4MRIA

Human brain aspartoacylase mutant f295s complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
b'HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEASAKTTKLTLNAKSIRCC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartoacylase
molecule tags Hydrolase
source organism Homo sapiens
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mriA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mriA01
1Y0YA 4NGNA 1F57A 2C6GA 2POKA 3H8EA 3D7FA 3TX8A 4NGMA 3JRUA 1LFWA 4ZX8A 4ZY2A 2BCOA 4G1PA 4NGRA 3PB9X 5K8PA 2XEGA 4EMEA 4KSIA 4OC0A 4A37A 2ZELA 2PJ6A 1ARMA 4YU9A 2IMOA 3KL9A 3IJ3A 4UIBA 2V8VA 3MRUA 1LAPA 3LWUA 1LANA 3BI1A 2EK8A 3FEEA 1UWYA 1ZG9A 4OIDA 4ZYQA 5LYIA 4EWTA 4R76A 3KQXA 4ZI6A 4DYOA 4F8ZA 2ZEEA 1R43A 1XBUA 3S9MA 4MXUA 4P4DA 4GM5A 3PB6X 2F8HA 5HXDA 2PJ9A 4BD9A 3FJUA 4OMEA 5LRKA 3DGVA 4EFDA 2NYQA 1FT7A 2AFXA 4P4IA 3V7ZA 1VGYA 2RFHA 4PXBA 4OC3A 2EWBA 1YW4A 3MN8A 5JM6A 2GU2A 3SI2A 2V8GA 3K2KA 3K9TA 5HVFA 2GREA 3I1UA 3KHXA 4MHZA 4P4JA 3IEHA 3QNVA 4FUUA 4MCQA 4K3NA 3IWWA 2XEJA 3CDXA 3KZWA 1TF9A 5LYDA 4MCPA 4X3RA 5THWA 4FWUA 1BAVA 1CG2A 1TKFA 4NJRA 5LRGA 5CPAA 1F2PA 2DEAA 1DTDA 1M4LA 4MRIA 3FVLA 3PEIA 3WC7A 2OOTA 3KQZA 2C6CA 2JBJA 3PB8X 2HB6A 2Q51A 1GYTA 5D8NA 1CPXA 3PFEA 1Y7EA 1DE4C 2F7VA 3RBUA 2GLFA 2RB7A 3IO1A 2PJ1A 4UEZA 1TXRA 2CTCA 3WC6A 2ZEOA 1HDUA 2CIJA 4NJQA 3GUXA 3FMCA 3VARA 1AYEA 4A94A 3ISZA 4MCSA 5ELYA 2ZOFA 2BOAA 3FF3A 2ZEHA 4IHMA 4TWEA 3SI0A 3B7IA 5DS0A 3S9LA 2PJ4A 4NGPA 1YW6A 4NGSA 4P4FA 2AFZA 4LQGA 3D68A 3D67A 3D4UA 2PJ3A 1TF8A 3GLJA 4OP4A 2PCUA 3D7GA 5I4MA 3VH9A 4FBEA 1CBXA 3KR4A 3WABA 4WJBA 2ZEDA 2V8DA 4JZ0A 2O4HA 2OR4A 1YLOA 1JQGA 7CPAA 1TKJA 4ZX9A 3DLJA 1LAMA 3SI1A 4H2KA 4UEFA 2Q43A 4P4BA 2PJ7A 4P4EA 3SJGA 1VHOA 1QMUA 3FX6A 1IY7A 4NGTA 2FVGA 3PRTA 4DUKA 2CF4A 4PPZA 3D66A 4ZY0A 1CP6A 8CPAA 4B6ZA 3IC1A 4MCRA 4R6TA 3CT9A 1KWMA 5LRJA 1YSJA 3TC8A 2NSMA 2PJ8A 3GB0A 4MHPA 1CX8A 3FECA 6CPAA 2HC9A 3KHZA 1PYTB 4OC4A 4Q7AA 4OIWA 4OKOA 3IIBA 3NFZA 1H8LA 4X8IA 3KASA 2PJCA 3N5FA 1Z8LA 1ELLP 2PE3A 4TNUA 3PB4X 4X2TA 5LYLA 2PJ5A 2PRQA 2IJZA 1Y0RA 2ZEFA 2QYVA 3LMSA 2C6PA 5K8OA 2PIYA 4P45A 3PBEA 4Z65A 4YWYA 4OC5A 4PXEA 2ZEGA 3NH8A 1EE3P 5JH9A 4JYWA 1ZLIA 3PBBA 1HEEA 4ZY1A 2ZEMA 2XEFA 4F9VA 1F2OA 2C1CA 3PFOA 2ABZA 3RAMA 1ZG8A 2QJ8A 3KR5A 2PJ2A 4NGQA 4RUHA 1VIXA 2V8HA 1PCAA 4CPAA 4AXVA 4WWVA 3VATA 4A39A 1BPMA 2ZEPA 2VL1A 3KI9A 4A38A 2O53A 1BPNA 2PJAA 1LOKA 2QVPA 1BLLE 3B3CA 2ZENA 4UIAA 3S9NA 2CTBA 4OC1A 2AFOA 4FAIA 5CBMA 2BO9A 3H8FA 1QQ9A 3HUVA 3BHXA 1OBRA 3NH4A 4R7MA 2V77A 4F9UA 4W9YA 3WT4A 1YMEA 5F09A 3B3SA 1ZLHA 2AFSA 4NFRA 3H8GA 2WYRA 5K8NA 2PVVA 2PJ0A 1NSAA 1R3NA 2JEWA 2AFMA 2G9DA 3PB7X 2WZNA 5K8MA 4PXDA 4R8FA 1Z5RA 1HDQA 3CPAA 3B35A 4MHNA 2GLJA 5HVGA 1ZG7A 3IFEA 4PXCA 2EK9A 4MMOA 1VHEA 4P44A 2J9AA 5J1QA 3FEDA 3SJXA 2I3CA 2XEIA 1XFOA 2AFWA 4ONWA 5D29A 2IQ6A 2PJBA 4OC2A 2ZOGA 1Q7LA 4UEEA 1XMBA 5JGFA 3D7DA 3D7HA 5LYFA 3NH5A 1TKHA 4P6YA 2Q4ZA 4DJLA 2JBKA 3CPXA 4IK2A 3ISXA 1CPSA 1FNOA 3B3VA 4O23A 1XJOA 3SJFA 1CP7A 3RZAA 4UF4A 3NA6A 4IAVA 4MHYA 3WC5A 2AFUA 5IB9A 3L2NA 4P10A 1ELMP 3B2YA 3HLPA 1AMPA 3T8WA 3KGQA 2ANPA 5HVHA 3SJEA 1IGBA 3B3WA 1RTQA 3BXMA 1XRYA 1ARLA 2PVWA 3V38A 3FH4A 4PQAA 2PIZA 1Z2LA 3BI0A 1LCPA 3B3TA
chains in the Genus database with same CATH superfamily
1FDOA 5AG5A 2RBLA 1F57A 2C6GA 4MY0A 3H8EA 1VQK1 1RXTA 4XX2A 4ZX8A 4NGRA 4II9A 2BUEA 3PB9X 5CNPA 5K8PA 2XEGA 3K9UA 4EMEA 4MY3A 3IFUA 2PJ6A 2IMOA 3KL9A 3IJ3A 4NBDA 3LWUA 4MD8A 4KLVA 3CCE1 3KKWA 2EK8A 5A2Qf 3S2DI 4OIDA 1R57A 4A3CI 4J3GA 3TO9A 2E9HA 3KQXA 3CC71 2JIPA 1R43A 3B8GA 4MXUA 1V0CA 4P4DA 1KC81 3MGDA 3PB6X 5H84A 4A3GI 3R95A 4OLLA 5IV0A 3P2HA 1RO0A 4BD9A 2QLVB 2VI7A 2EGTA 2NYQA 2QKDA 4B10A 3QAHA 4KLWA 4GXHA 1WIIA 3G6EZ 2GTIA 4PXBA 4AVBA 4R3KA 5F46A 4XPDC 5JM6A 2GU2A 4RVFA 4KVXA 3K9TA 1KQSY 3SI2A 2GREA 1AUGA 2EVNA 4CAVA 3W6SA 4FD7A 3QNVA 4MCQA 2ZXVA 4A3MI 4MJ8A 1X0TA 2XEJA 3CDXA 2DPSA 5T67A 1MJBA 3VMGA 4KSFA 1K8A2 2FXFA 2KCWA 4A32A 3PO2I 1S7MA 5LRGA 1DTDA 1M4LA 4ZGYB 2H85A 1QSRA 4MRIA 3FVLA 3FRMA 3WC7A 5E96A 2Q7SA 4E2XA 3W6XA 4MFLA 1GYTA 4S1TA 1M902 5C4JI 1M1K1 2F7VA 2PJ1A 4BINA 3FMCA 3VARA 1Y9WA 3CPWZ 3CCU1 4A94A 2OZKA 4KUAA 3B7IA 2H5MA 4DQYB 3CMA1 3EEDA 4P4FA 4A3EI 1TWHI 4LQGA 1RO4A 3F8KA 3GLJA 3CMAZ 1S60A 2E2JI 4CGLA 3D7GA 3HOZI 1IYKA 3VH9A 1CBXA 3WABA 4YFJA 2ZEDA 5JQ4A 4JZ0A 3HOVI 2JS4A 1JQGA 5IP9I 3H4QA 3DLJA 1NJI1 3JTKA 4H2KA 3SI1A 5HMNA 4E0AA 1Q811 1JWHC 3SJGA 1VHOA 2FVGA 3CCLZ 2Z3PA 1ZB9A 2FS5A 2ODFA 4CAWA 1MJ9A 4AVCA 2OZGA 4B6ZA 4MCRA 5HH1A 5LRJA 3BJ7A 2J6AA 1YSJA 2NSMA 3GB0A 2GANA 3FKII 4QTUA 2E2HI 1B6BA 4OIWA 4ONUA 1Z8LA 4RI1A 4A3FI 2PE3A 3PB4X 2IL4A 4NOZA 2PJ5A 2RT9A 1Y0RA 2ZEFA 3H3VJ 3GTJI 4KORA 5G20A 2PSWA 2W03A 3GTPI 5FVJA 1MJAA 5G22A 1IU8A 4E8OA 3TCVA 1ZB8A 2NVXI 3DSBA 3U50C 3QWUA 2B4DA 1Q822 3NH8A 3S15I 3GKRA 4NBBA 3D8PA 2GIVA 4UFVA 1IICA 2ZEMA 2XEFA 4MBUA 2OOYB 1A2ZA 4R9MA 2VQYA 4JJXA 2O28A 2WUUA 2V8HA 4B5OA 4U9YA 3VATA 4XPDB 2VL1A 2JIRA 2ZW6A 3CZXA 1YJWZ 1LOKA 3B3CA 1YJNZ 4YRHA 1XMTA 2QR1B 4EWCA 2VUMI 4GS4A 2BO9A 4FD6A 3H8FA 4CGMA 1QQ9A 5C82A 3HUVA 4A33A 2QRDB 1IB1E 5H86A 5ISVA 4W9YA 1VQN1 5F09A 1N8R2 1ZLHA 2V45A 5K8NA 1NSAA 3PB7X 2WZNA 1M1K2 2EBJA 2NVYI 5A2Qb 4R8FA 3CPAA 4R87A 1YJ91 5FLMI 3FNCA 1KUYA 2GLJA 5HVGA 1ZG7A 3J81b 4NF1A 2ZAEB 2EK9A 1P0HA 1M4DA 1ON0A 2I3CA 4BY1I 3TOBA 3DR8A 4ONWA 4OC2A 1Q7LA 2P6FA 3D7DA 3D7HA 4JXRA 2OZHA 2B63I 3I3GA 3CXQA 1Q2YA 1IIDA 3K7AI 2G2KA 2PR8A 2JBKA 3CPXA 1IOIA 4ZBGA 3F3PC 3ISXA 1WK4A 1CPSA 1XEBA 3B3VA 4MFPA 1XJOA 2JA5I 1CP7A 1KRLA 3IU1A 1W2BZ 1Q2CA 2G3TA 2R92I 1AA6A 4M6IA 1LQLA 3G4SZ 1VQKZ 4CYPA 1X3WA 2JDCA 4A93I 3T8WA 1YHQ1 3KGQA 3SJEA 4RS4A 1IGBA 1MK4A 1W2BY 3QAYA 3NDIA 4QVTA 4U5YA 1Z2LA 3B3TA 1K8A1 1OZPA 1Z8XA 2POKA 4CRZB 3CCJZ 2V8IA 3PO3S 4NGMA 3JRUA 2ARHA 2FT0A 2RPRA 4ZY2A 4KOXA 4PSWA 4G1PA 3CD6Z 2PQ8A 4KSIA 4C2XA 1Y7RA 2ZELA 3E0KA 5LL6f 3IR7A 2HF1A 3RZDI 5AG4A 4B13A 3VWEA 1KC82 3MRUA 4M3SA 4KOWA 1Z4RA 3R1KA 3FEEA 3CCV1 1UWYA 1ZG9A 3CCL1 5LYIA 4AB7A 4DYOA 4F8ZA 4AVAA 3H0GI 3S16I 1VQ9Z 4OAEA 3CCR1 4E2ZA 1XBUA 4UWJA 3S9MA 2Q04A 2A4NA 3CCJ1 3FJUA 4H89A 4OMEA 1WCMI 3DGVA 2Z11A 2VPZA 1FDIA 1VQ4Z 4P4IA 1XE4A 2OH1A 1UFHA 3I55Z 1Q16A 3MONA 1YW4A 3MN8A 5AN9F 3VWDA 1Z4EA 3W91A 2V8GA 5HVFA 3G6E1 3UY5A 2D4OA 4MHZA 4P4JA 3F5BA 2ZW7A 4Y52I 3OW2Z 4K3NA 1N2FA 3KZWA 4MCPA 4FWUA 1TKFA 3GTLI 1F2PA 2WSAA 3R9GA 5A28A 3GY9A 2REFA 4Y49C 2PR1A 1I21A 1M4GA 3S6KA 3MZKB 1K83I 1QVFZ 4F0XA 3VB9A 2C6CA 3PB8X 2Q51A 1QSOA 1CPXA 2RC4A 1S5KA 3CCSZ 2GLFA 2Z3LA 4OADA 3P2FA 2M48A 3BJ8A 1TXRA 5IT9f 2CIJA 1AYEA 1PUAA 2CNSA 2ZOFA 2BOAA 3FF3A 4IHMA 1YI21 4PK3A 4TWEA 3SI0A 4NBGA 3TE4A 2VPWA 5CM2M 2K5TA 5FLXf 3EC4A 5AG6A 1M4IA 1VQ51 2AFZA 1QVFY 1VQOZ 2PJ3A 1TF8A 4IUSA 4B5PA 4Q38A 1S7NA 5I4MA 3BG0B 3KR4A 5IT9b 2DF5A 1RNIA 1NP6A 7CPAA 3VMIA 1TKJA 3P5JB 2J8MA 2GTHA 4KUBA 5FLXb 3D2PA 4A3BI 4P4EA 2G3AA 2YNEA 3VTNA 2F4OA 2KPIA 4UCMA 1NMTA 2YNDA 4NEXA 5D1OB 2P0WA 3IC1A 1VLAA 4KVOE 2OOXB 3TC8A 4MHPA 3FECA 4UFWA 3I4MI 1KUVA 1QVGZ 1PYTB 4OC4A 2PM9A 3PZJA 2KI7B 3NFZA 1H8LA 3OWCA 3N5FA 1M901 1VQ71 4TNUA 4X2TA 1YHQZ 2PRQA 1SQHA 4QB9A 5AGEA 2QYVA 3LMSA 1I1DA 2NAPA 2C6PA 5K8OA 2I00A 4Z65A 2B4DB 2M6NA 5F48A 1YVOA 1EE3P 4PK2A 2PRBA 2FE7A 2Z0ZA 3PBBA 3CC7Z 1QSNA 2OZUA 4ZY1A 4A31A 5AG7A 4F9VA 2C1CA 2ABZA 3KR5A 2PJ2A 4E30A 4B14A 2VZZA 4NGQA 4NBHA 1PCAA 3HOWI 4WWVA 1USPA 4A39A 1BPMA 1NJI2 4AG9A 3G4S1 2FSRA 1KQSZ 2R7ZI 1VQM1 4QTTA 2QA41 1QXFA 3S9NA 2CTBA 2LFUA 1Z8WA 2E2II 2DPTA 3CC41 1YX0A 1XIXA 1QSTA 4R7MA 2V77A 4JWPA 4NFRA 2R7HA 3T90A 2PVVA 2RHBA 2PJ0A 1S3ZA 1R3NA 4MH4A 2NVTI 2G9DA 1VQ41 5K8MA 4IF5A 1Z5RA 1IOFA 4QUSA 3HOUI 4MHNA 2PC1A 3IFEA 2WPXA 4PXCA 4CRYB 2VEZA 5J1QA 3FEDA 3SJXA 2XEIA 3FXTA 4UWIA 2AFWA 5JPHA 3IX0A 2IQ6A 2ZOGA 4UEEA 2OTJZ 5JGFA 4KOTA 3S1QI 3NH5A 1TKHA 2OTJ1 4KVME 1KD12 3QB8A 1K9M2 3J81f 2VF1A 1S7FA 4RVDA 4Y49B 1DL6A 4XNHB 1Y1VI 1TWFI 1YJ9Z 4MHYA 3WC5A 2YNCA 4NCZA 3TDHB 3B2YA 2QRCB 4B11A 1S7LA 5GCNA 3DR6A 3HLPA 2JR6A 3BXMA 2PVWA 5DWMA 2K5RA 4E31A 3FH4A 3SJFA 2VUGA 2JIQA 5IP7I 4CAXA 2DE7A 4A3LI 1Y0YA 4NGNA 2FIAA 2Q0YA 2Z3NA 4UCNA 1X10A 5I0CA 2JEVA 1TWCI 1YVKA 3V8IA 3GTMS 2CY2A 2OU2A 3EERA 3FBUA 3CCM1 4OC0A 3CCQZ 3D2LA 1SFOI 3D6WA 4UCPA 4YU9A 1VQ6Z 3S17I 5KTCA 1LAPA 3HOYI 3TTHA 4XPLA 3FYNA 4EWTA 3CC21 3LACA 1M1DA 2PK7A 2R1IA 3JAMf 1XF8A 3DNSA 3IWGA 5EC4A 4JLYA 2F4MA 2VZYA 4GM5A 2I79A 2F8HA 1VQ91 3I07A 4MFKA 2PJ9A 5IB0A 1YGHA 4EFDA 5C3EI 1VQO1 4MFZA 2PDOA 2AFXA 3V7ZA 4KZTA 4LQ6A 3GKQA 4HNWB 2AJ6A 3CCMZ 3F0AA 3CCQ1 2VPXA 4UBRA 4E32A 2QECA 5G1ZA 2Y0MA 3K2KA 3I1UA 3SXNA 2R98A 3IEHA 2X7BA 4FUUA 3ZJ0A 4C7HA 4C2ZA 5THWA 1BAVA 2EO8A 5CPAA 1Q7Y2 2P28A 2BEIA 4KSAA 4AYBA 2CNMA 4MHDA 3KIFA 5F49A 1WW9A 1Y9KA 2HB6A 3FIXA 1YR0A 3PFEA 1Y7EA 1X12A 3G71Z 4RVHA 3Q87A 1KD11 4PV6A 2YU9I 4RVGA 2RB7A 1ZO0A 3IO1A 3D2MA 3WC6A 2ZEOA 1JJ2Z 3CCS1 3GTKI 3JVNA 3ISZA 2JA8I 5ELYA 2BL1A 1Q861 2AYDA 4JXQA 3EY5A 4MD7A 5D1OA 3GTOI 2LIYA 4NGPA 4ORFA 1YW6A 4NBCA 1GHEA 1YI2Z 2HU9A 3D67A 3D4UA 1I50I 4OP4A 4WJBA 3I56Z 2QEXZ 2JUBA 2V8DA 2B3VA 1JWQA 4HNYB 4F6AA 4EVYA 1YLOA 2QMLA 3BG1B 2GE3A 2WAQA 3CXSA 3ESWA 2JNYA 4ZX9A 1LAMA 4BBHA 1S7KA 3GTQI 2Q43A 4P4BA 1QMUA 3FX6A 4M6GA 1Q2DA 4E2WA 4HH4A 2JIOA 3PRTA 1YJW1 4PPZA 2HUZA 4NBEA 2DXQA 1VQMZ 2QA4Z 1CP6A 1K4JA 2YNCC 8CPAA 3I551 4RN7A 1QF8A 4R6TA 3CT9A 3S1NI 2EUIA 4CYOA 2PJ8A 2HC9A 3KHZA 2R93I 1ZH1A 1L1OC 4Q7AA 2YADA 2QEX1 1I6HI 3IIBA 4UA3A 4QBJA 2ATRA 3KASA 3TE5B 2PJCA 4CYNA 2NMTA 5LYLA 1S721 3TO7A 2IJZA 3S2HI 2Z10A 2JMOA 2JA7I 4NB9A 3TT2A 1VQ61 2PIYA 3IU2A 4YWYA 3EO4A 4KOUA 1Y8CA 3RO0A 2VXKA 2ZEGA 5JH9A 1ZLIA 1HEEA 1F2OA 1ZG8A 2QJ8A 4A95A 4A30A 3LD2A 1VIXA 4NBAA 5C88A 2DE6A 1YLEA 1J4JA 4A38A 2O53A 3RZOI 3CD61 1BLLE 4CAEA 1TWGI 2B5GA 3T4NB 5G21A 5CBMA 3N7ZA 4CGPA 3LODA 1OBRA 3ZZIA 3NH4A 4F9UA 3WT4A 1YMEA 3B3SA 1U6MA 4AG7A 4A3II 2JEWA 2J8NA 4RV9A 4PXDA 4BBRI 3B35A 3IGRA 3CCRZ 3S6FA 1ML8A 3RNZA 4MMOA 2B4BA 3EXNA 4P44A 2YGWA 1B87A 1XFOA 1VQNZ 3FB3A 1LRZA 3PGPA 1XMBA 2ZW5A 2PMZA 1RQFA 4I49A 4C7IA 4UFXA 3LUSA 4MD9A 4JD6A 1TIQA 2V8KA 3CQZI 4DJLA 4IK2A 2OB0A 5C4XI 4H6ZA 4RS2A 2LEXA 4UF4A 4B5PB 4A2ZA 3M4OI 2JA6I 1BOBA 3D3SA 1IYLA 1Q812 3I561 3L2NA 1KUXA 2Y0SA 3TO6A 3WR7A 3OW2Y 3SXOA 1K731 2ANPA 5HVHA 3B3WA 1XOVA 1RTQA 1ARLA 3NE8A 3CXCY 4XNHC 3V38A 2ZPAA 3C26A 2PIZA 3BI0A 1LCPA 1WJ2A 3CXPA 1USPB 2AE6A 4H6UA 3GTGI 4E2YA 5IX3A 5C44I 3D7FA 4CYQA 3TX8A 1LFWA 1WZNA 2BCOA 1NUIA 4HGZA 1Z03A 1TWAI 4A37A 3CPWY 2V3VA 1VQ8Z 4A3KI 4NB8A 1ARMA 1N8R1 1P4NA 4UIBA 2V8VA 1LANA 3BI1A 5KTDA 1VQ7Z 4KOYA 5J8FA 1Z8TA 4ZYQA 1VKCA 3G3SA 4R76A 4ZI6A 4KOVA 2ZEEA 2JDDA 1K9M1 2B5GB 3I9SA 3S6GA 5HXDA 1YQEA 2B58A 4BBSI 5A27A 1VQ5Z 4Q36A 5LRKA 3JUWA 3M3YI 4BXXI 1FT7A 2VBQA 5J8CA 3FQMA 1RO2A 3IF8A 1VGYA 4CL1A 2RFHA 1S72Z 1YUKA 4OC3A 2EWBA 2IV2X 3JAMb 1YJN1 3KHXA 3CCUZ 3GTMI 4M85A 2P6GA 2B3UA 3IWWA 1VQL1 3G711 1TF9A 5LYDA 4NSQA 4X3RA 1I3QI 3S1RI 2HV2A 1CG2A 4NJRA 2R8VA 2DEAA 2JLMA 2FL4A 3PEIA 2OOTA 3KQZA 1Z9UA 3J80f 2JBJA 3J7A4 2NVQI 4R57A 5D8NA 1DE4C 3EFAA 2Q44A 4DK1A 3RBUA 1N71A 4UEZA 3CCVZ 2CTCA 1KZFA 1HDUA 4NJQA 3GUXA 2BSWA 3H5ZA 4MCSA 3S14I 2BJOA 3BLNA 4NBFA 2ZEHA 5DWNA 3IWEA 2RIQA 2W04A 5DS0A 2FCKA 4U9ZA 3S9LA 1PFTA 1Y1VS 2PJ4A 2WPWA 3PO3I 4MFJA 4NGSA 2OTLZ 1VHSA 3D68A 3G8WA 1JJ2Y 2Q4YA 2PCUA 1Y1WI 3R9EA 3KIHA 4FBEA 3CME1 1I12A 2CXAA 2F5IA 1RO5A 4KOSA 1Q862 3GCFA 4PSXA 2O4HA 2OR4A 4HGYA 4C68A 4MONA 4LUAA 1K732 2QREB 3S6HA 4UEFA 1VQP1 3D9XA 3I4NI 1YIT1 2QIRA 2PJ7A 3TFYA 4CAFA 1IY7A 4NGTA 2Q7BA 4FD4A 2HQYA 2J8RA 4DUKA 3VMHA 4HKFA 2CF4A 3D66A 4ZY0A 4YGOA 1CM0A 1KWMA 4E2AA 1CX8A 6CPAA 1WWZA 3F3FC 4LX9A 4OKOA 2DE5A 3GIUA 4X8IA 1ELLP 1Q821 2WB1A 5KTAA 4E33A 4BY7I 4A3JI 4F0YA 1VQPZ 1P9NA 1PU9A 1L0CA 4HPSA 1QVGY 4P45A 3PBEA 4Y7NI 3S1MI 4OC5A 1SIWA 4PXEA 5BWAB 3R96A 4JYWA 1Z01A 4B12A 1QSMA 3NDJA 2REEA 4QC6A 3PFOA 3A9LA 3RAMA 2Q4VA 1VQ81 1TFIA 1BO4A 5EMIA 4RUHA 1YITZ 3CC4Z 4CPAA 4AXVA 2FIWA 2ZEPA 3MZLB 2G0BA 3KI9A 1BPNA 2PJAA 2QVPA 4HNXB 1YREA 2ZENA 4UIAA 4CS0B 1R9TI 4MI4A 1YIJZ 4OC1A 2AFOA 4FAIA 2R6MA 1Z02A 3J80b 2IZ3A 4NH1C 3BHXA 2OTL1 1QYPA 5F47A 2AFSA 2WYRA 3H8GA 2K3RA 2GFQA 3CC2Z 4KS9A 4K30A 2AFMA 4NXYA 4XPKA 2CNTA 4CGNA 1X3ZA 3CMEZ 4X5KA 1HDQA 3GYAA 4X6AI 1YUAA 4DNCA 1CJWA 2IZ4A 1VHEA 1RLYA 2P3YA 4DGLA 2J9AA 4FD5A 4BMHA 5T6BA 5D29A 3T9YA 2PJBA 3CXCZ 1VQLZ 1NE9A 1YK3A 4R3LA 3R9FA 5LYFA 4CGOA 3NE7A 1YIJ1 2V8JA 4P6YA 5D1PA 1NSLA 2Q4ZA 3HKZA 2P6EA 2D4PA 3PP9A 5EBVA 5T64A 1FNOA 3TOAA 2Z3KA 4O23A 2Z3OA 1FY7A 1M44A 3DDDA 4MFQA 2E7ZA 3RZAA 3FQQA 3RYOA 3NA6A 2C27A 4IAVA 2AKLA 2AFUA 5IB9A 2JIMA 4P10A 1ELMP 4L89A 4A3DI 2ZW4A 3CCEZ 4C2YA 4M6HA 4L8AA 1AMPA 3HOXI 3SHPA 2Z3MA 1XRYA 1Q7Y1 2VPYA 4PQAA
chains in the Genus database with same CATH topology
2DE7A 4A3LI 1USPB 1Y0YA 4NGNA 1K8A1 3GTGI 2RBLA 1F57A 2C6GA 4E2YA 5C44I 2POKA 3H8EA 3CCJZ 2V8IA 3PO3S 3D7FA 1VQK1 3TX8A 4NGMA 4XX2A 3JRUA 1LFWA 4ZX8A 2RPRA 4ZY2A 2BCOA 1NUIA 4HGZA 1TWCI 4G1PA 4NGRA 3PB9X 5K8PA 1Z03A 3CD6Z 2XEGA 3GTMS 1TWAI 4EMEA 3EERA 4KSIA 3CCM1 4OC0A 3CPWY 4A37A 3CCQZ 1SFOI 1VQ8Z 3IFUA 3D6WA 2ZELA 4A3KI 4NB8A 2PJ6A 5LL6f 1ARMA 1N8R1 4YU9A 2HF1A 3RZDI 1VQ6Z 3S17I 2IMOA 3KL9A 3IJ3A 1KC82 4UIBA 4NBDA 2V8VA 1LAPA 3LWUA 3MRUA 4MD8A 3CCE1 3HOYI 1LANA 3BI1A 2EK8A 3FEEA 1VQ7Z 3CCV1 5A2Qf 3S2DI 3CCL1 1UWYA 1ZG9A 4OIDA 4ZYQA 5LYIA 4EWTA 3CC21 4A3CI 4R76A 2E9HA 3KQXA 4ZI6A 4DYOA 4F8ZA 3H0GI 3CC71 3S16I 2ZEEA 1VQ9Z 2PK7A 1R43A 3CCR1 4E2ZA 3JAMf 1K9M1 1XBUA 3S9MA 4MXUA 4P4DA 2F4MA 4GM5A 1KC81 3PB6X 2F8HA 4A3GI 5HXDA 1VQ91 3CCJ1 3I07A 2PJ9A 4BBSI 1RO0A 3FJUA 2QLVB 4BD9A 4OMEA 1VQ5Z 2EGTA 1WCMI 5LRKA 3M3YI 3DGVA 4EFDA 5C3EI 2NYQA 2QKDA 1VQO1 4BXXI 1FT7A 3FQMA 2AFXA 1VQ4Z 4P4IA 1RO2A 3V7ZA 3IF8A 1VGYA 3GKQA 4CL1A 2RFHA 1WIIA 3CCMZ 3G6EZ 3CCQ1 2GTIA 4PXBA 3I55Z 1S72Z 1YUKA 4E32A 3MONA 2EWBA 1YW4A 3MN8A 4OC3A 5JM6A 5AN9F 3BI0A 3JAMb 1YJN1 2GU2A 4RVFA 3SI2A 2V8GA 1KQSY 3K2KA 3K9TA 5HVFA 3G6E1 2GREA 3I1UA 3KHXA 3CCUZ 3GTMI 4MHZA 4P4JA 3IEHA 4Y52I 3QNVA 4FUUA 4MCQA 3OW2Z 4A3MI 4K3NA 1X0TA 3IWWA 1N2FA 2XEJA 1VQL1 3CDXA 3KZWA 3G711 1TF9A 5T67A 5LYDA 3VMGA 1K8A2 4MCPA 4X3RA 1I3QI 5THWA 4FWUA 3S1RI 3PO2I 1BAVA 1CG2A 1TKFA 4NJRA 1S7MA 3GTLI 5LRGA 5CPAA 1F2PA 2DEAA 1DTDA 1M4LA 1Q7Y2 2H85A 2P28A 4MRIA 3FVLA 4AYBA 3KIFA 3PEIA 3WC7A 2OOTA 3MZKB 1K83I 1WW9A 1QVFZ 3J80f 3VB9A 3KQZA 2C6CA 2JBJA 3PB8X 4E2XA 3J7A4 2HB6A 2NVQI 2Q51A 1GYTA 4S1TA 5D8NA 1CPXA 1M902 3PFEA 5C4JI 1Y7EA 1DE4C 3G71Z 4RVHA 1M1K1 3CCSZ 3Q87A 4DK1A 1KD11 2F7VA 3RBUA 2YU9I 4RVGA 2GLFA 2RB7A 2M48A 2PJ1A 3IO1A 3CCVZ 4UEZA 1TXRA 2CTCA 5IT9f 3WC6A 2ZEOA 1HDUA 2CIJA 4NJQA 1JJ2Z 3CCS1 3FMCA 3GUXA 3VARA 3GTKI 1AYEA 3CPWZ 3CCU1 4A94A 3ISZA 2OZKA 2JA8I 4MCSA 5ELYA 2ZOFA 3S14I 2BJOA 2BOAA 3FF3A 1Q861 4NBFA 2ZEHA 1YI21 4IHMA 4TWEA 3SI0A 2RIQA 4MD7A 4NBGA 2W04A 5D1OA 3GTOI 3B7IA 5DS0A 2LIYA 5CM2M 3S9LA 1PFTA 4DQYB 5FLXf 1Y1VS 2PJ4A 3CMA1 4NGPA 3PO3I 1YW6A 3EEDA 4NBCA 4NGSA 1YI2Z 4A3EI 1TWHI 2HU9A 1VQ51 2OTLZ 2AFZA 4P4FA 1QVFY 4LQGA 3D68A 3D67A 1RO4A 1VQOZ 3D4UA 2PJ3A 1TF8A 1I50I 3GLJA 3CMAZ 1JJ2Y 4OP4A 2PCUA 2E2JI 1Y1WI 3D7GA 3HOZI 5I4MA 3KIHA 3VH9A 4FBEA 3BG0B 1CBXA 3CME1 5IT9b 3KR4A 4WJBA 3WABA 2ZEDA 3I56Z 2QEXZ 2JUBA 2V8DA 1Q862 3GCFA 4JZ0A 2O4HA 3HOVI 2OR4A 1RNIA 1YLOA 3BG1B 2JS4A 2WAQA 1NP6A 4HGYA 1JQGA 7CPAA 4MONA 5IP9I 3ESWA 3VMIA 1TKJA 1K732 2JNYA 2QREB 3P5JB 3DLJA 4ZX9A 1LAMA 1NJI1 3SI1A 4H2KA 2GTHA 5FLXb 3GTQI 1Q811 4UEFA 1VQP1 3D9XA 1JWHC 3I4NI 2Q43A 1YIT1 4A3BI 4P4BA 2PJ7A 4P4EA 3SJGA 1VHOA 1QMUA 3FX6A 1IY7A 4NGTA 2FVGA 4E2WA 3CCLZ 4HH4A 3PRTA 3VMHA 4DUKA 1ZB9A 1YJW1 3VTNA 2CF4A 2F4OA 4PPZA 3D66A 4NBEA 2KPIA 4ZY0A 1VQMZ 2QA4Z 5D1OB 1CP6A 8CPAA 4B6ZA 3I551 3IC1A 4MCRA 1QF8A 4R6TA 3CT9A 1KWMA 1VLAA 3S1NI 5LRJA 2OOXB 2J6AA 1YSJA 3TC8A 2NSMA 2PJ8A 3GB0A 4MHPA 1CX8A 3FECA 6CPAA 2HC9A 3FKII 3KHZA 3I4MI 2R93I 4QTUA 1PYTB 1QVGZ 4OC4A 2PM9A 2E2HI 1ZH1A 1L1OC 4Q7AA 3F3FC 4OIWA 2YADA 2QEX1 1I6HI 3IIBA 2DE5A 4OKOA 2KI7B 3NFZA 1H8LA 4X8IA 3KASA 3TE5B 2PJCA 3N5FA 1Z8LA 1M901 1ELLP 1Q821 1VQ71 4A3FI 2WB1A 2PE3A 4TNUA 3PB4X 4X2TA 1S721 5LYLA 4NOZA 4E33A 2PJ5A 1YHQZ 2PRQA 2IJZA 3S2HI 4BY7I 2RT9A 1Y0RA 2ZEFA 3H3VJ 4A3JI 2QYVA 3GTJI 2JMOA 2JA7I 3LMSA 4NB9A 1VQPZ 1VQ61 1P9NA 1QVGY 2W03A 3GTPI 2C6PA 5K8OA 2PIYA 4P45A 3PBEA 1ZB8A 2NVXI 4Z65A 4YWYA 3U50C 4Y7NI 3S1MI 4OC5A 3QWUA 4PXEA 2M6NA 1Q822 2ZEGA 3NH8A 3S15I 1EE3P 4NBBA 5JH9A 4JYWA 1ZLIA 3PBBA 1HEEA 3CC7Z 1Z01A 4ZY1A 2ZEMA 2XEFA 3NDJA 4F9VA 1F2OA 2C1CA 2OOYB 3PFOA 2ABZA 3RAMA 1ZG8A 1VQ81 2QJ8A 1TFIA 3KR5A 2PJ2A 4E30A 4NGQA 4RUHA 4NBHA 1VIXA 1PCAA 2V8HA 4NBAA 1YITZ 3CC4Z 3HOWI 4CPAA 4AXVA 2DE6A 4WWVA 1USPA 3VATA 4A39A 1BPMA 2ZEPA 3MZLB 1NJI2 2VL1A 3KI9A 4A38A 2O53A 1YJWZ 1BPNA 2PJAA 3G4S1 3RZOI 1LOKA 3CD61 2QVPA 1BLLE 3B3CA 1YJNZ 1KQSZ 2R7ZI 1VQM1 4QTTA 2ZENA 1TWGI 4UIAA 2QA41 1R9TI 3S9NA 2CTBA 3T4NB 2QR1B 1YIJZ 4EWCA 2LFUA 2AFOA 4OC1A 4FAIA 2VUMI 2R6MA 1Z02A 5CBMA 3J80b 2IZ3A 2BO9A 4NH1C 3H8FA 1QQ9A 3HUVA 2E2II 2QRDB 3BHXA 1OBRA 3CC41 2OTL1 1QYPA 3NH4A 4R7MA 2V77A 4F9UA 4W9YA 1VQN1 3WT4A 1YMEA 5F09A 1N8R2 3B3SA 1ZLHA 2AFSA 4NFRA 2WYRA 2K3RA 3H8GA 5K8NA 2PVVA 2RHBA 2PJ0A 3CC2Z 4A3II 1NSAA 1R3NA 4MH4A 2AFMA 4RV9A 2NVTI 2JEWA 2G9DA 3PB7X 2WZNA 1VQ41 1X3ZA 3CMEZ 5K8MA 1M1K2 4PXDA 4R8FA 2NVYI 5A2Qb 1HDQA 1Z5RA 3CPAA 4BBRI 1YJ91 3B35A 5FLMI 3CCRZ 3HOUI 4MHNA 2GLJA 4X6AI 5HVGA 1ZG7A 3J81b 1ML8A 1YUAA 3IFEA 2ZAEB 2EK9A 4PXCA 2IZ4A 4MMOA 1VHEA 1RLYA 4P44A 2P3YA 4DGLA 2J9AA 5J1QA 3FEDA 3SJXA 2I3CA 4BY1I 2XEIA 5T6BA 1XFOA 1VQNZ 2AFWA 4ONWA 3IX0A 5D29A 2IQ6A 2PJBA 4OC2A 3CXCZ 1VQLZ 2ZOGA 1Q7LA 4UEEA 2OTJZ 1XMBA 5JGFA 3D7DA 3D7HA 5LYFA 3S1QI 2PMZA 2B63I 3NH5A 1RQFA 1YIJ1 2V8JA 1TKHA 4P6YA 3LUSA 5D1PA 2OTJ1 4MD9A 1KD12 2Q4ZA 1K9M2 3HKZA 3J81f 2V8KA 3K7AI 2G2KA 3CQZI 2VF1A 4DJLA 2JBKA 3CPXA 4IK2A 3F3PC 3ISXA 1CPSA 5T64A 1FNOA 3B3VA 5C4XI 4O23A 4RVDA 1XJOA 2JA5I 1CP7A 3SJFA 1KRLA 1DL6A 3RZAA 3FQQA 4UF4A 1W2BZ 3NA6A 1Y1VI 1TWFI 4IAVA 1YJ9Z 4MHYA 3WC5A 2AKLA 2JA6I 3M4OI 2AFUA 5IB9A 2R92I 3TDHB 1Q812 1LQLA 3I561 3L2NA 3G4SZ 1VQKZ 4P10A 1ELMP 2Y0SA 3B2YA 2QRCB 3OW2Y 1X3WA 4A3DI 4A93I 3HLPA 3CCEZ 1AMPA 1YHQ1 1K731 3KGQA 2ANPA 3T8WA 5HVHA 3SJEA 4RS4A 1IGBA 3B3WA 3HOXI 1W2BY 2JR6A 1RTQA 3NDIA 3BXMA 1XRYA 1ARLA 2PVWA 3CXCY 1Q7Y1 3V38A 2K5RA 4E31A 3FH4A 4PQAA 2PIZA 1Z2LA 2VUGA 1LCPA 5IP7I 3B3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0Y A;  4NGN A;  1F57 A;  2C6G A;  2POK A;  3H8E A;  3D7F A;  3TX8 A;  4NGM A;  3JRU A;  1LFW A;  4ZX8 A;  4ZY2 A;  2BCO A;  4G1P A;  4NGR A;  3PB9 X;  5K8P A;  2XEG A;  4EME A;  4KSI A;  4OC0 A;  4A37 A;  2ZEL A;  2PJ6 A;  1ARM A;  4YU9 A;  2IMO A;  3KL9 A;  3IJ3 A;  4UIB A;  2V8V A;  3MRU A;  1LAP A;  3LWU A;  1LAN A;  3BI1 A;  2EK8 A;  3FEE A;  1UWY A;  1ZG9 A;  4OID A;  4ZYQ A;  5LYI A;  4EWT A;  4R76 A;  3KQX A;  4ZI6 A;  4DYO A;  4F8Z A;  2ZEE A;  1R43 A;  1XBU A;  3S9M A;  4MXU A;  4P4D A;  4GM5 A;  3PB6 X;  2F8H A;  5HXD A;  2PJ9 A;  4BD9 A;  3FJU A;  4OME A;  5LRK A;  3DGV A;  4EFD A;  2NYQ A;  1FT7 A;  2AFX A;  4P4I A;  3V7Z A;  1VGY A;  2RFH A;  4PXB A;  4OC3 A;  2EWB A;  1YW4 A;  3MN8 A;  5JM6 A;  2GU2 A;  3SI2 A;  2V8G A;  3K2K A;  3K9T A;  5HVF A;  2GRE A;  3I1U A;  3KHX A;  4MHZ A;  4P4J A;  3IEH A;  3QNV A;  4FUU A;  4MCQ A;  4K3N A;  3IWW A;  2XEJ A;  3CDX A;  3KZW A;  1TF9 A;  5LYD A;  4MCP A;  4X3R A;  5THW A;  4FWU A;  1BAV A;  1CG2 A;  1TKF A;  4NJR A;  5LRG A;  5CPA A;  1F2P A;  2DEA A;  1DTD A;  1M4L A;  4MRI A;  3FVL A;  3PEI A;  3WC7 A;  2OOT A;  3KQZ A;  2C6C A;  2JBJ A;  3PB8 X;  2HB6 A;  2Q51 A;  1GYT A;  5D8N A;  1CPX A;  3PFE A;  1Y7E A;  1DE4 C;  2F7V A;  3RBU A;  2GLF A;  2RB7 A;  3IO1 A;  2PJ1 A;  4UEZ A;  1TXR A;  2CTC A;  3WC6 A;  2ZEO A;  1HDU A;  2CIJ A;  4NJQ A;  3GUX A;  3FMC A;  3VAR A;  1AYE A;  4A94 A;  3ISZ A;  4MCS A;  5ELY A;  2ZOF A;  2BOA A;  3FF3 A;  2ZEH A;  4IHM A;  4TWE A;  3SI0 A;  3B7I A;  5DS0 A;  3S9L A;  2PJ4 A;  4NGP A;  1YW6 A;  4NGS A;  4P4F A;  2AFZ A;  4LQG A;  3D68 A;  3D67 A;  3D4U A;  2PJ3 A;  1TF8 A;  3GLJ A;  4OP4 A;  2PCU A;  3D7G A;  5I4M A;  3VH9 A;  4FBE A;  1CBX A;  3KR4 A;  3WAB A;  4WJB A;  2ZED A;  2V8D A;  4JZ0 A;  2O4H A;  2OR4 A;  1YLO A;  1JQG A;  7CPA A;  1TKJ A;  4ZX9 A;  3DLJ A;  1LAM A;  3SI1 A;  4H2K A;  4UEF A;  2Q43 A;  4P4B A;  2PJ7 A;  4P4E A;  3SJG A;  1VHO A;  1QMU A;  3FX6 A;  1IY7 A;  4NGT A;  2FVG A;  3PRT A;  4DUK A;  2CF4 A;  4PPZ A;  3D66 A;  4ZY0 A;  1CP6 A;  8CPA A;  4B6Z A;  3IC1 A;  4MCR A;  4R6T A;  3CT9 A;  1KWM A;  5LRJ A;  1YSJ A;  3TC8 A;  2NSM A;  2PJ8 A;  3GB0 A;  4MHP A;  1CX8 A;  3FEC A;  6CPA A;  2HC9 A;  3KHZ A;  1PYT B;  4OC4 A;  4Q7A A;  4OIW A;  4OKO A;  3IIB A;  3NFZ A;  1H8L A;  4X8I A;  3KAS A;  2PJC A;  3N5F A;  1Z8L A;  1ELL P;  2PE3 A;  4TNU A;  3PB4 X;  4X2T A;  5LYL A;  2PJ5 A;  2PRQ A;  2IJZ A;  1Y0R A;  2ZEF A;  2QYV A;  3LMS A;  2C6P A;  5K8O A;  2PIY A;  4P45 A;  3PBE A;  4Z65 A;  4YWY A;  4OC5 A;  4PXE A;  2ZEG A;  3NH8 A;  1EE3 P;  5JH9 A;  4JYW A;  1ZLI A;  3PBB A;  1HEE A;  4ZY1 A;  2ZEM A;  2XEF A;  4F9V A;  1F2O A;  2C1C A;  3PFO A;  2ABZ A;  3RAM A;  1ZG8 A;  2QJ8 A;  3KR5 A;  2PJ2 A;  4NGQ A;  4RUH A;  1VIX A;  2V8H A;  1PCA A;  4CPA A;  4AXV A;  4WWV A;  3VAT A;  4A39 A;  1BPM A;  2ZEP A;  2VL1 A;  3KI9 A;  4A38 A;  2O53 A;  1BPN A;  2PJA A;  1LOK A;  2QVP A;  1BLL E;  3B3C A;  2ZEN A;  4UIA A;  3S9N A;  2CTB A;  4OC1 A;  2AFO A;  4FAI A;  5CBM A;  2BO9 A;  3H8F A;  1QQ9 A;  3HUV A;  3BHX A;  1OBR A;  3NH4 A;  4R7M A;  2V77 A;  4F9U A;  4W9Y A;  3WT4 A;  1YME A;  5F09 A;  3B3S A;  1ZLH A;  2AFS A;  4NFR A;  3H8G A;  2WYR A;  5K8N A;  2PVV A;  2PJ0 A;  1NSA A;  1R3N A;  2JEW A;  2AFM A;  2G9D A;  3PB7 X;  2WZN A;  5K8M A;  4PXD A;  4R8F A;  1Z5R A;  1HDQ A;  3CPA A;  3B35 A;  4MHN A;  2GLJ A;  5HVG A;  1ZG7 A;  3IFE A;  4PXC A;  2EK9 A;  4MMO A;  1VHE A;  4P44 A;  2J9A A;  5J1Q A;  3FED A;  3SJX A;  2I3C A;  2XEI A;  1XFO A;  2AFW A;  4ONW A;  5D29 A;  2IQ6 A;  2PJB A;  4OC2 A;  2ZOG A;  1Q7L A;  4UEE A;  1XMB A;  5JGF A;  3D7D A;  3D7H A;  5LYF A;  3NH5 A;  1TKH A;  4P6Y A;  2Q4Z A;  4DJL A;  2JBK A;  3CPX A;  4IK2 A;  3ISX A;  1CPS A;  1FNO A;  3B3V A;  4O23 A;  1XJO A;  3SJF A;  1CP7 A;  3RZA A;  4UF4 A;  3NA6 A;  4IAV A;  4MHY A;  3WC5 A;  2AFU A;  5IB9 A;  3L2N A;  4P10 A;  1ELM P;  3B2Y A;  3HLP A;  1AMP A;  3T8W A;  3KGQ A;  2ANP A;  5HVH A;  3SJE A;  1IGB A;  3B3W A;  1RTQ A;  3BXM A;  1XRY A;  1ARL A;  2PVW A;  3V38 A;  3FH4 A;  4PQA A;  2PIZ A;  1Z2L A;  3BI0 A;  1LCP A;  3B3T A; 
#chains in the Genus database with same CATH topology
 1FDO A;  5AG5 A;  2RBL A;  1F57 A;  2C6G A;  4MY0 A;  3H8E A;  1VQK 1;  1RXT A;  4XX2 A;  4ZX8 A;  4NGR A;  4II9 A;  2BUE A;  3PB9 X;  5CNP A;  5K8P A;  2XEG A;  3K9U A;  4EME A;  4MY3 A;  3IFU A;  2PJ6 A;  2IMO A;  3KL9 A;  3IJ3 A;  4NBD A;  3LWU A;  4MD8 A;  4KLV A;  3CCE 1;  3KKW A;  2EK8 A;  5A2Q f;  3S2D I;  4OID A;  1R57 A;  4A3C I;  4J3G A;  3TO9 A;  2E9H A;  3KQX A;  3CC7 1;  2JIP A;  1R43 A;  3B8G A;  4MXU A;  1V0C A;  4P4D A;  1KC8 1;  3MGD A;  3PB6 X;  5H84 A;  4A3G I;  3R95 A;  4OLL A;  5IV0 A;  3P2H A;  1RO0 A;  4BD9 A;  2QLV B;  2VI7 A;  2EGT A;  2NYQ A;  2QKD A;  4B10 A;  3QAH A;  4KLW A;  4GXH A;  1WII A;  3G6E Z;  2GTI A;  4PXB A;  4AVB A;  4R3K A;  5F46 A;  4XPD C;  5JM6 A;  2GU2 A;  4RVF A;  4KVX A;  3K9T A;  1KQS Y;  3SI2 A;  2GRE A;  1AUG A;  2EVN A;  4CAV A;  3W6S A;  4FD7 A;  3QNV A;  4MCQ A;  2ZXV A;  4A3M I;  4MJ8 A;  1X0T A;  2XEJ A;  3CDX A;  2DPS A;  5T67 A;  1MJB A;  3VMG A;  4KSF A;  1K8A 2;  2FXF A;  2KCW A;  4A32 A;  3PO2 I;  1S7M A;  5LRG A;  1DTD A;  1M4L A;  4ZGY B;  2H85 A;  1QSR A;  4MRI A;  3FVL A;  3FRM A;  3WC7 A;  5E96 A;  2Q7S A;  4E2X A;  3W6X A;  4MFL A;  1GYT A;  4S1T A;  1M90 2;  5C4J I;  1M1K 1;  2F7V A;  2PJ1 A;  4BIN A;  3FMC A;  3VAR A;  1Y9W A;  3CPW Z;  3CCU 1;  4A94 A;  2OZK A;  4KUA A;  3B7I A;  2H5M A;  4DQY B;  3CMA 1;  3EED A;  4P4F A;  4A3E I;  1TWH I;  4LQG A;  1RO4 A;  3F8K A;  3GLJ A;  3CMA Z;  1S60 A;  2E2J I;  4CGL A;  3D7G A;  3HOZ I;  1IYK A;  3VH9 A;  1CBX A;  3WAB A;  4YFJ A;  2ZED A;  5JQ4 A;  4JZ0 A;  3HOV I;  2JS4 A;  1JQG A;  5IP9 I;  3H4Q A;  3DLJ A;  1NJI 1;  3JTK A;  4H2K A;  3SI1 A;  5HMN A;  4E0A A;  1Q81 1;  1JWH C;  3SJG A;  1VHO A;  2FVG A;  3CCL Z;  2Z3P A;  1ZB9 A;  2FS5 A;  2ODF A;  4CAW A;  1MJ9 A;  4AVC A;  2OZG A;  4B6Z A;  4MCR A;  5HH1 A;  5LRJ A;  3BJ7 A;  2J6A A;  1YSJ A;  2NSM A;  3GB0 A;  2GAN A;  3FKI I;  4QTU A;  2E2H I;  1B6B A;  4OIW A;  4ONU A;  1Z8L A;  4RI1 A;  4A3F I;  2PE3 A;  3PB4 X;  2IL4 A;  4NOZ A;  2PJ5 A;  2RT9 A;  1Y0R A;  2ZEF A;  3H3V J;  3GTJ I;  4KOR A;  5G20 A;  2PSW A;  2W03 A;  3GTP I;  5FVJ A;  1MJA A;  5G22 A;  1IU8 A;  4E8O A;  3TCV A;  1ZB8 A;  2NVX I;  3DSB A;  3U50 C;  3QWU A;  2B4D A;  1Q82 2;  3NH8 A;  3S15 I;  3GKR A;  4NBB A;  3D8P A;  2GIV A;  4UFV A;  1IIC A;  2ZEM A;  2XEF A;  4MBU A;  2OOY B;  1A2Z A;  4R9M A;  2VQY A;  4JJX A;  2O28 A;  2WUU A;  2V8H A;  4B5O A;  4U9Y A;  3VAT A;  4XPD B;  2VL1 A;  2JIR A;  2ZW6 A;  3CZX A;  1YJW Z;  1LOK A;  3B3C A;  1YJN Z;  4YRH A;  1XMT A;  2QR1 B;  4EWC A;  2VUM I;  4GS4 A;  2BO9 A;  4FD6 A;  3H8F A;  4CGM A;  1QQ9 A;  5C82 A;  3HUV A;  4A33 A;  2QRD B;  1IB1 E;  5H86 A;  5ISV A;  4W9Y A;  1VQN 1;  5F09 A;  1N8R 2;  1ZLH A;  2V45 A;  5K8N A;  1NSA A;  3PB7 X;  2WZN A;  1M1K 2;  2EBJ A;  2NVY I;  5A2Q b;  4R8F A;  3CPA A;  4R87 A;  1YJ9 1;  5FLM I;  3FNC A;  1KUY A;  2GLJ A;  5HVG A;  1ZG7 A;  3J81 b;  4NF1 A;  2ZAE B;  2EK9 A;  1P0H A;  1M4D A;  1ON0 A;  2I3C A;  4BY1 I;  3TOB A;  3DR8 A;  4ONW A;  4OC2 A;  1Q7L A;  2P6F A;  3D7D A;  3D7H A;  4JXR A;  2OZH A;  2B63 I;  3I3G A;  3CXQ A;  1Q2Y A;  1IID A;  3K7A I;  2G2K A;  2PR8 A;  2JBK A;  3CPX A;  1IOI A;  4ZBG A;  3F3P C;  3ISX A;  1WK4 A;  1CPS A;  1XEB A;  3B3V A;  4MFP A;  1XJO A;  2JA5 I;  1CP7 A;  1KRL A;  3IU1 A;  1W2B Z;  1Q2C A;  2G3T A;  2R92 I;  1AA6 A;  4M6I A;  1LQL A;  3G4S Z;  1VQK Z;  4CYP A;  1X3W A;  2JDC A;  4A93 I;  3T8W A;  1YHQ 1;  3KGQ A;  3SJE A;  4RS4 A;  1IGB A;  1MK4 A;  1W2B Y;  3QAY A;  3NDI A;  4QVT A;  4U5Y A;  1Z2L A;  3B3T A;  1K8A 1;  1OZP A;  1Z8X A;  2POK A;  4CRZ B;  3CCJ Z;  2V8I A;  3PO3 S;  4NGM A;  3JRU A;  2ARH A;  2FT0 A;  2RPR A;  4ZY2 A;  4KOX A;  4PSW A;  4G1P A;  3CD6 Z;  2PQ8 A;  4KSI A;  4C2X A;  1Y7R A;  2ZEL A;  3E0K A;  5LL6 f;  3IR7 A;  2HF1 A;  3RZD I;  5AG4 A;  4B13 A;  3VWE A;  1KC8 2;  3MRU A;  4M3S A;  4KOW A;  1Z4R A;  3R1K A;  3FEE A;  3CCV 1;  1UWY A;  1ZG9 A;  3CCL 1;  5LYI A;  4AB7 A;  4DYO A;  4F8Z A;  4AVA A;  3H0G I;  3S16 I;  1VQ9 Z;  4OAE A;  3CCR 1;  4E2Z A;  1XBU A;  4UWJ A;  3S9M A;  2Q04 A;  2A4N A;  3CCJ 1;  3FJU A;  4H89 A;  4OME A;  1WCM I;  3DGV A;  2Z11 A;  2VPZ A;  1FDI A;  1VQ4 Z;  4P4I A;  1XE4 A;  2OH1 A;  1UFH A;  3I55 Z;  1Q16 A;  3MON A;  1YW4 A;  3MN8 A;  5AN9 F;  3VWD A;  1Z4E A;  3W91 A;  2V8G A;  5HVF A;  3G6E 1;  3UY5 A;  2D4O A;  4MHZ A;  4P4J A;  3F5B A;  2ZW7 A;  4Y52 I;  3OW2 Z;  4K3N A;  1N2F A;  3KZW A;  4MCP A;  4FWU A;  1TKF A;  3GTL I;  1F2P A;  2WSA A;  3R9G A;  5A28 A;  3GY9 A;  2REF A;  4Y49 C;  2PR1 A;  1I21 A;  1M4G A;  3S6K A;  3MZK B;  1K83 I;  1QVF Z;  4F0X A;  3VB9 A;  2C6C A;  3PB8 X;  2Q51 A;  1QSO A;  1CPX A;  2RC4 A;  1S5K A;  3CCS Z;  2GLF A;  2Z3L A;  4OAD A;  3P2F A;  2M48 A;  3BJ8 A;  1TXR A;  5IT9 f;  2CIJ A;  1AYE A;  1PUA A;  2CNS A;  2ZOF A;  2BOA A;  3FF3 A;  4IHM A;  1YI2 1;  4PK3 A;  4TWE A;  3SI0 A;  4NBG A;  3TE4 A;  2VPW A;  5CM2 M;  2K5T A;  5FLX f;  3EC4 A;  5AG6 A;  1M4I A;  1VQ5 1;  2AFZ A;  1QVF Y;  1VQO Z;  2PJ3 A;  1TF8 A;  4IUS A;  4B5P A;  4Q38 A;  1S7N A;  5I4M A;  3BG0 B;  3KR4 A;  5IT9 b;  2DF5 A;  1RNI A;  1NP6 A;  7CPA A;  3VMI A;  1TKJ A;  3P5J B;  2J8M A;  2GTH A;  4KUB A;  5FLX b;  3D2P A;  4A3B I;  4P4E A;  2G3A A;  2YNE A;  3VTN A;  2F4O A;  2KPI A;  4UCM A;  1NMT A;  2YND A;  4NEX A;  5D1O B;  2P0W A;  3IC1 A;  1VLA A;  4KVO E;  2OOX B;  3TC8 A;  4MHP A;  3FEC A;  4UFW A;  3I4M I;  1KUV A;  1QVG Z;  1PYT B;  4OC4 A;  2PM9 A;  3PZJ A;  2KI7 B;  3NFZ A;  1H8L A;  3OWC A;  3N5F A;  1M90 1;  1VQ7 1;  4TNU A;  4X2T A;  1YHQ Z;  2PRQ A;  1SQH A;  4QB9 A;  5AGE A;  2QYV A;  3LMS A;  1I1D A;  2NAP A;  2C6P A;  5K8O A;  2I00 A;  4Z65 A;  2B4D B;  2M6N A;  5F48 A;  1YVO A;  1EE3 P;  4PK2 A;  2PRB A;  2FE7 A;  2Z0Z A;  3PBB A;  3CC7 Z;  1QSN A;  2OZU A;  4ZY1 A;  4A31 A;  5AG7 A;  4F9V A;  2C1C A;  2ABZ A;  3KR5 A;  2PJ2 A;  4E30 A;  4B14 A;  2VZZ A;  4NGQ A;  4NBH A;  1PCA A;  3HOW I;  4WWV A;  1USP A;  4A39 A;  1BPM A;  1NJI 2;  4AG9 A;  3G4S 1;  2FSR A;  1KQS Z;  2R7Z I;  1VQM 1;  4QTT A;  2QA4 1;  1QXF A;  3S9N A;  2CTB A;  2LFU A;  1Z8W A;  2E2I I;  2DPT A;  3CC4 1;  1YX0 A;  1XIX A;  1QST A;  4R7M A;  2V77 A;  4JWP A;  4NFR A;  2R7H A;  3T90 A;  2PVV A;  2RHB A;  2PJ0 A;  1S3Z A;  1R3N A;  4MH4 A;  2NVT I;  2G9D A;  1VQ4 1;  5K8M A;  4IF5 A;  1Z5R A;  1IOF A;  4QUS A;  3HOU I;  4MHN A;  2PC1 A;  3IFE A;  2WPX A;  4PXC A;  4CRY B;  2VEZ A;  5J1Q A;  3FED A;  3SJX A;  2XEI A;  3FXT A;  4UWI A;  2AFW A;  5JPH A;  3IX0 A;  2IQ6 A;  2ZOG A;  4UEE A;  2OTJ Z;  5JGF A;  4KOT A;  3S1Q I;  3NH5 A;  1TKH A;  2OTJ 1;  4KVM E;  1KD1 2;  3QB8 A;  1K9M 2;  3J81 f;  2VF1 A;  1S7F A;  4RVD A;  4Y49 B;  1DL6 A;  4XNH B;  1Y1V I;  1TWF I;  1YJ9 Z;  4MHY A;  3WC5 A;  2YNC A;  4NCZ A;  3TDH B;  3B2Y A;  2QRC B;  4B11 A;  1S7L A;  5GCN A;  3DR6 A;  3HLP A;  2JR6 A;  3BXM A;  2PVW A;  5DWM A;  2K5R A;  4E31 A;  3FH4 A;  3SJF A;  2VUG A;  2JIQ A;  5IP7 I;  4CAX A;  2DE7 A;  4A3L I;  1Y0Y A;  4NGN A;  2FIA A;  2Q0Y A;  2Z3N A;  4UCN A;  1X10 A;  5I0C A;  2JEV A;  1TWC I;  1YVK A;  3V8I A;  3GTM S;  2CY2 A;  2OU2 A;  3EER A;  3FBU A;  3CCM 1;  4OC0 A;  3CCQ Z;  3D2L A;  1SFO I;  3D6W A;  4UCP A;  4YU9 A;  1VQ6 Z;  3S17 I;  5KTC A;  1LAP A;  3HOY I;  3TTH A;  4XPL A;  3FYN A;  4EWT A;  3CC2 1;  3LAC A;  1M1D A;  2PK7 A;  2R1I A;  3JAM f;  1XF8 A;  3DNS A;  3IWG A;  5EC4 A;  4JLY A;  2F4M A;  2VZY A;  4GM5 A;  2I79 A;  2F8H A;  1VQ9 1;  3I07 A;  4MFK A;  2PJ9 A;  5IB0 A;  1YGH A;  4EFD A;  5C3E I;  1VQO 1;  4MFZ A;  2PDO A;  2AFX A;  3V7Z A;  4KZT A;  4LQ6 A;  3GKQ A;  4HNW B;  2AJ6 A;  3CCM Z;  3F0A A;  3CCQ 1;  2VPX A;  4UBR A;  4E32 A;  2QEC A;  5G1Z A;  2Y0M A;  3K2K A;  3I1U A;  3SXN A;  2R98 A;  3IEH A;  2X7B A;  4FUU A;  3ZJ0 A;  4C7H A;  4C2Z A;  5THW A;  1BAV A;  2EO8 A;  5CPA A;  1Q7Y 2;  2P28 A;  2BEI A;  4KSA A;  4AYB A;  2CNM A;  4MHD A;  3KIF A;  5F49 A;  1WW9 A;  1Y9K A;  2HB6 A;  3FIX A;  1YR0 A;  3PFE A;  1Y7E A;  1X12 A;  3G71 Z;  4RVH A;  3Q87 A;  1KD1 1;  4PV6 A;  2YU9 I;  4RVG A;  2RB7 A;  1ZO0 A;  3IO1 A;  3D2M A;  3WC6 A;  2ZEO A;  1JJ2 Z;  3CCS 1;  3GTK I;  3JVN A;  3ISZ A;  2JA8 I;  5ELY A;  2BL1 A;  1Q86 1;  2AYD A;  4JXQ A;  3EY5 A;  4MD7 A;  5D1O A;  3GTO I;  2LIY A;  4NGP A;  4ORF A;  1YW6 A;  4NBC A;  1GHE A;  1YI2 Z;  2HU9 A;  3D67 A;  3D4U A;  1I50 I;  4OP4 A;  4WJB A;  3I56 Z;  2QEX Z;  2JUB A;  2V8D A;  2B3V A;  1JWQ A;  4HNY B;  4F6A A;  4EVY A;  1YLO A;  2QML A;  3BG1 B;  2GE3 A;  2WAQ A;  3CXS A;  3ESW A;  2JNY A;  4ZX9 A;  1LAM A;  4BBH A;  1S7K A;  3GTQ I;  2Q43 A;  4P4B A;  1QMU A;  3FX6 A;  4M6G A;  1Q2D A;  4E2W A;  4HH4 A;  2JIO A;  3PRT A;  1YJW 1;  4PPZ A;  2HUZ A;  4NBE A;  2DXQ A;  1VQM Z;  2QA4 Z;  1CP6 A;  1K4J A;  2YNC C;  8CPA A;  3I55 1;  4RN7 A;  1QF8 A;  4R6T A;  3CT9 A;  3S1N I;  2EUI A;  4CYO A;  2PJ8 A;  2HC9 A;  3KHZ A;  2R93 I;  1ZH1 A;  1L1O C;  4Q7A A;  2YAD A;  2QEX 1;  1I6H I;  3IIB A;  4UA3 A;  4QBJ A;  2ATR A;  3KAS A;  3TE5 B;  2PJC A;  4CYN A;  2NMT A;  5LYL A;  1S72 1;  3TO7 A;  2IJZ A;  3S2H I;  2Z10 A;  2JMO A;  2JA7 I;  4NB9 A;  3TT2 A;  1VQ6 1;  2PIY A;  3IU2 A;  4YWY A;  3EO4 A;  4KOU A;  1Y8C A;  3RO0 A;  2VXK A;  2ZEG A;  5JH9 A;  1ZLI A;  1HEE A;  1F2O A;  1ZG8 A;  2QJ8 A;  4A95 A;  4A30 A;  3LD2 A;  1VIX A;  4NBA A;  5C88 A;  2DE6 A;  1YLE A;  1J4J A;  4A38 A;  2O53 A;  3RZO I;  3CD6 1;  1BLL E;  4CAE A;  1TWG I;  2B5G A;  3T4N B;  5G21 A;  5CBM A;  3N7Z A;  4CGP A;  3LOD A;  1OBR A;  3ZZI A;  3NH4 A;  4F9U A;  3WT4 A;  1YME A;  3B3S A;  1U6M A;  4AG7 A;  4A3I I;  2JEW A;  2J8N A;  4RV9 A;  4PXD A;  4BBR I;  3B35 A;  3IGR A;  3CCR Z;  3S6F A;  1ML8 A;  3RNZ A;  4MMO A;  2B4B A;  3EXN A;  4P44 A;  2YGW A;  1B87 A;  1XFO A;  1VQN Z;  3FB3 A;  1LRZ A;  3PGP A;  1XMB A;  2ZW5 A;  2PMZ A;  1RQF A;  4I49 A;  4C7I A;  4UFX A;  3LUS A;  4MD9 A;  4JD6 A;  1TIQ A;  2V8K A;  3CQZ I;  4DJL A;  4IK2 A;  2OB0 A;  5C4X I;  4H6Z A;  4RS2 A;  2LEX A;  4UF4 A;  4B5P B;  4A2Z A;  3M4O I;  2JA6 I;  1BOB A;  3D3S A;  1IYL A;  1Q81 2;  3I56 1;  3L2N A;  1KUX A;  2Y0S A;  3TO6 A;  3WR7 A;  3OW2 Y;  3SXO A;  1K73 1;  2ANP A;  5HVH A;  3B3W A;  1XOV A;  1RTQ A;  1ARL A;  3NE8 A;  3CXC Y;  4XNH C;  3V38 A;  2ZPA A;  3C26 A;  2PIZ A;  3BI0 A;  1LCP A;  1WJ2 A;  3CXP A;  1USP B;  2AE6 A;  4H6U A;  3GTG I;  4E2Y A;  5IX3 A;  5C44 I;  3D7F A;  4CYQ A;  3TX8 A;  1LFW A;  1WZN A;  2BCO A;  1NUI A;  4HGZ A;  1Z03 A;  1TWA I;  4A37 A;  3CPW Y;  2V3V A;  1VQ8 Z;  4A3K I;  4NB8 A;  1ARM A;  1N8R 1;  1P4N A;  4UIB A;  2V8V A;  1LAN A;  3BI1 A;  5KTD A;  1VQ7 Z;  4KOY A;  5J8F A;  1Z8T A;  4ZYQ A;  1VKC A;  3G3S A;  4R76 A;  4ZI6 A;  4KOV A;  2ZEE A;  2JDD A;  1K9M 1;  2B5G B;  3I9S A;  3S6G A;  5HXD A;  1YQE A;  2B58 A;  4BBS I;  5A27 A;  1VQ5 Z;  4Q36 A;  5LRK A;  3JUW A;  3M3Y I;  4BXX I;  1FT7 A;  2VBQ A;  5J8C A;  3FQM A;  1RO2 A;  3IF8 A;  1VGY A;  4CL1 A;  2RFH A;  1S72 Z;  1YUK A;  4OC3 A;  2EWB A;  2IV2 X;  3JAM b;  1YJN 1;  3KHX A;  3CCU Z;  3GTM I;  4M85 A;  2P6G A;  2B3U A;  3IWW A;  1VQL 1;  3G71 1;  1TF9 A;  5LYD A;  4NSQ A;  4X3R A;  1I3Q I;  3S1R I;  2HV2 A;  1CG2 A;  4NJR A;  2R8V A;  2DEA A;  2JLM A;  2FL4 A;  3PEI A;  2OOT A;  3KQZ A;  1Z9U A;  3J80 f;  2JBJ A;  3J7A 4;  2NVQ I;  4R57 A;  5D8N A;  1DE4 C;  3EFA A;  2Q44 A;  4DK1 A;  3RBU A;  1N71 A;  4UEZ A;  3CCV Z;  2CTC A;  1KZF A;  1HDU A;  4NJQ A;  3GUX A;  2BSW A;  3H5Z A;  4MCS A;  3S14 I;  2BJO A;  3BLN A;  4NBF A;  2ZEH A;  5DWN A;  3IWE A;  2RIQ A;  2W04 A;  5DS0 A;  2FCK A;  4U9Z A;  3S9L A;  1PFT A;  1Y1V S;  2PJ4 A;  2WPW A;  3PO3 I;  4MFJ A;  4NGS A;  2OTL Z;  1VHS A;  3D68 A;  3G8W A;  1JJ2 Y;  2Q4Y A;  2PCU A;  1Y1W I;  3R9E A;  3KIH A;  4FBE A;  3CME 1;  1I12 A;  2CXA A;  2F5I A;  1RO5 A;  4KOS A;  1Q86 2;  3GCF A;  4PSX A;  2O4H A;  2OR4 A;  4HGY A;  4C68 A;  4MON A;  4LUA A;  1K73 2;  2QRE B;  3S6H A;  4UEF A;  1VQP 1;  3D9X A;  3I4N I;  1YIT 1;  2QIR A;  2PJ7 A;  3TFY A;  4CAF A;  1IY7 A;  4NGT A;  2Q7B A;  4FD4 A;  2HQY A;  2J8R A;  4DUK A;  3VMH A;  4HKF A;  2CF4 A;  3D66 A;  4ZY0 A;  4YGO A;  1CM0 A;  1KWM A;  4E2A A;  1CX8 A;  6CPA A;  1WWZ A;  3F3F C;  4LX9 A;  4OKO A;  2DE5 A;  3GIU A;  4X8I A;  1ELL P;  1Q82 1;  2WB1 A;  5KTA A;  4E33 A;  4BY7 I;  4A3J I;  4F0Y A;  1VQP Z;  1P9N A;  1PU9 A;  1L0C A;  4HPS A;  1QVG Y;  4P45 A;  3PBE A;  4Y7N I;  3S1M I;  4OC5 A;  1SIW A;  4PXE A;  5BWA B;  3R96 A;  4JYW A;  1Z01 A;  4B12 A;  1QSM A;  3NDJ A;  2REE A;  4QC6 A;  3PFO A;  3A9L A;  3RAM A;  2Q4V A;  1VQ8 1;  1TFI A;  1BO4 A;  5EMI A;  4RUH A;  1YIT Z;  3CC4 Z;  4CPA A;  4AXV A;  2FIW A;  2ZEP A;  3MZL B;  2G0B A;  3KI9 A;  1BPN A;  2PJA A;  2QVP A;  4HNX B;  1YRE A;  2ZEN A;  4UIA A;  4CS0 B;  1R9T I;  4MI4 A;  1YIJ Z;  4OC1 A;  2AFO A;  4FAI A;  2R6M A;  1Z02 A;  3J80 b;  2IZ3 A;  4NH1 C;  3BHX A;  2OTL 1;  1QYP A;  5F47 A;  2AFS A;  2WYR A;  3H8G A;  2K3R A;  2GFQ A;  3CC2 Z;  4KS9 A;  4K30 A;  2AFM A;  4NXY A;  4XPK A;  2CNT A;  4CGN A;  1X3Z A;  3CME Z;  4X5K A;  1HDQ A;  3GYA A;  4X6A I;  1YUA A;  4DNC A;  1CJW A;  2IZ4 A;  1VHE A;  1RLY A;  2P3Y A;  4DGL A;  2J9A A;  4FD5 A;  4BMH A;  5T6B A;  5D29 A;  3T9Y A;  2PJB A;  3CXC Z;  1VQL Z;  1NE9 A;  1YK3 A;  4R3L A;  3R9F A;  5LYF A;  4CGO A;  3NE7 A;  1YIJ 1;  2V8J A;  4P6Y A;  5D1P A;  1NSL A;  2Q4Z A;  3HKZ A;  2P6E A;  2D4P A;  3PP9 A;  5EBV A;  5T64 A;  1FNO A;  3TOA A;  2Z3K A;  4O23 A;  2Z3O A;  1FY7 A;  1M44 A;  3DDD A;  4MFQ A;  2E7Z A;  3RZA A;  3FQQ A;  3RYO A;  3NA6 A;  2C27 A;  4IAV A;  2AKL A;  2AFU A;  5IB9 A;  2JIM A;  4P10 A;  1ELM P;  4L89 A;  4A3D I;  2ZW4 A;  3CCE Z;  4C2Y A;  4M6H A;  4L8A A;  1AMP A;  3HOX I;  3SHP A;  2Z3M A;  1XRY A;  1Q7Y 1;  2VPY A;  4PQA A; 
#chains in the Genus database with same CATH homology
 2DE7 A;  4A3L I;  1USP B;  1Y0Y A;  4NGN A;  1K8A 1;  3GTG I;  2RBL A;  1F57 A;  2C6G A;  4E2Y A;  5C44 I;  2POK A;  3H8E A;  3CCJ Z;  2V8I A;  3PO3 S;  3D7F A;  1VQK 1;  3TX8 A;  4NGM A;  4XX2 A;  3JRU A;  1LFW A;  4ZX8 A;  2RPR A;  4ZY2 A;  2BCO A;  1NUI A;  4HGZ A;  1TWC I;  4G1P A;  4NGR A;  3PB9 X;  5K8P A;  1Z03 A;  3CD6 Z;  2XEG A;  3GTM S;  1TWA I;  4EME A;  3EER A;  4KSI A;  3CCM 1;  4OC0 A;  3CPW Y;  4A37 A;  3CCQ Z;  1SFO I;  1VQ8 Z;  3IFU A;  3D6W A;  2ZEL A;  4A3K I;  4NB8 A;  2PJ6 A;  5LL6 f;  1ARM A;  1N8R 1;  4YU9 A;  2HF1 A;  3RZD I;  1VQ6 Z;  3S17 I;  2IMO A;  3KL9 A;  3IJ3 A;  1KC8 2;  4UIB A;  4NBD A;  2V8V A;  1LAP A;  3LWU A;  3MRU A;  4MD8 A;  3CCE 1;  3HOY I;  1LAN A;  3BI1 A;  2EK8 A;  3FEE A;  1VQ7 Z;  3CCV 1;  5A2Q f;  3S2D I;  3CCL 1;  1UWY A;  1ZG9 A;  4OID A;  4ZYQ A;  5LYI A;  4EWT A;  3CC2 1;  4A3C I;  4R76 A;  2E9H A;  3KQX A;  4ZI6 A;  4DYO A;  4F8Z A;  3H0G I;  3CC7 1;  3S16 I;  2ZEE A;  1VQ9 Z;  2PK7 A;  1R43 A;  3CCR 1;  4E2Z A;  3JAM f;  1K9M 1;  1XBU A;  3S9M A;  4MXU A;  4P4D A;  2F4M A;  4GM5 A;  1KC8 1;  3PB6 X;  2F8H A;  4A3G I;  5HXD A;  1VQ9 1;  3CCJ 1;  3I07 A;  2PJ9 A;  4BBS I;  1RO0 A;  3FJU A;  2QLV B;  4BD9 A;  4OME A;  1VQ5 Z;  2EGT A;  1WCM I;  5LRK A;  3M3Y I;  3DGV A;  4EFD A;  5C3E I;  2NYQ A;  2QKD A;  1VQO 1;  4BXX I;  1FT7 A;  3FQM A;  2AFX A;  1VQ4 Z;  4P4I A;  1RO2 A;  3V7Z A;  3IF8 A;  1VGY A;  3GKQ A;  4CL1 A;  2RFH A;  1WII A;  3CCM Z;  3G6E Z;  3CCQ 1;  2GTI A;  4PXB A;  3I55 Z;  1S72 Z;  1YUK A;  4E32 A;  3MON A;  2EWB A;  1YW4 A;  3MN8 A;  4OC3 A;  5JM6 A;  5AN9 F;  3BI0 A;  3JAM b;  1YJN 1;  2GU2 A;  4RVF A;  3SI2 A;  2V8G A;  1KQS Y;  3K2K A;  3K9T A;  5HVF A;  3G6E 1;  2GRE A;  3I1U A;  3KHX A;  3CCU Z;  3GTM I;  4MHZ A;  4P4J A;  3IEH A;  4Y52 I;  3QNV A;  4FUU A;  4MCQ A;  3OW2 Z;  4A3M I;  4K3N A;  1X0T A;  3IWW A;  1N2F A;  2XEJ A;  1VQL 1;  3CDX A;  3KZW A;  3G71 1;  1TF9 A;  5T67 A;  5LYD A;  3VMG A;  1K8A 2;  4MCP A;  4X3R A;  1I3Q I;  5THW A;  4FWU A;  3S1R I;  3PO2 I;  1BAV A;  1CG2 A;  1TKF A;  4NJR A;  1S7M A;  3GTL I;  5LRG A;  5CPA A;  1F2P A;  2DEA A;  1DTD A;  1M4L A;  1Q7Y 2;  2H85 A;  2P28 A;  4MRI A;  3FVL A;  4AYB A;  3KIF A;  3PEI A;  3WC7 A;  2OOT A;  3MZK B;  1K83 I;  1WW9 A;  1QVF Z;  3J80 f;  3VB9 A;  3KQZ A;  2C6C A;  2JBJ A;  3PB8 X;  4E2X A;  3J7A 4;  2HB6 A;  2NVQ I;  2Q51 A;  1GYT A;  4S1T A;  5D8N A;  1CPX A;  1M90 2;  3PFE A;  5C4J I;  1Y7E A;  1DE4 C;  3G71 Z;  4RVH A;  1M1K 1;  3CCS Z;  3Q87 A;  4DK1 A;  1KD1 1;  2F7V A;  3RBU A;  2YU9 I;  4RVG A;  2GLF A;  2RB7 A;  2M48 A;  2PJ1 A;  3IO1 A;  3CCV Z;  4UEZ A;  1TXR A;  2CTC A;  5IT9 f;  3WC6 A;  2ZEO A;  1HDU A;  2CIJ A;  4NJQ A;  1JJ2 Z;  3CCS 1;  3FMC A;  3GUX A;  3VAR A;  3GTK I;  1AYE A;  3CPW Z;  3CCU 1;  4A94 A;  3ISZ A;  2OZK A;  2JA8 I;  4MCS A;  5ELY A;  2ZOF A;  3S14 I;  2BJO A;  2BOA A;  3FF3 A;  1Q86 1;  4NBF A;  2ZEH A;  1YI2 1;  4IHM A;  4TWE A;  3SI0 A;  2RIQ A;  4MD7 A;  4NBG A;  2W04 A;  5D1O A;  3GTO I;  3B7I A;  5DS0 A;  2LIY A;  5CM2 M;  3S9L A;  1PFT A;  4DQY B;  5FLX f;  1Y1V S;  2PJ4 A;  3CMA 1;  4NGP A;  3PO3 I;  1YW6 A;  3EED A;  4NBC A;  4NGS A;  1YI2 Z;  4A3E I;  1TWH I;  2HU9 A;  1VQ5 1;  2OTL Z;  2AFZ A;  4P4F A;  1QVF Y;  4LQG A;  3D68 A;  3D67 A;  1RO4 A;  1VQO Z;  3D4U A;  2PJ3 A;  1TF8 A;  1I50 I;  3GLJ A;  3CMA Z;  1JJ2 Y;  4OP4 A;  2PCU A;  2E2J I;  1Y1W I;  3D7G A;  3HOZ I;  5I4M A;  3KIH A;  3VH9 A;  4FBE A;  3BG0 B;  1CBX A;  3CME 1;  5IT9 b;  3KR4 A;  4WJB A;  3WAB A;  2ZED A;  3I56 Z;  2QEX Z;  2JUB A;  2V8D A;  1Q86 2;  3GCF A;  4JZ0 A;  2O4H A;  3HOV I;  2OR4 A;  1RNI A;  1YLO A;  3BG1 B;  2JS4 A;  2WAQ A;  1NP6 A;  4HGY A;  1JQG A;  7CPA A;  4MON A;  5IP9 I;  3ESW A;  3VMI A;  1TKJ A;  1K73 2;  2JNY A;  2QRE B;  3P5J B;  3DLJ A;  4ZX9 A;  1LAM A;  1NJI 1;  3SI1 A;  4H2K A;  2GTH A;  5FLX b;  3GTQ I;  1Q81 1;  4UEF A;  1VQP 1;  3D9X A;  1JWH C;  3I4N I;  2Q43 A;  1YIT 1;  4A3B I;  4P4B A;  2PJ7 A;  4P4E A;  3SJG A;  1VHO A;  1QMU A;  3FX6 A;  1IY7 A;  4NGT A;  2FVG A;  4E2W A;  3CCL Z;  4HH4 A;  3PRT A;  3VMH A;  4DUK A;  1ZB9 A;  1YJW 1;  3VTN A;  2CF4 A;  2F4O A;  4PPZ A;  3D66 A;  4NBE A;  2KPI A;  4ZY0 A;  1VQM Z;  2QA4 Z;  5D1O B;  1CP6 A;  8CPA A;  4B6Z A;  3I55 1;  3IC1 A;  4MCR A;  1QF8 A;  4R6T A;  3CT9 A;  1KWM A;  1VLA A;  3S1N I;  5LRJ A;  2OOX B;  2J6A A;  1YSJ A;  3TC8 A;  2NSM A;  2PJ8 A;  3GB0 A;  4MHP A;  1CX8 A;  3FEC A;  6CPA A;  2HC9 A;  3FKI I;  3KHZ A;  3I4M I;  2R93 I;  4QTU A;  1PYT B;  1QVG Z;  4OC4 A;  2PM9 A;  2E2H I;  1ZH1 A;  1L1O C;  4Q7A A;  3F3F C;  4OIW A;  2YAD A;  2QEX 1;  1I6H I;  3IIB A;  2DE5 A;  4OKO A;  2KI7 B;  3NFZ A;  1H8L A;  4X8I A;  3KAS A;  3TE5 B;  2PJC A;  3N5F A;  1Z8L A;  1M90 1;  1ELL P;  1Q82 1;  1VQ7 1;  4A3F I;  2WB1 A;  2PE3 A;  4TNU A;  3PB4 X;  4X2T A;  1S72 1;  5LYL A;  4NOZ A;  4E33 A;  2PJ5 A;  1YHQ Z;  2PRQ A;  2IJZ A;  3S2H I;  4BY7 I;  2RT9 A;  1Y0R A;  2ZEF A;  3H3V J;  4A3J I;  2QYV A;  3GTJ I;  2JMO A;  2JA7 I;  3LMS A;  4NB9 A;  1VQP Z;  1VQ6 1;  1P9N A;  1QVG Y;  2W03 A;  3GTP I;  2C6P A;  5K8O A;  2PIY A;  4P45 A;  3PBE A;  1ZB8 A;  2NVX I;  4Z65 A;  4YWY A;  3U50 C;  4Y7N I;  3S1M I;  4OC5 A;  3QWU A;  4PXE A;  2M6N A;  1Q82 2;  2ZEG A;  3NH8 A;  3S15 I;  1EE3 P;  4NBB A;  5JH9 A;  4JYW A;  1ZLI A;  3PBB A;  1HEE A;  3CC7 Z;  1Z01 A;  4ZY1 A;  2ZEM A;  2XEF A;  3NDJ A;  4F9V A;  1F2O A;  2C1C A;  2OOY B;  3PFO A;  2ABZ A;  3RAM A;  1ZG8 A;  1VQ8 1;  2QJ8 A;  1TFI A;  3KR5 A;  2PJ2 A;  4E30 A;  4NGQ A;  4RUH A;  4NBH A;  1VIX A;  1PCA A;  2V8H A;  4NBA A;  1YIT Z;  3CC4 Z;  3HOW I;  4CPA A;  4AXV A;  2DE6 A;  4WWV A;  1USP A;  3VAT A;  4A39 A;  1BPM A;  2ZEP A;  3MZL B;  1NJI 2;  2VL1 A;  3KI9 A;  4A38 A;  2O53 A;  1YJW Z;  1BPN A;  2PJA A;  3G4S 1;  3RZO I;  1LOK A;  3CD6 1;  2QVP A;  1BLL E;  3B3C A;  1YJN Z;  1KQS Z;  2R7Z I;  1VQM 1;  4QTT A;  2ZEN A;  1TWG I;  4UIA A;  2QA4 1;  1R9T I;  3S9N A;  2CTB A;  3T4N B;  2QR1 B;  1YIJ Z;  4EWC A;  2LFU A;  2AFO A;  4OC1 A;  4FAI A;  2VUM I;  2R6M A;  1Z02 A;  5CBM A;  3J80 b;  2IZ3 A;  2BO9 A;  4NH1 C;  3H8F A;  1QQ9 A;  3HUV A;  2E2I I;  2QRD B;  3BHX A;  1OBR A;  3CC4 1;  2OTL 1;  1QYP A;  3NH4 A;  4R7M A;  2V77 A;  4F9U A;  4W9Y A;  1VQN 1;  3WT4 A;  1YME A;  5F09 A;  1N8R 2;  3B3S A;  1ZLH A;  2AFS A;  4NFR A;  2WYR A;  2K3R A;  3H8G A;  5K8N A;  2PVV A;  2RHB A;  2PJ0 A;  3CC2 Z;  4A3I I;  1NSA A;  1R3N A;  4MH4 A;  2AFM A;  4RV9 A;  2NVT I;  2JEW A;  2G9D A;  3PB7 X;  2WZN A;  1VQ4 1;  1X3Z A;  3CME Z;  5K8M A;  1M1K 2;  4PXD A;  4R8F A;  2NVY I;  5A2Q b;  1HDQ A;  1Z5R A;  3CPA A;  4BBR I;  1YJ9 1;  3B35 A;  5FLM I;  3CCR Z;  3HOU I;  4MHN A;  2GLJ A;  4X6A I;  5HVG A;  1ZG7 A;  3J81 b;  1ML8 A;  1YUA A;  3IFE A;  2ZAE B;  2EK9 A;  4PXC A;  2IZ4 A;  4MMO A;  1VHE A;  1RLY A;  4P44 A;  2P3Y A;  4DGL A;  2J9A A;  5J1Q A;  3FED A;  3SJX A;  2I3C A;  4BY1 I;  2XEI A;  5T6B A;  1XFO A;  1VQN Z;  2AFW A;  4ONW A;  3IX0 A;  5D29 A;  2IQ6 A;  2PJB A;  4OC2 A;  3CXC Z;  1VQL Z;  2ZOG A;  1Q7L A;  4UEE A;  2OTJ Z;  1XMB A;  5JGF A;  3D7D A;  3D7H A;  5LYF A;  3S1Q I;  2PMZ A;  2B63 I;  3NH5 A;  1RQF A;  1YIJ 1;  2V8J A;  1TKH A;  4P6Y A;  3LUS A;  5D1P A;  2OTJ 1;  4MD9 A;  1KD1 2;  2Q4Z A;  1K9M 2;  3HKZ A;  3J81 f;  2V8K A;  3K7A I;  2G2K A;  3CQZ I;  2VF1 A;  4DJL A;  2JBK A;  3CPX A;  4IK2 A;  3F3P C;  3ISX A;  1CPS A;  5T64 A;  1FNO A;  3B3V A;  5C4X I;  4O23 A;  4RVD A;  1XJO A;  2JA5 I;  1CP7 A;  3SJF A;  1KRL A;  1DL6 A;  3RZA A;  3FQQ A;  4UF4 A;  1W2B Z;  3NA6 A;  1Y1V I;  1TWF I;  4IAV A;  1YJ9 Z;  4MHY A;  3WC5 A;  2AKL A;  2JA6 I;  3M4O I;  2AFU A;  5IB9 A;  2R92 I;  3TDH B;  1Q81 2;  1LQL A;  3I56 1;  3L2N A;  3G4S Z;  1VQK Z;  4P10 A;  1ELM P;  2Y0S A;  3B2Y A;  2QRC B;  3OW2 Y;  1X3W A;  4A3D I;  4A93 I;  3HLP A;  3CCE Z;  1AMP A;  1YHQ 1;  1K73 1;  3KGQ A;  2ANP A;  3T8W A;  5HVH A;  3SJE A;  4RS4 A;  1IGB A;  3B3W A;  3HOX I;  1W2B Y;  2JR6 A;  1RTQ A;  3NDI A;  3BXM A;  1XRY A;  1ARL A;  2PVW A;  3CXC Y;  1Q7Y 1;  3V38 A;  2K5R A;  4E31 A;  3FH4 A;  4PQA A;  2PIZ A;  1Z2L A;  2VUG A;  1LCP A;  5IP7 I;  3B3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...