M3YI 2PJ9A 1YSJA 1M901 3J81f 2DE5A 5J1QA 4UEZA 4XX2A 3B3SA 2C6GA 3P5JB 1TXRA 4P6YA 1TFIA 3JAMb 3F3PC 1KC82 3RAMA 1HEEA 3VMHA 2RPRA 1VQ9Z 5FLMI 3S1RI 4UIBA 5HXDA 4NBAA 4X2TA 1W2BY 1VGYA 4P45A 4A3FI 2PJ7A 2KI7B 3MZLB 4MD7A 1VQO1 4ZYQA 3GTKI 3HOVI 2JUBA 4E33A 1LQLA 3KASA 1ML8A 3RZAA 1TWHI 1QF8A 3MONA 4QTUA 4NGPA 5I4MA 5JH9A 3B35A 4PPZA 3KQZA 2NSMA 3GTMI 1YUAA 3PB8X 1YHQ1 4MHZA 3GLJA 3S14I 1YIT1 3VARA 2JA6I 4DGLA 4WJBA 5F09A 2AFMA 3CPWZ 1TWFI 2R6MA 2NVQI 4HGZA 1VQOZ 5LYDA 3IFEA 3CME1 1YUKA 4IHMA 4NOZA 3IFUA 3PO2I 1FNOA 3VMGA 3CCS1 3S1MI 5DS0A 3WC7A 5IB9A 3CCQ1 2JEWA 3QNVA 1Z2LA 4RVHA 1VQM1 2BCOA 8CPAA 4UEFA 2YADA 1K9M2 2XEJA 3H8FA 1Y1WI 3EERA 3GKQA 1K9M1 3KHXA 1YITZ 1ELMP 5ELYA 3GTOI 3CXCY 4E2XA 3QWUA 2JNYA 2NVTI 1USPB 3CD6Z 2PJ4A 5T6BA 3B3TA 4EWTA 1QVFZ 5FLXb 2AFWA 2V77A 4P4DA 3CMEZ 4F9VA 4NGSA 3CC7Z 3KGQA 3CPAA 3CCSZ 1K83I 3CCQZ 3PO3S 5CPAA 1RO2A 1WCMI 1VQMZ 5LYLA 2ZOGA 3CDXA 2VL1A 1RO0A 2HC9A 2ZEDA 3EEDA 1NP6A 2RT9A 4NBBA 1XFOA 4P4EA 4BXXI 3S2DI 2KPIA 1R9TI 2IMOA 4P44A 4IAVA 1YJW1 3GCFA 1BPNA 4BY1I 4MD8A 4RVDA 3PB7X 2JR6A 1VQ81 5LRGA 1JJ2Y 5D8NA 2J9AA 4E2ZA 2WAQA 2PIZA 1Y0RA 4MCRA 4R7MA 3BHXA 1VQLZ 3H0GI 5D1OB 5AN9F 2ANPA 4H2KA 4GM5A 1Z03A 4CPAA 2W04A 4A3EI 1QVGZ 4MHPA 2EK8A 1BLLE 5CBMA 1ZG8A 1DL6A 2C6CA 3D66A 1YW4A 3I561 3J7A4 1VQ8Z 2QYVA 4A38A 4FWUA 2ZEGA 1VQK1 3RZOI 1USPA 2PK7A 1VQ7Z 3DLJA 2F4MA 1X3ZA 3KL9A 4A3II 2GTIA 3TE5B 1I3QI 3VMIA 4AYBA 2POKA 2DE6A 2PJ0A 4CL1A 3SI2A 1F2PA 4P10A 4NGNA 3CCR1 4O23A 4OC2A 2C6PA 1RQFA 3I56Z 1ZLHA 2ZEHA 4ZI6A 2PJ1A 1I6HI 3WABA 2K3RA 2Q4ZA 1VQ91 1Q862 2GLFA 1Y1VS 5LYIA 4EMEA 5C4XI 3KZWA 2ZOFA 2WYRA 4K3NA 2C1CA 3CPXA 4B6ZA 3CCE1 3G6E1 3ISXA 4NBFA 3KHZA 1NJI2 3JAMf 2P3YA 3CCRZ 3S2HI 3NH4A 3OW2Z 1Q812 3L2NA 5D1OA 1VQ41 4NBHA 2V8HA 1Q811 2IZ3A 3HOUI 3HOWI 3BI0A 4EWCA 2JS4A 3CC21 1KC81 3N5FA 1XJOA 2OOTA 4BY7I 1H8LA 1X3WA 2IQ6A 3I551 3SI1A 4OP4A 4DJLA 3G6EZ 3CCEZ 1CBXA 2Q43A 3B3WA 4NGRA 1RO4A 1M4LA 2H85A 1RNIA 2RFHA 2PJ3A 3KR5A 4F9UA 3GTJI 2GTHA 1VQP1 4Q7AA 1VQ4Z 3TX8A 3CQZI 1QQ9A 1EE3P 2QA4Z 2RB7A 4MCPA 3PRTA 3SJEA 3CC2Z 3CC41 1K8A2 1YMEA 1YJ9Z 2QRCB 3FKII 4NB8A 3I55Z 1K8A1 2JA5I 4MHNA 4FAIA 5K8PA 4UF4A 3FX6A 3CD61 1RTQA 3VB9A 3LUSA 4DQYB 3FF3A 1TKJA 7CPAA 2O53A 3CC71 2OTJ1 3I4MI 2R93I 1IY7A 1VQPZ 1VHOA 3IEHA 5JGFA 2V8GA 5K8MA 3SJXA 3HOZI 2EK9A 2JA8I 1W2BZ 2CF4A 4OC1A 3WT4A 2M6NA 3CC4Z 5C4JI 5LL6f 1YJN1 5FLXf 1CX8A 4EFDA 1QYPA 4ONWA 4ZY0A 4NJQA 4R76A 4PXBA 3BG1B 1CPSA 4ZX8A 2QREB 3RZDI 1ZG9A 1JWHC 2XEIA 2OTLZ 3S9LA 1X0TA 2OTJZ 2RIQA 3CCMZ 3I1UA 5CM2M 3MRUA 1Q822 4A3BI 2CTBA 4Y52I 4DK1A 3KI9A 1K732 1LANA 3PB6X 1Q821 2G2KA 2JBJA 2AKLA 1K731 2E2II 1ELLP 1VQL1 4F8ZA 2VUGA 4P4BA 1YJNZ 3I07A 3H8EA 4NGTA 4MH4A 4OMEA 1VQNZ 2XEFA 5HVGA 3CMA1 3ISZA 4S1TA 5IP7I 1CP6A 1N2FA 3H8GA 3S15I 1HDQA 4P4JA 1XMBA 4G1PA 2E2JI 3FEDA 2E2HI 2Q51A 3CXCZ 1UWYA 1SFOI 1VQ71 4HGYA 1KRLA 3IF8A 3GTQI 1KQSY 2V8VA 1NUIA 3DGVA 4NGQA 4R8FA 2AFUA 3FECA 2JMOA 3WC5A 2PIYA 5LYFA 5T64A 3CMAZ 1VIXA 4FBEA 3HOYI 3GTPI 3CCUZ 1ARLA 4DYOA 1WW9A 3D67A 4OIDA 3B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HVH A;  1PYT B;  1DTD A;  4OC5 A;  3NH5 A;  1LAP A;  4IK2 A;  2PJ8 A;  2ZEN A;  3V38 A;  4PXD A;  2ABZ A;  1BAV A;  4MRI A;  1HDU A;  3PB4 X;  3HLP A;  3LMS A;  4ZY2 A;  4P4I A;  1ZG7 A;  2PVW A;  3FVL A;  4JZ0 A;  5THW A;  5HVF A;  4KSI A;  2BOA A;  3D68 A;  3D7G A;  3PBE A;  3TC8 A;  3V7Z A;  2PVV A;  4OC3 A;  2V8D A;  4PQA A;  3D4U A;  1GYT A;  2ZEE A;  4PXC A;  2NYQ A;  5K8O A;  4MCQ A;  3FEE A;  4ZY1 A;  1YLO A;  2PJB A;  4OIW A;  1IGB A;  1XRY A;  2AFS A;  1LCP A;  3PFO A;  3PB9 X;  2GLJ A;  3FH4 A;  1Y0Y A;  1TKH A;  3WC6 A;  3S9M A;  2G9D A;  3VAT A;  5D29 A;  2F7V A;  3FJU A;  1LFW A;  2WZN A;  4MMO A;  2PCU A;  2DEA A;  3HUV A;  1Z5R A;  4UIA A;  1TKF A;  3JRU A;  1LAM A;  3CT9 A;  2JBK A;  4YWY A;  4P4F A;  3IC1 A;  3NH8 A;  1ARM A;  2GRE A;  4YU9 A;  3IO1 A;  2PJ2 A;  1BPM A;  2AFO A;  1AMP A;  1PCA A;  6CPA A;  2CTC A;  3PFE A;  4X8I A;  4NFR A;  1Y7E A;  4MCS A;  3IIB A;  3SJG A;  1TF9 A;  2AFZ A;  4NJR A;  2FVG A;  3S9N A;  4ZX9 A;  3LWU A;  4OC4 A;  3RBU A;  2HB6 A;  5LRJ A;  1CP7 A;  2CIJ A;  3GB0 A;  4RUH A;  4NGM A;  1FT7 A;  1CG2 A;  2PJ5 A;  2AFX A;  2I3C A;  4AXV A;  3B7I A;  2ZEM A;  1R43 A;  4FUU A;  2ZEF A;  3KQX A;  1LOK A;  2BO9 A;  2IJZ A;  2QVP A;  2ZEL A;  3SI0 A;  4OKO A;  2PJ6 A;  3NFZ A;  1JQG A;  4DUK A;  1VHE A;  2ZEO A;  3KR4 A;  4A37 A;  2GU2 A;  1QMU A;  3IWW A;  2F8H A;  4LQG A;  3SJF A;  4A39 A;  3B3V A;  2PJA A;  4W9Y A;  2ZEP A;  1R3N A;  3B3C A;  3K2K A;  5LRK A;  3D7H A;  1F2O A;  4UEE A;  4PXE A;  3BI1 A;  4Z65 A;  2OR4 A;  3PBB A;  5JM6 A;  1TF8 A;  4MHY A;  3K9T A;  2PRQ A;  3MN8 A;  2XEG A;  5K8N A;  3VH9 A;  2QJ8 A;  4TWE A;  1DE4 C;  3GUX A;  1AYE A;  1NSA A;  1Q7L A;  4X3R A;  3BXM A;  2PE3 A;  3PEI A;  4BD9 A;  3IJ3 A;  4TNU A;  3D7F A;  4OC0 A;  1KWM A;  2O4H A;  3NA6 A;  4JYW A;  1YW6 A;  4A94 A;  4WWV A;  1F57 A;  2EWB A;  3FMC A;  2PJC A;  1OBR A;  3T8W A;  1CPX A;  1ZLI A;  3D7D A;  1XBU A;  4R6T A;  1Z8L A;  4MXU A;  2PJ9 A;  1YSJ A;  5J1Q A;  4UEZ A;  3B3S A;  2C6G A;  1TXR A;  4P6Y A;  3RAM A;  1HEE A;  4UIB A;  5HXD A;  4X2T A;  1VGY A;  4P45 A;  2PJ7 A;  4ZYQ A;  3KAS A;  3RZA A;  4NGP A;  5I4M A;  5JH9 A;  3B35 A;  4PPZ A;  3KQZ A;  2NSM A;  3PB8 X;  4MHZ A;  3GLJ A;  3VAR A;  4WJB A;  5F09 A;  2AFM A;  5LYD A;  3IFE A;  4IHM A;  1FNO A;  5DS0 A;  3WC7 A;  5IB9 A;  2JEW A;  3QNV A;  1Z2L A;  2BCO A;  8CPA A;  4UEF A;  2XEJ A;  3H8F A;  3KHX A;  1ELM P;  5ELY A;  2PJ4 A;  3B3T A;  4EWT A;  2AFW A;  2V77 A;  4P4D A;  4F9V A;  4NGS A;  3KGQ A;  3CPA A;  5CPA A;  5LYL A;  2ZOG A;  3CDX A;  2VL1 A;  2HC9 A;  2ZED A;  4P4E A;  1XFO A;  2IMO A;  4P44 A;  4IAV A;  1BPN A;  3PB7 X;  5LRG A;  5D8N A;  2J9A A;  2PIZ A;  1Y0R A;  4MCR A;  4R7M A;  3BHX A;  2ANP A;  4H2K A;  4GM5 A;  4CPA A;  4MHP A;  2EK8 A;  1BLL E;  5CBM A;  1ZG8 A;  2C6C A;  3D66 A;  1YW4 A;  2QYV A;  4A38 A;  4FWU A;  2ZEG A;  3DLJ A;  3KL9 A;  2POK A;  2PJ0 A;  3SI2 A;  1F2P A;  4P10 A;  4NGN A;  4O23 A;  4OC2 A;  2C6P A;  1ZLH A;  2ZEH A;  4ZI6 A;  2PJ1 A;  3WAB A;  2Q4Z A;  5LYI A;  2GLF A;  4EME A;  3KZW A;  2ZOF A;  2WYR A;  4K3N A;  2C1C A;  3CPX A;  4B6Z A;  3ISX A;  3KHZ A;  3NH4 A;  3L2N A;  2V8H A;  3BI0 A;  3N5F A;  1XJO A;  2OOT A;  1H8L A;  2IQ6 A;  3SI1 A;  4OP4 A;  4DJL A;  1CBX A;  2Q43 A;  3B3W A;  4NGR A;  1M4L A;  2RFH A;  2PJ3 A;  3KR5 A;  4F9U A;  4Q7A A;  3TX8 A;  1QQ9 A;  1EE3 P;  2RB7 A;  4MCP A;  3PRT A;  3SJE A;  1YME A;  4FAI A;  4MHN A;  5K8P A;  4UF4 A;  3FX6 A;  1RTQ A;  3FF3 A;  1TKJ A;  7CPA A;  2O53 A;  1IY7 A;  1VHO A;  3IEH A;  5JGF A;  2V8G A;  5K8M A;  3SJX A;  2EK9 A;  2CF4 A;  4OC1 A;  3WT4 A;  1CX8 A;  4EFD A;  4ZY0 A;  4ONW A;  4NJQ A;  4R76 A;  4PXB A;  1CPS A;  4ZX8 A;  1ZG9 A;  2XEI A;  3S9L A;  3I1U A;  3MRU A;  2CTB A;  3KI9 A;  1LAN A;  3PB6 X;  2JBJ A;  1ELL P;  4F8Z A;  4P4B A;  3H8E A;  4NGT A;  4OME A;  2XEF A;  5HVG A;  3ISZ A;  1CP6 A;  3H8G A;  1HDQ A;  4P4J A;  1XMB A;  4G1P A;  3FED A;  2Q51 A;  1UWY A;  3DGV A;  4NGQ A;  2V8V A;  4R8F A;  2AFU A;  3FEC A;  3WC5 A;  2PIY A;  5LYF A;  1VIX A;  4FBE A;  1ARL A;  4DYO A;  3D67 A;  4OID A;  3B2Y A; 
#chains in the Genus database with same CATH topology
 1PYT B;  4OC5 A;  3D2P A;  2J8N A;  4CGL A;  4M6G A;  3HLP A;  3LMS A;  1WII A;  1YLE A;  2P6F A;  2P28 A;  3J80 f;  5A2Q f;  3PBE A;  1TWG I;  2V8D A;  1P9N A;  4A3J I;  3S6F A;  4PQA A;  3D4U A;  1SIW A;  2ZEE A;  4PXC A;  4HNX B;  4A3K I;  2YNE A;  2PMZ A;  1Z02 A;  2PJB A;  1LCP A;  2B4D A;  4A3D I;  1YJ9 1;  3FH4 A;  4UBR A;  3VAT A;  4CYO A;  4MMO A;  3G4S 1;  3KIH A;  1Z5R A;  1TKF A;  3NE8 A;  3JRU A;  3GTL I;  1LAM A;  2QRD B;  2WB1 A;  4NBD A;  1J4J A;  4XPL A;  4P4F A;  2GE3 A;  4NEX A;  1BPM A;  3D9X A;  1M1K 1;  3G4S Z;  1QVF Y;  2LIY A;  2CTC A;  3PFE A;  4NFR A;  2OZH A;  4MON A;  1Y7E A;  3GKR A;  3TO9 A;  3S9N A;  2YU9 I;  2V8J A;  1Y9W A;  2HB6 A;  4RUH A;  4NGM A;  1FT7 A;  3PP9 A;  1CG2 A;  1X12 A;  4A3G I;  1YHQ Z;  2QEX 1;  2G3T A;  3CCU 1;  3CCJ 1;  4KOU A;  2G0B A;  2LFU A;  4OKO A;  4B11 A;  1QVG Y;  3S1Q I;  5AG7 A;  3U50 C;  4DUK A;  3FXT A;  2LEX A;  1N8R 2;  2GU2 A;  1QMU A;  1VHS A;  2QEX Z;  1S72 1;  2RC4 A;  4A33 A;  3CCV 1;  2PJA A;  3CCL 1;  3CCJ Z;  3D7H A;  1F2O A;  3TO6 A;  3BI1 A;  3I4N I;  1WZN A;  3K9T A;  1YI2 1;  4H89 A;  4RS4 A;  3SHP A;  4AVA A;  1KD1 1;  1S72 Z;  2NVX I;  3CCV Z;  3QB8 A;  1DE4 C;  3GUX A;  3JUW A;  3G3S A;  4LX9 A;  4E31 A;  4X3R A;  3PEI A;  4UFV A;  4AG9 A;  2JA7 I;  1UFH A;  2ZW5 A;  3D7F A;  4E32 A;  4CGM A;  3NA6 A;  4JYW A;  1YW6 A;  2EWB A;  4XPD C;  2REF A;  2PJC A;  5IB0 A;  2OOX B;  3HOX I;  3F5B A;  1XBU A;  1BOB A;  3W91 A;  4MXU A;  1Z9U A;  2DE5 A;  4UA3 A;  2PR8 A;  4CAE A;  4X5K A;  3B3S A;  2I79 A;  1TXR A;  4P6Y A;  3JAM b;  3F3P C;  5FLM I;  3S1R I;  4A30 A;  2PSW A;  2Y0M A;  4NBA A;  4P45 A;  4MD7 A;  3GTK I;  2WUU A;  3HOV I;  1ML8 A;  3RZA A;  1TWH I;  3MON A;  4XNH C;  3B35 A;  5J8C A;  2BL1 A;  1IYL A;  2AFM A;  3IFE A;  3CME 1;  1YUK A;  4C68 A;  1KUY A;  4NOZ A;  3IFU A;  1FNO A;  1SQH A;  5DS0 A;  5IB9 A;  5F47 A;  3CCQ 1;  4LQ6 A;  3QNV A;  2BCO A;  1VQM 1;  4ONU A;  2Q7B A;  4UCM A;  1K9M 1;  1Y7R A;  1ELM P;  5ELY A;  2ATR A;  2JNY A;  1USP B;  4CGO A;  2HUZ A;  3B3T A;  5HMN A;  2JDC A;  2WPX A;  2Z10 A;  3CME Z;  2BSW A;  4ORF A;  1M44 A;  2B3U A;  3CCQ Z;  1RO2 A;  1WCM I;  1VQM Z;  5LYL A;  4OAD A;  2B58 A;  1YJW 1;  1BPN A;  4MBU A;  2J9A A;  1Y0R A;  4R7M A;  2VI7 A;  4KOS A;  1VQL Z;  3H0G I;  2WPW A;  4M6H A;  4GM5 A;  4QUS A;  1IID A;  2JDD A;  2EK8 A;  2R1I A;  1YW4 A;  4A38 A;  1IIC A;  2ZEG A;  1Q2D A;  2YNC A;  1X3Z A;  3TE5 B;  2QML A;  2POK A;  2DE6 A;  1Y8C A;  4F6A A;  2KCW A;  5KTC A;  4M3S A;  4OC2 A;  3SXO A;  1M1D A;  1VQ9 1;  5LYI A;  3ISX A;  4NBF A;  2P3Y A;  4B13 A;  1VQ4 1;  1I12 A;  4NBH A;  2V8H A;  3BI0 A;  1KC8 1;  1X3W A;  4JD6 A;  2Q43 A;  3B3W A;  3KR5 A;  1VQ4 Z;  1QQ9 A;  1EE3 P;  2ODF A;  3RO0 A;  1JWQ A;  4FAI A;  1K8A 1;  1Q16 A;  4MHN A;  3LUS A;  4F0X A;  2R93 I;  2QIR A;  3IEH A;  3SJX A;  3HOZ I;  4Q36 A;  2DPT A;  2REE A;  2R98 A;  4FD5 A;  2CNM A;  1YJN 1;  5FLX f;  1CX8 A;  3EC4 A;  1Z4R A;  4ZX8 A;  1MJA A;  1P4N A;  4CGN A;  1X0T A;  5CM2 M;  2CTB A;  5KTA A;  1K73 1;  1ELL P;  2VUG A;  1YJN Z;  4NGT A;  4OME A;  1VQN Z;  5HVG A;  3S15 I;  4P4J A;  1XMB A;  2VBQ A;  2E2H I;  2Q51 A;  3CXC Z;  1SFO I;  3GTQ I;  1KRL A;  3IF8 A;  2GAN A;  1KQS Y;  4BMH A;  1S7L A;  5LYF A;  3FIX A;  3HOY I;  5I0C A;  1WW9 A;  4MJ8 A;  3D67 A;  4OID A;  3VTN A;  1M4I A;  1KD1 2;  3H3V J;  3HKZ A;  1S7M A;  4RV9 A;  1L1O C;  4M85 A;  5HH1 A;  1HDU A;  3PB4 X;  4HKF A;  2EGT A;  1JJ2 Z;  4HNW B;  1AA6 A;  1ZG7 A;  1RLY A;  4JZ0 A;  2DPS A;  5HVF A;  1VKC A;  4KSI A;  1ZB8 A;  3D7G A;  4A2Z A;  2PVV A;  2Z3L A;  2R7H A;  1PFT A;  1NMT A;  1Z01 A;  3I3G A;  1WJ2 A;  2NYQ A;  3R9F A;  4ZY1 A;  1YLO A;  1NJI 1;  2QR1 B;  2QA4 1;  1IGB A;  1XRY A;  2X7B A;  1GHE A;  3FRM A;  2GLJ A;  3LAC A;  1Y0Y A;  5D29 A;  2HU9 A;  2V8K A;  4KOW A;  4MD9 A;  3TDH B;  2WZN A;  2FIA A;  1TWC I;  4NSQ A;  3J81 b;  3CPW Y;  2AJ6 A;  3HUV A;  4A3L I;  3FQM A;  4A3M I;  3CT9 A;  4H6U A;  4XNH B;  3EFA A;  4L89 A;  3CCM 1;  4MHD A;  4X8I A;  4E30 A;  3IIB A;  3SJG A;  1TF9 A;  3QAH A;  4ZGY B;  2AFZ A;  1ZH1 A;  2GIV A;  2R92 I;  3DR8 A;  3RBU A;  1ZB9 A;  1IU8 A;  1S5K A;  4NB9 A;  2OB0 A;  2CXA A;  2ZEF A;  5C44 I;  4IF5 A;  3KQX A;  3EO4 A;  4QB9 A;  2IJZ A;  4GXH A;  2QVP A;  2ZEL A;  3SI0 A;  3NFZ A;  3SXN A;  1JQG A;  4JXQ A;  1VHE A;  3MGD A;  4A37 A;  2IZ4 A;  2FIW A;  4R3K A;  3GTG I;  4KUA A;  4KVO E;  1R3N A;  3K2K A;  5LRK A;  1Q7Y 2;  4PXE A;  4C2X A;  5JM6 A;  5IT9 f;  5IP9 I;  2WSA A;  2QJ8 A;  3M4O I;  5EBV A;  1BO4 A;  2C27 A;  2DXQ A;  3I9S A;  4E2W A;  2FSR A;  4BD9 A;  4MFQ A;  4Y49 C;  3S1N I;  3F3F C;  2Q4Y A;  4A94 A;  2QLV B;  2Q44 A;  1VQK Z;  3IR7 A;  2R7Z I;  2AYD A;  2Z3K A;  4UWJ A;  1M90 2;  1S7K A;  1YSJ A;  1PUA A;  1QXF A;  5IV0 A;  1TIQ A;  4UEZ A;  4JLY A;  2Q0Y A;  1TFI A;  2ZXV A;  1B87 A;  4H6Z A;  1KC8 2;  3RAM A;  1IYK A;  4C2Y A;  3R95 A;  1W2B Y;  5A28 A;  4A3F I;  1PU9 A;  3DSB A;  3KAS A;  1QF8 A;  4NGP A;  4M6I A;  1YUA A;  4PSW A;  1YHQ 1;  4MHZ A;  3VAR A;  2JA6 I;  5FVJ A;  4DGL A;  4WJB A;  5F09 A;  2R6M A;  4PSX A;  1XEB A;  3RNZ A;  4CAW A;  3C26 A;  4IHM A;  2NAP A;  3CCS 1;  1Z2L A;  4PK2 A;  2XEJ A;  3H8F A;  3EER A;  2JIM A;  3GTO I;  3QWU A;  2J8R A;  2NVT I;  3CD6 Z;  1MK4 A;  4EWT A;  2AFW A;  2V77 A;  2PDO A;  4F9V A;  3CC7 Z;  3KGQ A;  3CCS Z;  1CM0 A;  3PO3 S;  2ZOG A;  2VL1 A;  2HC9 A;  2ZED A;  3EED A;  4P4E A;  1XFO A;  3S2D I;  2KPI A;  2IMO A;  4P44 A;  4IAV A;  4KOR A;  3GCF A;  4BY1 I;  4MD8 A;  4RVD A;  3PB7 X;  5D8N A;  4HPS A;  4K30 A;  3BJ8 A;  5AN9 F;  3GY9 A;  2HQY A;  2B4D B;  1BLL E;  1USP A;  3W6S A;  2VPW A;  2FL4 A;  3IGR A;  4AYB A;  2PJ0 A;  4CL1 A;  2Q04 A;  3SI2 A;  4NGN A;  3CCR 1;  2H5M A;  2ZEH A;  1I6H I;  3WAB A;  2K3R A;  1Y1V S;  5H86 A;  3CCE 1;  1KUX A;  4AVC A;  3KHZ A;  1NJI 2;  3CCR Z;  3NH4 A;  3L2N A;  3OW2 Z;  4FD4 A;  2O28 A;  1YGH A;  1Q81 1;  2IZ3 A;  3HOU I;  5G1Z A;  4EWC A;  2OOT A;  1H8L A;  3I55 1;  3ZZI A;  1Z4E A;  3SI1 A;  4DJL A;  3CCE Z;  4KSA A;  3FYN A;  1RO4 A;  2H85 A;  2YGW A;  2PJ3 A;  4XPK A;  3GTJ I;  2GTH A;  4F0Y A;  3TX8 A;  2V45 A;  1I1D A;  3PRT A;  4IUS A;  2FXF A;  3I55 Z;  3CXS A;  4UF4 A;  3FX6 A;  2JIR A;  4DQY B;  1TKJ A;  3I4M I;  2Z3N A;  5K8M A;  1Z8X A;  4EFD A;  1Z8T A;  4ONW A;  1RXT A;  3BG1 B;  1CPS A;  1ZG9 A;  1JWH C;  3GIU A;  2OTL Z;  4C7H A;  3S9L A;  4A31 A;  3MRU A;  1Q82 2;  4A3B I;  2JBJ A;  2E2I I;  1VQL 1;  2PRB A;  1Q2C A;  3ISZ A;  1N2F A;  1S7F A;  1YK3 A;  5E96 A;  2V8V A;  2QEC A;  3H5Z A;  2JMO A;  2PIY A;  3GTP I;  5DWN A;  3P2H A;  1I21 A;  5HVH A;  2FCK A;  3JTK A;  2JLM A;  3S16 I;  4IK2 A;  2B63 I;  2PJ8 A;  2ZEN A;  4PXD A;  5EMI A;  2ABZ A;  2HV2 A;  1FDI A;  4ZY2 A;  4Y49 B;  3IWG A;  4A93 I;  1XOV A;  3FVL A;  2BOA A;  3GTM S;  4FD6 A;  4A3C I;  3OW2 Y;  4OC3 A;  2RHB A;  1GYT A;  4KOT A;  4KVX A;  4B12 A;  1VQ5 1;  4A32 A;  2Z3P A;  3K7A I;  3PFO A;  4II9 A;  5T67 A;  1X10 A;  2VPX A;  1S60 A;  4E2Y A;  5JQ4 A;  4QTT A;  3WC6 A;  3D6W A;  2OZG A;  2BJO A;  3FJU A;  1LFW A;  1VQ5 Z;  2W03 A;  2PCU A;  1VQ6 1;  1TWA I;  4MFJ A;  4UIA A;  5C3E I;  4MFK A;  3A9L A;  2JBK A;  2OH1 A;  3IC1 A;  3NH8 A;  1ARM A;  2GRE A;  4YU9 A;  4E8O A;  3IO1 A;  2A4N A;  2PJ2 A;  2ZAE B;  5D1P A;  1M1K 2;  1AMP A;  1PCA A;  2CNS A;  2Z11 A;  4UFX A;  6CPA A;  1VQ6 Z;  3IU1 A;  3NDJ A;  1FDO A;  3MZK B;  3Q87 A;  1Y1V I;  4MCS A;  4KOV A;  1VQN 1;  3EXN A;  4NJR A;  2FVG A;  2BUE A;  1YIJ 1;  3IX0 A;  1B6B A;  3D2M A;  1CP7 A;  5LRJ A;  2CIJ A;  4X6A I;  1WK4 A;  2PJ5 A;  2I3C A;  4AXV A;  2VPZ A;  3B7I A;  3DDD A;  4FUU A;  1I50 I;  1YIJ Z;  2BO9 A;  2NVY I;  4E2A A;  3QAY A;  3G71 1;  1ON0 A;  3TOB A;  2ZEO A;  3H4Q A;  3KR4 A;  5A27 A;  3IWE A;  3S17 I;  1N8R 1;  4RVG A;  4BIN A;  3SJF A;  4B14 A;  4A39 A;  4MY0 A;  4U5Y A;  2ZEP A;  4Z65 A;  2QKD A;  1TF8 A;  3FQQ A;  4MHY A;  3G71 Z;  2IL4 A;  2VZY A;  2PRQ A;  3MN8 A;  1LRZ A;  2XEG A;  4MY3 A;  4HH4 A;  3T4N B;  1S3Z A;  4RS2 A;  1Q7L A;  3NE7 A;  3BXM A;  2PE3 A;  2GFQ A;  1XE4 A;  2ZW7 A;  2OOY B;  2VUM I;  2VF1 A;  4TNU A;  2E9H A;  4OC0 A;  3ESW A;  3D3S A;  4QBJ A;  2IV2 X;  1A2Z A;  2O4H A;  4WWV A;  1F57 A;  4GS4 A;  1OBR A;  3T8W A;  1YVO A;  1CPX A;  4NH1 C;  2RBL A;  4OLL A;  1Z8L A;  3T9Y A;  1QSR A;  5J1Q A;  4XX2 A;  3PGP A;  4C7I A;  2C6G A;  3P5J B;  4UWI A;  2P6E A;  4UCN A;  2B5G B;  4A95 A;  2PJ7 A;  2KI7 B;  3MZL B;  4NCZ A;  4ZYQ A;  4E33 A;  2ZW4 A;  3S6K A;  5JH9 A;  3GTM I;  2EBJ A;  5C82 A;  5J8F A;  3WR7 A;  1TWF I;  4HGZ A;  3T90 A;  4I49 A;  2PR1 A;  1OZP A;  3PO2 I;  1KZF A;  4CAF A;  4OAE A;  4CYN A;  4RVH A;  4UEF A;  2YAD A;  1K9M 2;  3KHX A;  3CXC Y;  1YRE A;  2VEZ A;  5T6B A;  1QVF Z;  5FLX b;  3TO7 A;  4KVM E;  3EY5 A;  1V0C A;  3CZX A;  1K83 I;  5CPA A;  4KUB A;  2OU2 A;  1RO0 A;  4R3L A;  1NP6 A;  2RT9 A;  4NBB A;  4BXX I;  1R9T I;  4KS9 A;  5G20 A;  3TCV A;  3CXQ A;  5LRG A;  1VQ8 1;  1JJ2 Y;  3DR6 A;  2WAQ A;  2NMT A;  2E7Z A;  3BHX A;  2ARH A;  5D1O B;  4J3G A;  1IB1 E;  4C2Z A;  2W04 A;  4A3E I;  1QVG Z;  4MHP A;  5CBM A;  1DL6 A;  4CRY B;  3D66 A;  3I56 1;  3TT2 A;  1VQ8 Z;  1VQK 1;  4KLV A;  1VQ7 Z;  3DLJ A;  2YND A;  1MJ9 A;  3VMI A;  1P0H A;  3R9G A;  1RQF A;  3KKW A;  3I56 Z;  2AE6 A;  5CNP A;  2Q4Z A;  2VPY A;  2GLF A;  4L8A A;  4PK3 A;  4EME A;  5C4X I;  3KZW A;  4B6Z A;  2Z0Z A;  4B5P B;  2JIO A;  5F46 A;  3JAM f;  3S2H I;  2FE7 A;  3GYA A;  2J8M A;  4KOX A;  1AUG A;  1XJO A;  2IQ6 A;  5AGE A;  2EO8 A;  5AG6 A;  4OP4 A;  2Z3O A;  1CBX A;  1QSM A;  5IX3 A;  1IOI A;  4R9M A;  4MCP A;  3SJE A;  3CC4 1;  1K8A 2;  4CGP A;  1YME A;  1YJ9 Z;  2QRC B;  2JA5 I;  4PV6 A;  4NXY A;  3CD6 1;  2JIQ A;  3TTH A;  2ZPA A;  3CC7 1;  2OTJ 1;  1VHO A;  2V8G A;  2EK9 A;  2JA8 I;  2CF4 A;  3CXP A;  4OC1 A;  5EC4 A;  3CC4 Z;  5C4J I;  1NSL A;  1Y9K A;  1QYP A;  4NJQ A;  5DWM A;  4PXB A;  4UCP A;  4U9Z A;  2OTJ Z;  2RIQ A;  4Y52 I;  4DK1 A;  3KI9 A;  1K73 2;  3PB6 X;  3S6H A;  2G2K A;  2AKL A;  4P4B A;  2VXK A;  1XIX A;  2YNC C;  5G22 A;  5GCN A;  1KUV A;  2XEF A;  1CP6 A;  4CYQ A;  2E2J I;  4NF1 A;  2D4P A;  1UWY A;  4HGY A;  3DGV A;  4KLW A;  3BLN A;  2AFU A;  5AG5 A;  1QSN A;  1VIX A;  3CCU Z;  1ARL A;  3FBU A;  1DTD A;  1Z8W A;  3NH5 A;  1LAP A;  3V38 A;  2EVN A;  5IT9 b;  1BAV A;  4MRI A;  4AB7 A;  4P4I A;  4NBE A;  3CCL Z;  4NBG A;  2PC1 A;  2PVW A;  5THW A;  3D68 A;  3TC8 A;  3V7Z A;  4CAV A;  3J80 b;  5A2Q b;  1YI2 Z;  4QVT A;  1Q86 1;  1YR0 A;  5K8O A;  4MCQ A;  3FEE A;  4OIW A;  2VQY A;  3OWC A;  2AFS A;  3PB9 X;  4YFJ A;  3F0A A;  2Y0S A;  2M48 A;  2ZW6 A;  1TKH A;  4LUA A;  3S9M A;  2G9D A;  2DF5 A;  2F7V A;  3K9U A;  1YX0 A;  5F48 A;  4E0A A;  2DEA A;  4AG7 A;  4YWY A;  4UFW A;  2J6A A;  1K4J A;  2OTL 1;  2AFO A;  3TE4 A;  3V8I A;  3B8G A;  1VLA A;  1ZO0 A;  3ZJ0 A;  3KIF A;  1XMT A;  4ZX9 A;  3LWU A;  4OC4 A;  3R96 A;  3GB0 A;  2B3V A;  2HF1 A;  3RYO A;  2AFX A;  1YQE A;  3BG0 B;  2F4O A;  1R43 A;  2ZEM A;  2K5R A;  1LOK A;  1YVK A;  4FD7 A;  4Y7N I;  4CYP A;  2PJ6 A;  3P2F A;  4RI1 A;  2P6G A;  1M4G A;  4NBC A;  3IWW A;  1RO5 A;  3F8K A;  2F8H A;  4LQG A;  2V8I A;  3B3V A;  4MFZ A;  4W9Y A;  2DE7 A;  3B3C A;  2OZK A;  4UEE A;  5C88 A;  1Q7Y 1;  2OR4 A;  3PBB A;  2EUI A;  1WWZ A;  5K8N A;  3VH9 A;  2PM9 A;  1U6M A;  1M4D A;  3LD2 A;  4TWE A;  1XF8 A;  2D4O A;  1YJW Z;  1AYE A;  4ZBG A;  1NSA A;  4KSF A;  1KQS Z;  3R1K A;  3PO3 I;  3IJ3 A;  4BBR I;  3DNS A;  4CS0 B;  3IU2 A;  1KWM A;  3VWD A;  3FMC A;  4B5O A;  4YGO A;  1ZLI A;  3NDI A;  1QST A;  3D7D A;  4RVF A;  4BBS I;  4R6T A;  3M3Y I;  4R57 A;  3JVN A;  1QSO A;  2PJ9 A;  1M90 1;  3J81 f;  1Q2Y A;  4KZT A;  4Q38 A;  2G3A A;  1CJW A;  1HEE A;  3TOA A;  3VMH A;  2RPR A;  1NE9 A;  1VQ9 Z;  4UIB A;  5HXD A;  5BWA B;  4X2T A;  2Q7S A;  1VGY A;  4HNY B;  1VQO 1;  2JUB A;  1LQL A;  4QTU A;  5I4M A;  4PPZ A;  2JIP A;  3KQZ A;  4BBH A;  2NSM A;  1N71 A;  3PB8 X;  4YRH A;  3GLJ A;  4CAX A;  3S14 I;  1YIT 1;  4EVY A;  5G21 A;  3N7Z A;  3CPW Z;  2NVQ I;  1VQO Z;  5LYD A;  5KTD A;  3VMG A;  3S1M I;  3WC7 A;  2JEW A;  8CPA A;  1Y1W I;  3GKQ A;  1YIT Z;  3UY5 A;  4E2X A;  2PJ4 A;  4DNC A;  4P4D A;  4NGS A;  2B5G A;  3CPA A;  3G8W A;  3PZJ A;  3CDX A;  2CNT A;  4R87 A;  2I00 A;  2JR6 A;  4JXR A;  4E2Z A;  2PIZ A;  4MCR A;  4MFL A;  4B10 A;  2ANP A;  4H2K A;  1Z03 A;  2VZZ A;  4CPA A;  3R9E A;  2K5T A;  1IOF A;  5F49 A;  1ZG8 A;  4U9Y A;  2C6C A;  1MJB A;  3J7A 4;  2QYV A;  4FWU A;  3RZO I;  2PK7 A;  2F4M A;  2OZU A;  2R8V A;  3KL9 A;  4A3I I;  2GTI A;  1I3Q I;  5H84 A;  1F2P A;  4P10 A;  4O23 A;  2Q4V A;  2C6P A;  1ZLH A;  4ZI6 A;  2PJ1 A;  5JPH A;  1Q86 2;  2FT0 A;  4RN7 A;  4XPD B;  4AVB A;  2ZOF A;  2WYR A;  4K3N A;  2C1C A;  3CPX A;  1S7N A;  3VWE A;  3G6E 1;  4CRZ B;  5ISV A;  1Q81 2;  2F5I A;  3FB3 A;  5D1O A;  1L0C A;  3HOW I;  2JS4 A;  3CC2 1;  2PQ8 A;  3N5F A;  4BY7 I;  3E0K A;  3G6E Z;  1FY7 A;  3S6G A;  4NGR A;  1M4L A;  4JJX A;  1RNI A;  2RFH A;  4F9U A;  1VQP 1;  4Q7A A;  3CQZ I;  2RB7 A;  3LOD A;  2QA4 Z;  3CC2 Z;  3FKI I;  4NB8 A;  5K8P A;  4KOY A;  1RTQ A;  3VB9 A;  3FF3 A;  4QC6 A;  7CPA A;  2O53 A;  1IY7 A;  1VQP Z;  5JGF A;  2Z3M A;  1W2B Z;  4B5P A;  2V3V A;  3WT4 A;  1R57 A;  2M6N A;  5LL6 f;  5AG4 A;  4ZY0 A;  4R76 A;  3W6X A;  2JEV A;  2QRE B;  3RZD I;  2XEI A;  3CCM Z;  3I1U A;  2CY2 A;  3BJ7 A;  1LAN A;  1Q82 1;  4F8Z A;  3D2L A;  3D8P A;  2FS5 A;  4MFP A;  3I07 A;  3H8E A;  4MH4 A;  3TFY A;  3FNC A;  3CMA 1;  4S1T A;  5IP7 I;  3H8G A;  1HDQ A;  4G1P A;  3FED A;  2B4B A;  2BEI A;  1VQ7 1;  4NGQ A;  1NUI A;  4R8F A;  3FEC A;  3WC5 A;  4JWP A;  5T64 A;  3CMA Z;  4FBE A;  2P0W A;  4DYO A;  4MI4 A;  3B2Y A; 
#chains in the Genus database with same CATH homology
 5HVH A;  1PYT B;  1DTD A;  4OC5 A;  3VTN A;  3NH5 A;  1KD1 2;  3H3V J;  3S16 I;  1LAP A;  4IK2 A;  2B63 I;  2PJ8 A;  3HKZ A;  1S7M A;  2ZEN A;  4RV9 A;  3V38 A;  1L1O C;  4PXD A;  5IT9 b;  2ABZ A;  1BAV A;  4MRI A;  1HDU A;  3PB4 X;  3HLP A;  3LMS A;  2EGT A;  4ZY2 A;  1WII A;  1JJ2 Z;  4P4I A;  4NBE A;  4A93 I;  2P28 A;  1ZG7 A;  3CCL Z;  4NBG A;  1RLY A;  2PVW A;  3FVL A;  4JZ0 A;  3J80 f;  5THW A;  5A2Q f;  5HVF A;  4KSI A;  1ZB8 A;  2BOA A;  3D68 A;  3D7G A;  3PBE A;  3TC8 A;  3V7Z A;  2PVV A;  1TWG I;  3J80 b;  3GTM S;  5A2Q b;  1YI2 Z;  4A3C I;  3OW2 Y;  4OC3 A;  2RHB A;  1PFT A;  1Q86 1;  2V8D A;  1P9N A;  4A3J I;  4PQA A;  3D4U A;  1Z01 A;  1GYT A;  2ZEE A;  4PXC A;  2NYQ A;  4A3K I;  2PMZ A;  5K8O A;  4MCQ A;  3FEE A;  1VQ5 1;  4ZY1 A;  1YLO A;  1NJI 1;  1Z02 A;  2PJB A;  2QR1 B;  4OIW A;  2QA4 1;  1IGB A;  1XRY A;  3K7A I;  2AFS A;  1LCP A;  3PFO A;  3PB9 X;  5T67 A;  4A3D I;  1YJ9 1;  2GLJ A;  3FH4 A;  4E2Y A;  2Y0S A;  1Y0Y A;  2M48 A;  4QTT A;  1TKH A;  3WC6 A;  3D6W A;  3S9M A;  2BJO A;  2G9D A;  3VAT A;  5D29 A;  2F7V A;  2HU9 A;  2V8K A;  4MD9 A;  3FJU A;  1LFW A;  1VQ5 Z;  3TDH B;  2WZN A;  4MMO A;  1TWC I;  2W03 A;  3J81 b;  3CPW Y;  1VQ6 1;  2DEA A;  2PCU A;  3HUV A;  3G4S 1;  1TWA I;  3KIH A;  1Z5R A;  4UIA A;  1TKF A;  5C3E I;  3JRU A;  4A3L I;  3GTL I;  1LAM A;  2QRD B;  3FQM A;  2WB1 A;  4A3M I;  4NBD A;  3CT9 A;  2JBK A;  4YWY A;  4P4F A;  3IC1 A;  3NH8 A;  1ARM A;  2GRE A;  4YU9 A;  3IO1 A;  2PJ2 A;  2ZAE B;  5D1P A;  1BPM A;  2J6A A;  2OTL 1;  1M1K 2;  2AFO A;  3D9X A;  3CCM 1;  1AMP A;  1PCA A;  1M1K 1;  6CPA A;  1VQ6 Z;  3NDJ A;  3G4S Z;  2LIY A;  1QVF Y;  2CTC A;  1VLA A;  3MZK B;  3PFE A;  4X8I A;  3Q87 A;  4NFR A;  1Y1V I;  4E30 A;  4MON A;  1Y7E A;  4MCS A;  3IIB A;  3SJG A;  1TF9 A;  1VQN 1;  2AFZ A;  3KIF A;  4NJR A;  2FVG A;  1ZH1 A;  3S9N A;  2YU9 I;  2V8J A;  4ZX9 A;  1YIJ 1;  3IX0 A;  3LWU A;  4OC4 A;  2R92 I;  3RBU A;  2HB6 A;  1ZB9 A;  5LRJ A;  1CP7 A;  2CIJ A;  3GB0 A;  4RUH A;  4NB9 A;  4NGM A;  1FT7 A;  4X6A I;  2HF1 A;  1CG2 A;  2PJ5 A;  2AFX A;  2I3C A;  4AXV A;  4A3G I;  3BG0 B;  1YHQ Z;  2F4O A;  3B7I A;  1R43 A;  2ZEM A;  2ZEF A;  4FUU A;  2QEX 1;  1I50 I;  5C44 I;  3CCU 1;  3KQX A;  2K5R A;  1LOK A;  1YIJ Z;  3CCJ 1;  2BO9 A;  2IJZ A;  2LFU A;  2QVP A;  2NVY I;  2ZEL A;  4Y7N I;  3SI0 A;  4OKO A;  2PJ6 A;  1QVG Y;  3NFZ A;  3S1Q I;  3G71 1;  3U50 C;  1JQG A;  4DUK A;  1VHE A;  2ZEO A;  4NBC A;  3KR4 A;  1N8R 2;  4A37 A;  2GU2 A;  1QMU A;  3S17 I;  3IWW A;  2IZ4 A;  1N8R 1;  2F8H A;  4RVG A;  3GTG I;  2QEX Z;  1S72 1;  4LQG A;  3SJF A;  2V8I A;  3CCV 1;  3B3V A;  4A39 A;  2PJA A;  4W9Y A;  2DE7 A;  2ZEP A;  1R3N A;  3B3C A;  3CCL 1;  3CCJ Z;  3K2K A;  3D7H A;  5LRK A;  2OZK A;  1Q7Y 2;  1F2O A;  4UEE A;  4PXE A;  3BI1 A;  1Q7Y 1;  3I4N I;  2QKD A;  2OR4 A;  4Z65 A;  3PBB A;  5JM6 A;  1TF8 A;  3FQQ A;  4MHY A;  3K9T A;  3G71 Z;  1YI2 1;  5IT9 f;  4RS4 A;  5IP9 I;  1KD1 1;  2PRQ A;  3MN8 A;  2XEG A;  5K8N A;  3VH9 A;  2QJ8 A;  2PM9 A;  3M4O I;  1S72 Z;  4TWE A;  4HH4 A;  2NVX I;  3T4N B;  3CCV Z;  1DE4 C;  3GUX A;  1YJW Z;  1AYE A;  1NSA A;  1Q7L A;  1KQS Z;  4E31 A;  4X3R A;  3BXM A;  4E2W A;  2PE3 A;  3PO3 I;  3PEI A;  2OOY B;  4BD9 A;  2VUM I;  3IJ3 A;  2JA7 I;  2VF1 A;  4BBR I;  4TNU A;  3S1N I;  3D7F A;  2E9H A;  4E32 A;  3F3F C;  4OC0 A;  3ESW A;  1KWM A;  2O4H A;  3NA6 A;  4JYW A;  1YW6 A;  4A94 A;  4WWV A;  1F57 A;  2EWB A;  3FMC A;  2QLV B;  2PJC A;  1OBR A;  3T8W A;  1VQK Z;  1CPX A;  1ZLI A;  3NDI A;  2OOX B;  3HOX I;  4NH1 C;  2R7Z I;  3D7D A;  4RVF A;  2RBL A;  1XBU A;  4BBS I;  4R6T A;  1Z8L A;  1M90 2;  4MXU A;  3M3Y I;  2PJ9 A;  1YSJ A;  1M90 1;  3J81 f;  2DE5 A;  5J1Q A;  4UEZ A;  4XX2 A;  3B3S A;  2C6G A;  3P5J B;  1TXR A;  4P6Y A;  1TFI A;  3JAM b;  3F3P C;  1KC8 2;  3RAM A;  1HEE A;  3VMH A;  2RPR A;  1VQ9 Z;  5FLM I;  3S1R I;  4UIB A;  5HXD A;  4NBA A;  4X2T A;  1W2B Y;  1VGY A;  4P45 A;  4A3F I;  2PJ7 A;  2KI7 B;  3MZL B;  4MD7 A;  1VQO 1;  4ZYQ A;  3GTK I;  3HOV I;  2JUB A;  4E33 A;  1LQL A;  3KAS A;  1ML8 A;  3RZA A;  1TWH I;  1QF8 A;  3MON A;  4QTU A;  4NGP A;  5I4M A;  5JH9 A;  3B35 A;  4PPZ A;  3KQZ A;  2NSM A;  3GTM I;  1YUA A;  3PB8 X;  1YHQ 1;  4MHZ A;  3GLJ A;  3S14 I;  1YIT 1;  3VAR A;  2JA6 I;  4DGL A;  4WJB A;  5F09 A;  2AFM A;  3CPW Z;  1TWF I;  2R6M A;  2NVQ I;  4HGZ A;  1VQO Z;  5LYD A;  3IFE A;  3CME 1;  1YUK A;  4IHM A;  4NOZ A;  3IFU A;  3PO2 I;  1FNO A;  3VMG A;  3CCS 1;  3S1M I;  5DS0 A;  3WC7 A;  5IB9 A;  3CCQ 1;  2JEW A;  3QNV A;  1Z2L A;  4RVH A;  1VQM 1;  2BCO A;  8CPA A;  4UEF A;  2YAD A;  1K9M 2;  2XEJ A;  3H8F A;  1Y1W I;  3EER A;  3GKQ A;  1K9M 1;  3KHX A;  1YIT Z;  1ELM P;  5ELY A;  3GTO I;  3CXC Y;  4E2X A;  3QWU A;  2JNY A;  2NVT I;  1USP B;  3CD6 Z;  2PJ4 A;  5T6B A;  3B3T A;  4EWT A;  1QVF Z;  5FLX b;  2AFW A;  2V77 A;  4P4D A;  3CME Z;  4F9V A;  4NGS A;  3CC7 Z;  3KGQ A;  3CPA A;  3CCS Z;  1K83 I;  3CCQ Z;  3PO3 S;  5CPA A;  1RO2 A;  1WCM I;  1VQM Z;  5LYL A;  2ZOG A;  3CDX A;  2VL1 A;  1RO0 A;  2HC9 A;  2ZED A;  3EED A;  1NP6 A;  2RT9 A;  4NBB A;  1XFO A;  4P4E A;  4BXX I;  3S2D I;  2KPI A;  1R9T I;  2IMO A;  4P44 A;  4IAV A;  1YJW 1;  3GCF A;  1BPN A;  4BY1 I;  4MD8 A;  4RVD A;  3PB7 X;  2JR6 A;  1VQ8 1;  5LRG A;  1JJ2 Y;  5D8N A;  2J9A A;  4E2Z A;  2WAQ A;  2PIZ A;  1Y0R A;  4MCR A;  4R7M A;  3BHX A;  1VQL Z;  3H0G I;  5D1O B;  5AN9 F;  2ANP A;  4H2K A;  4GM5 A;  1Z03 A;  4CPA A;  2W04 A;  4A3E I;  1QVG Z;  4MHP A;  2EK8 A;  1BLL E;  5CBM A;  1ZG8 A;  1DL6 A;  2C6C A;  3D66 A;  1YW4 A;  3I56 1;  3J7A 4;  1VQ8 Z;  2QYV A;  4A38 A;  4FWU A;  2ZEG A;  1VQK 1;  3RZO I;  1USP A;  2PK7 A;  1VQ7 Z;  3DLJ A;  2F4M A;  1X3Z A;  3KL9 A;  4A3I I;  2GTI A;  3TE5 B;  1I3Q I;  3VMI A;  4AYB A;  2POK A;  2DE6 A;  2PJ0 A;  4CL1 A;  3SI2 A;  1F2P A;  4P10 A;  4NGN A;  3CCR 1;  4O23 A;  4OC2 A;  2C6P A;  1RQF A;  3I56 Z;  1ZLH A;  2ZEH A;  4ZI6 A;  2PJ1 A;  1I6H I;  3WAB A;  2K3R A;  2Q4Z A;  1VQ9 1;  1Q86 2;  2GLF A;  1Y1V S;  5LYI A;  4EME A;  5C4X I;  3KZW A;  2ZOF A;  2WYR A;  4K3N A;  2C1C A;  3CPX A;  4B6Z A;  3CCE 1;  3G6E 1;  3ISX A;  4NBF A;  3KHZ A;  1NJI 2;  3JAM f;  2P3Y A;  3CCR Z;  3S2H I;  3NH4 A;  3OW2 Z;  1Q81 2;  3L2N A;  5D1O A;  1VQ4 1;  4NBH A;  2V8H A;  1Q81 1;  2IZ3 A;  3HOU I;  3HOW I;  3BI0 A;  4EWC A;  2JS4 A;  3CC2 1;  1KC8 1;  3N5F A;  1XJO A;  2OOT A;  4BY7 I;  1H8L A;  1X3W A;  2IQ6 A;  3I55 1;  3SI1 A;  4OP4 A;  4DJL A;  3G6E Z;  3CCE Z;  1CBX A;  2Q43 A;  3B3W A;  4NGR A;  1RO4 A;  1M4L A;  2H85 A;  1RNI A;  2RFH A;  2PJ3 A;  3KR5 A;  4F9U A;  3GTJ I;  2GTH A;  1VQP 1;  4Q7A A;  1VQ4 Z;  3TX8 A;  3CQZ I;  1QQ9 A;  1EE3 P;  2QA4 Z;  2RB7 A;  4MCP A;  3PRT A;  3SJE A;  3CC2 Z;  3CC4 1;  1K8A 2;  1YME A;  1YJ9 Z;  2QRC B;  3FKI I;  4NB8 A;  3I55 Z;  1K8A 1;  2JA5 I;  4MHN A;  4FAI A;  5K8P A;  4UF4 A;  3FX6 A;  3CD6 1;  1RTQ A;  3VB9 A;  3LUS A;  4DQY B;  3FF3 A;  1TKJ A;  7CPA A;  2O53 A;  3CC7 1;  2OTJ 1;  3I4M I;  2R93 I;  1IY7 A;  1VQP Z;  1VHO A;  3IEH A;  5JGF A;  2V8G A;  5K8M A;  3SJX A;  3HOZ I;  2EK9 A;  2JA8 I;  1W2B Z;  2CF4 A;  4OC1 A;  3WT4 A;  2M6N A;  3CC4 Z;  5C4J I;  5LL6 f;  1YJN 1;  5FLX f;  1CX8 A;  4EFD A;  1QYP A;  4ONW A;  4ZY0 A;  4NJQ A;  4R76 A;  4PXB A;  3BG1 B;  1CPS A;  4ZX8 A;  2QRE B;  3RZD I;  1ZG9 A;  1JWH C;  2XEI A;  2OTL Z;  3S9L A;  1X0T A;  2OTJ Z;  2RIQ A;  3CCM Z;  3I1U A;  5CM2 M;  3MRU A;  1Q82 2;  4A3B I;  2CTB A;  4Y52 I;  4DK1 A;  3KI9 A;  1K73 2;  1LAN A;  3PB6 X;  1Q82 1;  2G2K A;  2JBJ A;  2AKL A;  1K73 1;  2E2I I;  1ELL P;  1VQL 1;  4F8Z A;  2VUG A;  4P4B A;  1YJN Z;  3I07 A;  3H8E A;  4NGT A;  4MH4 A;  4OME A;  1VQN Z;  2XEF A;  5HVG A;  3CMA 1;  3ISZ A;  4S1T A;  5IP7 I;  1CP6 A;  1N2F A;  3H8G A;  3S15 I;  1HDQ A;  4P4J A;  1XMB A;  4G1P A;  2E2J I;  3FED A;  2E2H I;  2Q51 A;  3CXC Z;  1UWY A;  1SFO I;  1VQ7 1;  4HGY A;  1KRL A;  3IF8 A;  3GTQ I;  1KQS Y;  2V8V A;  1NUI A;  3DGV A;  4NGQ A;  4R8F A;  2AFU A;  3FEC A;  2JMO A;  3WC5 A;  2PIY A;  5LYF A;  5T64 A;  3CMA Z;  1VIX A;  4FBE A;  3HOY I;  3GTP I;  3CCU Z;  1ARL A;  4DYO A;  1WW9 A;  3D67 A;  4OID A;  3B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...