4MRIA

Human brain aspartoacylase mutant f295s complex with intermediate analog (n-phosphonomethyl-l-aspartate)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
302
structure length
302
Chain Sequence
HIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEASAKTTKLTLNAKSIRCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Aspartoacylase catalytic deficiency as the cause of canavan disease: a structural perspective.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Aspartoacylase
total genus 94
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.15: Aspartoacylase.
pdb deposition date 2013-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.160 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4mriA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mriA01
4EMEA 2WZNA 3B35A 2PJ4A 2EK9A 4NGRA 4B6ZA 3B3VA 3FECA 2ZOFA 4P4FA 4TNUA 8CPAA 2IJZA 2C6PA 3PB9X 4YWYA 1IGBA 1YLOA 4UF4A 5DS0A 2XEGA 3WC7A 1OBRA 3VARA 3IO1A 1ZLHA 3B7IA 1BPMA 2ZEHA 3H8GA 2AFUA 2JBKA 2ABZA 4MHPA 5F09A 4JYWA 6CPAA 2NSMA 3WT4A 3NH5A 5LRJA 3BI1A 3BHXA 5LRGA 1DE4C 3TX8A 2PCUA 1BPNA 4P4EA 3KASA 2PVVA 2AFSA 1ELMP 4NGSA 4NFRA 3I1UA 3N5FA 4UEZA 1ZG9A 3PFEA 4MCPA 1VHOA 2OR4A 4UEEA 4DYOA 1VHEA 3SJEA 2HC9A 3D7GA 1PYTB 4UEFA 2ZEOA 2RFHA 4PXCA 3GUXA 3SI1A 2PRQA 2AFOA 4X2TA 4MMOA 1EE3P 4MCRA 3FEEA 4MHZA 4OMEA 4RUHA 5K8OA 4P45A 2GREA 4OC2A 1LOKA 5HVFA 1IY7A 4FAIA 4EFDA 2IQ6A 3VATA 4P4IA 2Q51A 3H8FA 5J1QA 3VH9A 4NJRA 3IJ3A 1DTDA 2JBJA 3KR5A 2PJ5A 4PXEA 4P4JA 3FEDA 2NYQA 2QVPA 1ZLIA 4OIDA 3PBBA 1LAMA 4OKOA 4A38A 5LYLA 1TKJA 4Q7AA 1CP7A 4O23A 2C6GA 2FVGA 4ZY0A 3NH8A 2AFWA 2G9DA 1LFWA 2Q4ZA 1ZG8A 4OC1A 3NFZA 1F2PA 3SI0A 1RTQA 3JRUA 3NA6A 1AYEA 1CPXA 2PJ1A 1TXRA 2RB7A 3D67A 4IAVA 1Y7EA 2I3CA 3PBEA 5D8NA 1M4LA 1HDQA 3KHXA 2VL1A 1CG2A 5HVGA 1BAVA 1LAPA 5IB9A 3D4UA 2C1CA 3CDXA 2BO9A 5HXDA 1Z8LA 5JH9A 7CPAA 1KWMA 3IIBA 2C6CA 3K2KA 4P44A 3HLPA 3PB7X 4MCSA 3KI9A 1CP6A 3PB6X 4KSIA 3TC8A 4R8FA 1HEEA 3NH4A 2ZEEA 4W9YA 1QMUA 4G1PA 5LRKA 2PVWA 4NGPA 3B3WA 1YMEA 2JEWA 2PJ0A 3QNVA 3ISZA 2PJ7A 4A39A 4FUUA 4ZX8A 4ZY2A 2EWBA 2CTBA 3PB8X 1YW6A 3B3TA 4OP4A 3WC5A 2WYRA 2ZEPA 4UIAA 3BI0A 4R76A 5JM6A 1LANA 4X3RA 2PJ6A 3CPAA 4H2KA 4NGMA 4IK2A 3B3CA 4P10A 2POKA 2ANPA 1XBUA 2V8DA 2PJ9A 5D29A 1R43A 4BD9A 3KHZA 1VGYA 1ARMA 3IC1A 3FVLA 4NGTA 3D7HA 4MRIA 2AFXA 4WWVA 2HB6A 1YW4A 3PFOA 3K9TA 4CPAA 4PQAA 5I4MA 1GYTA 2PJ2A 2V77A 4K3NA 2QJ8A 3L2NA 1NSAA 4OC3A 1LCPA 1BLLE 4EWTA 4MCQA 4PPZA 3DLJA 1XFOA 5LYFA 3WC6A 2ZELA 3S9MA 1TKFA 4OC4A 3DGVA 2ZEDA 3IEHA 4MXUA 2PJ8A 1XMBA 3B3SA 4OC0A 1XRYA 3BXMA 1QQ9A 3LMSA 1AMPA 2ZEMA 1UWYA 4WJBA 4AXVA 3FH4A 5THWA 4ONWA 2PJBA 1VIXA 1FNOA 2EK8A 3KQZA 4R7MA 4F9UA 4OIWA 4OC5A 1XJOA 3HUVA 1ZG7A 2O4HA 3D66A 1F57A 2BOAA 1ARLA 3KQXA 2DEAA 4PXBA 4A37A 3V38A 3MN8A 2GLJA 2ZEGA 3LWUA 2PIYA 5LYIA 3S9NA 4YU9A 2PE3A 2V8VA 5HVHA 4FWUA 2AFZA 2CIJA 3D7FA 3KR4A 4NGNA 5ELYA 2GU2A 2AFMA 3FMCA 4NJQA 4LQGA 4F9VA 1Z5RA 3MRUA 4R6TA 2V8GA 3H8EA 5CBMA 3KL9A 3GB0A 4MHNA 2F8HA 2PJ3A 4MHYA 3FJUA 4Z65A 3RZAA 1H8LA 3FX6A 3FF3A 3KZWA 5CPAA 2ZENA 4X8IA 2J9AA 3IWWA 3RBUA 4IHMA 3D68A 3GLJA 4P6YA 2ZOGA 1TF9A 3WABA 4P4DA 2GLFA 2XEJA 5LYDA 4PXDA 4TWEA 2XEFA 1CX8A 3IFEA 1TKHA 1R3NA 2PIZA 5K8MA 3S9LA 3ISXA 3CT9A 3RAMA 4JZ0A 3PB4X 1Y0RA 1TF8A 2ZEFA 2Q43A 1CBXA 1JQGA 3SJGA 4NGQA 4A94A 4ZY1A 3T8WA 3CPXA 2XEIA 5JGFA 2OOTA 4ZI6A 3B2YA 2CF4A 3SJXA 2CTCA 4DJLA 4UIBA 4F8ZA 4ZX9A 1PCAA 3SI2A 2V8HA 2O53A 1HDUA 4ZYQA 4GM5A 2F7VA 1CPSA 1YSJA 2PJAA 2PJCA 2QYVA 1Z2LA 5K8NA 4P4BA 3KGQA 3V7ZA 3PEIA 3SJFA 4FBEA 3D7DA 1Q7LA 1FT7A 1F2OA 2BCOA 2IMOA 4DUKA 1ELLP 1Y0YA 5K8PA 3PRTA
chains in the Genus database with same CATH superfamily
2VPXA 3TDHB 2PJ4A 1RO5A 2JLMA 4P4FA 4NBGA 4YRHA 3PB9X 4YWYA 3CCLZ 1YQEA 2ARHA 2Z0ZA 3VMGA 5DS0A 3EEDA 3B8GA 4C2YA 2WPWA 4ONUA 1N2FA 4B11A 1BOBA 3H8GA 3KIFA 4GS4A 3WT4A 1V0CA 5LRGA 3VMIA 4P4EA 4HNYB 2J6AA 3EERA 4CAWA 4MCPA 4MY3A 2OR4A 1WW9A 1TWFI 4QTUA 1QVGY 2B3VA 2ZEOA 4PXCA 1VQ5Z 2HQYA 5F46A 4E32A 3I551 1FY7A 4EVYA 4RN7A 1EE3P 4XNHB 1UFHA 5K8OA 2OTJ1 4UCNA 1LOKA 1Q7Y2 4P4IA 4QC6A 1QSRA 1NE9A 3FBUA 3VH9A 4NH1C 4CRYB 3DNSA 1I21A 2NYQA 4A3CI 1I12A 1WIIA 3VB9A 4OIDA 3PBBA 4A38A 4YFJA 3S16I 5LYLA 4RI1A 2FVGA 1KC81 2VPYA 1S5KA 3F3PC 4PK3A 2JIOA 2Q4ZA 1K4JA 4QUSA 3S14I 2V3VA 3SI0A 3IF8A 3F8KA 3GIUA 4KVXA 4CRZB 1WCMI 3CQZI 4UCPA 3JVNA 1K731 2R92I 4OADA 3ESWA 3HOYI 1MJBA 4NOZA 1RLYA 1X0TA 5C3EI 2VL1A 1CG2A 5AGEA 5HVGA 1RNIA 3CCE1 1LAPA 1YX0A 3CDXA 1XF8A 5JH9A 7CPAA 1USPA 2Z3KA 1VQO1 3BJ7A 1YJ9Z 3RZDI 3CCRZ 3D3SA 4KLWA 4R8FA 5AN9F 1QSNA 1HEEA 3NH4A 3S2DI 1J4JA 4G1PA 3FXTA 3RO0A 3Q87A 2PJ0A 3QNVA 3ISZA 2G0BA 2QA41 2JDDA 1Z8XA 2P0WA 3TOBA 4XPKA 2QRDB 4ZY2A 2EWBA 2KI7B 1Q861 1YREA 4OP4A 3WC5A 2ZEPA 4UIAA 1N8R2 3G711 1ON0A 2VPWA 2Q04A 1LANA 4H2KA 4CGLA 2KCWA 1VQ71 1YI2Z 2Z3PA 3I3GA 3G8WA 2H5MA 2PC1A 4IK2A 4R3LA 2ANPA 1XBUA 1TWAI 2V8DA 5D29A 1YJN1 1YK3A 3TE5B 4PSWA 3CC41 4Y7NI 1GYTA 2QEXZ 3S15I 4KS9A 2OH1A 2M6NA 3PP9A 4E2ZA 3J81b 4EWTA 2PR1A 2RBLA 2HU9A 1TWGI 1TKFA 4OC4A 4CAEA 4UWJA 2JIRA 1XMBA 3MGDA 4B13A 1FDIA 1FDOA 3T4NB 1TWHI 2YNDA 3VWEA 1VHSA 2PJBA 4E33A 3KQZA 4PV6A 4F9UA 2Z11A 3CC71 3PO3I 4XNHC 3V8IA 4JXRA 3D66A 2WAQA 1F57A 4I49A 3U50C 4BBHA 4IUSA 3D2MA 1VQ61 2ZW4A 3BG0B 4A37A 4NB8A 3V38A 1RO2A 1LRZA 1QVGZ 1QSTA 4LQ6A 2PIYA 1ML8A 1XIXA 4B5PB 4YU9A 2PE3A 4FWUA 2P3YA 3D7FA 1U6MA 5ELYA 2JS4A 1CM0A 2GU2A 3FMCA 4NJQA 4R6TA 5CBMA 4A32A 3GB0A 4ZBGA 4MJ8A 3G6EZ 5IB0A 3NDIA 3E0KA 3FJUA 1RO4A 2OOYB 4U9YA 4NBCA 1Z8WA 4E2XA 5A2Qf 3GTPI 2ZENA 2Q4YA 1NMTA 2FIWA 3PZJA 3RZOI 4AVBA 1AA6A 3GLJA 4P6YA 5JPHA 2ZOGA 4C2XA 4P4DA 1S72Z 5LYDA 3CPWZ 2X7BA 2PIZA 2DPSA 4OAEA 4B14A 2K3RA 2GFQA 3CT9A 4KOSA 2DPTA 5T67A 4JZ0A 1Q812 3GKQA 5IX3A 1VQN1 3GTJI 3CME1 1KC82 4ZY1A 4RVDA 4R9MA 2VBQA 3T8WA 4C68A 1KUVA 3B2YA 2CF4A 3SXNA 4DJLA 4QB9A 4UIBA 1IOIA 2VZZA 3M4OI 4ZX9A 1PCAA 1IOFA 2OZUA 5D1PA 4ZYQA 2VEZA 4HGYA 2PJCA 2E2HI 2WSAA 2CNTA 4DQYB 3RNZA 3V7ZA 3D7DA 1VQ7Z 3CCJZ 1S60A 2FIAA 1Y1WI 4E0AA 4A3KI 4B12A 1Y0YA 3MONA 3PRTA 4EMEA 3QAHA 3FIXA 4NGRA 4B6ZA 3B3VA 1QVFY 4TNUA 3HOVI 8CPAA 2C6PA 1YJW1 2JA7I 1YLOA 4K30A 1X3ZA 2B4DB 4UF4A 1WK4A 3VARA 4KUBA 3B7IA 3FQMA 1BPMA 3J7A4 2ABZA 1IIDA 2O28A 2QKDA 2BJOA 3HOZI 1GHEA 2NSMA 3NH5A 4KSFA 1Q16A 4R3KA 3BHXA 1DE4C 3TX8A 2PCUA 4NSQA 3CXCY 2AFSA 1YJ91 3I56Z 1ZG9A 3IFUA 1Q2DA 2YGWA 3VMHA 1VQ51 2ZXVA 4UEEA 1Q822 3SJEA 2HV2A 1PYTB 4UEFA 2RFHA 1USPB 4LUAA 2W04A 4MFZA 3IWEA 4KOTA 3SI1A 2PRQA 2R7ZI 2AFOA 2ZPAA 5H86A 1IYKA 4X2TA 2PRBA 4MMOA 4NXYA 4MHZA 4OMEA 1M901 3GYAA 4P45A 4OC2A 2A4NA 4CGOA 4EFDA 1QYPA 4U9ZA 3VATA 4NEXA 5KTCA 2Z3NA 2Q4VA 4NJRA 1DTDA 3KR5A 2PJ5A 4PXEA 3FEDA 2QVPA 1ZLIA 2ATRA 2WPXA 4OKOA 5AG5A 3DR6A 2V45A 1M1K1 4HNWB 3D9XA 2C6GA 4S1TA 3CCV1 4KORA 2E9HA 2G9DA 3FQQA 1ZG8A 2YU9I 3NFZA 4ZGYB 4UFVA 2R93I 1Z8TA 1KRLA 2PK7A 4X5KA 3JRUA 1MJ9A 3SXOA 2PJ1A 1TXRA 2RB7A 1PUAA 1VQ9Z 4IAVA 1Y7EA 2I3CA 5D8NA 3KHXA 4L8AA 1K9M1 4A3GI 2FE7A 1AUGA 5FLXf 5IB9A 1YHQZ 1Q2CA 3P2HA 2EBJA 4NB9A 3J80b 3PB7X 2ZW7A 3I561 4MCSA 3KI9A 1CP6A 1L1OC 2PMZA 1VQMZ 4W9YA 3CMA1 1QMUA 2CNSA 2NVYI 4DGLA 1QVFZ 2NMTA 5GCNA 2PR8A 2PJ7A 4A39A 3S6GA 1VKCA 2ZW6A 2E2II 4CGPA 2OZKA 3TO6A 4C7HA 2CTBA 4R87A 2Y0MA 1RO0A 4J3GA 3CCS1 3PGPA 4R76A 1JWQA 1W2BY 4NGMA 1YVOA 3B3CA 1XEBA 2POKA 1YIJZ 4RV9A 2EUIA 2IZ3A 1R43A 2RIQA 2AKLA 3KHZA 1ARMA 3F3FC 4NGTA 3TO9A 3D8PA 1Z4EA 2D4PA 3NE8A 4XX2A 2PJ2A 2V77A 1ZB9A 3ZJ0A 2FT0A 2QJ8A 1NSAA 1VQK1 2B5GB 4PPZA 4KOVA 1S7NA 4JLYA 3DLJA 3CCM1 1XFOA 3H0GI 4UWIA 4CAVA 3S9MA 4BBSI 1KUYA 3I9SA 2ZEDA 3IEHA 2R1IA 4RS2A 3I4NI 1YHQ1 1YUKA 3IX0A 4OC0A 1XRYA 4UFWA 3BXMA 4M6HA 3LMSA 1AMPA 2CNMA 3HOXI 5C44I 3GTMS 1M1DA 3GTGI 2EK8A 3CCUZ 4OIWA 2QECA 2CY2A 1Y8CA 4A3JI 3HOWI 3BJ8A 3CXQA 2B63I 4PXBA 2PQ8A 3QWUA 5FLXb 2I00A 1M4GA 2FL4A 5E96A 1TIQA 3G4SZ 5LYIA 2H85A 4R57A 2B58A 4CAFA 2VQYA 1KD11 1BO4A 3CCJ1 2PSWA 3CD6Z 2OTL1 3GTKI 4RVFA 4XPLA 3FRMA 4UBRA 4LQGA 3S1MI 2IV2X 4F9VA 3MRUA 2V8GA 3H8EA 2F8HA 2BL1A 2Z3OA 4MHYA 4HGZA 2JDCA 3CCU1 3FYNA 3FX6A 2B3UA 3FF3A 3IWGA 4X8IA 3D6WA 4KZTA 2K5TA 1YR0A 3J80f 4F6AA 2FXFA 2XEJA 3P5JB 1NJI1 3F5BA 1CX8A 1VQP1 2PM9A 5F47A 1IICA 4A3DI 1S7MA 3CD61 2Y0SA 3FB3A 4PSXA 4A3EI 3P2FA 3DSBA 4GXHA 2ZEFA 1XMTA 2J8MA 3SJGA 4M6GA 3W6XA 2G2KA 2IL4A 1X3WA 3CPXA 2XEIA 3TE4A 2YNCA 1VQM1 5JGFA 4A95A 2CTCA 3R96A 4FD5A 2JEVA 5DWNA 4AG9A 2FCKA 1QSMA 3SI2A 3IU2A 3EC4A 3H5ZA 3C26A 1QSOA 5DWMA 2EO8A 1YIT1 5AG6A 4RVHA 5D1OA 2B4BA 3PEIA 2J8RA 5H84A 1Q7LA 1TFIA 4AYBA 3S6FA 3TCVA 2BCOA 3DDDA 2IMOA 5LL6f 4CYQA 3CCQ1 4B10A 2WZNA 3B35A 2EK9A 1W2BZ 5C4XI 2ZOFA 5BWAB 1IYLA 3CC2Z 2REEA 4E2YA 1IGBA 4MFLA 3WC7A 2XEGA 1OBRA 4JWPA 3IO1A 1ZLHA 1S7KA 4QBJA 2F4MA 2ZEHA 2GE3A 2AFUA 2JBKA 2VF1A 4JYWA 6CPAA 1VQ8Z 5LRJA 3BI1A 1ZO0A 1BPNA 4JD6A 3KASA 3M3YI 3I4MI 2PVVA 1ELMP 4NGSA 4NFRA 3I1UA 3JAMb 4ORFA 5C4JI 1VHOA 5KTAA 3W6SA 4DYOA 2HUZA 3D7GA 1K8A1 3K9UA 4Y49B 3CCL1 2J8NA 2DE7A 5C82A 2VUGA 2G3AA 4UFXA 3FEEA 5CNPA 3KIHA 5HVFA 2QR1B 2Z3MA 2IQ6A 4XPDB 1JJ2Y 2Q51A 1RXTA 3H8FA 5J1QA 3HKZA 3IJ3A 2BSWA 2JBJA 4IF5A 1NP6A 3S2HI 2G3TA 3CCQZ 2KPIA 4KLVA 4BY1I 2NVXI 1TKJA 4Q7AA 1KUXA 4O23A 1I3QI 4ZY0A 2V8IA 3GKRA 1M1K2 2AFWA 2EGTA 3CCR1 1B6BA 4MD7A 4OC1A 4A3FI 2PDOA 1F2PA 1SIWA 3BG1B 2K5RA 1S721 2W03A 4LX9A 1VQL1 4MFKA 1K9M2 1AYEA 4X6AI 3D67A 3NE7A 3D4UA 3CCSZ 5HXDA 1RQFA 3SHPA 3OW2Y 4FD4A 3K2KA 4P44A 3BLNA 2Q44A 1YJNZ 4E2AA 1MK4A 4KSIA 2ZEEA 5LRKA 2PVWA 3B3WA 1YMEA 3G6E1 4BINA 4A33A 4FUUA 1K8A2 1QF8A 2QA4Z 3B3TA 2QMLA 4A3BI 3BI0A 2B5GA 5JM6A 1VQKZ 2AE6A 2PJ6A 2JA5I 1TWCI 4H6UA 3RYOA 2OTLZ 2OTJZ 5C88A 4BD9A 1VGYA 4AVCA 4UCMA 3QAYA 1Z01A 1IB1E 4MRIA 1K83I 2AFXA 4WWVA 1OZPA 5HH1A 3CMEZ 1Z02A 2HB6A 1YW4A 4A3II 3PFOA 4PQAA 2DXQA 2QRCB 3D2PA 4K3NA 3EY5A 1LCPA 3TFYA 4MCQA 1Y9WA 1M902 2VI7A 3DGVA 2WB1A 4MXUA 2REFA 3B3SA 1QQ9A 3S1NI 1UWYA 2R7HA 3FH4A 2R98A 1Y9KA 5THWA 1XOVA 4NBHA 1VIXA 5EMIA 3H3VJ 2DE5A 1Q811 1I6HI 2JA6I 1B87A 2F4OA 4DNCA 2O4HA 3G3SA 3S6KA 3CMAZ 1ARLA 3KQXA 2JMOA 2DEAA 3J81f 3MN8A 4A30A 2ZAEB 2VPZA 2GLJA 2ZEGA 2AYDA 2YNCC 3S9NA 4BY7I 2V8VA 5HVHA 5D1OB 5IP9I 2AFZA 4NGNA 5FVJA 3R9GA 2DE6A 1I50I 3H4QA 2Z10A 4KVOE 1VQ4Z 4H6ZA 3WR7A 2P6EA 3RZAA 1H8LA 2LIYA 1VQ6Z 3LODA 1ZH1A 3KZWA 3GCFA 2E2JI 3IWWA 3RBUA 3D68A 2NAPA 3LUSA 3R9EA 3G4S1 2XEFA 2P6FA 1WZNA 3IFEA 2ODFA 1YI21 3UY5A 5K8MA 3GTMI 3S9LA 1R9TI 4NBFA 1TF8A 2JR6A 3KKWA 2NVQI 5G21A 4MFPA 3IGRA 2JIMA 4NGQA 4A94A 3R9FA 2OOXB 3EO4A 4CL1A 4OLLA 1X12A 2FS5A 2JNYA 4H89A 5J8CA 1JJ2Z 1NUIA 4EWCA 5EC4A 4NBDA 1MJAA 1VLAA 3TTHA 2V8HA 2O53A 1S7LA 1HDUA 5AG7A 2I79A 5G1ZA 4M3SA 3W91A 3JTKA 4CAXA 4CYNA 1YSJA 2PJAA 1Z2LA 1M44A 5K8NA 4P4BA 3KGQA 4KOUA 4MFQA 4AVAA 3D2LA 1FT7A 1F2OA 3EXNA 2YNEA 2JA8I 3TO7A 5IP7I 1ELLP 1VQNZ 5EBVA 4MD8A 3R1KA 5J8FA 1VQ81 1M4DA 4HKFA 3FECA 4Y52I 2AJ6A 4MI4A 1M4IA 2IJZA 4CGNA 3A9LA 2V8JA 2P28A 1YJWZ 3QB8A 4II9A 4B5PA 2RPRA 4MHPA 5F09A 4HPSA 4MD9A 1KD12 1YVKA 5IT9f 1YGHA 3CPWY 3CXCZ 3S1QI 2IZ4A 3N5FA 4UEZA 3CXSA 3PFEA 3T90A 2QLVB 1VHEA 3S1RI 2HC9A 5T6BA 3GUXA 4MCRA 4RUHA 2GREA 1IY7A 4UA3A 4FAIA 3LACA 4FD7A 2RT9A 3CCEZ 3JUWA 1NSLA 4Q36A 3ZZIA 4P4JA 2DF5A 2Q7SA 1LAMA 4CYPA 2CXAA 1QXFA 1CP7A 3CC4Z 3HOUI 4CYOA 2QREB 4MFJA 3NH8A 3MZKB 3I07A 2OZGA 1LFWA 2F5IA 1VQLZ 1WJ2A 1X10A 3F0AA 1R57A 2OB0A 2OZHA 4MHDA 1RTQA 4MY0A 2Z3LA 2HF1A 3NA6A 2VXKA 3GTLI 1PU9A 2ZW5A 1CPXA 1Y7RA 1SQHA 1Q862 3PBEA 1NJI2 1M4LA 1HDQA 1A2ZA 4AG7A 1BAVA 1P4NA 4NBAA 2C1CA 1Y1VS 2GIVA 2BO9A 1Q821 1Z8LA 4E31A 3MZLB 1S3ZA 1KWMA 3IIBA 5IV0A 2C6CA 4A93I 3HLPA 5ISVA 5FLMI 3FNCA 3PB6X 3TC8A 3CCVZ 1KZFA 4C2ZA 4NGPA 2JEWA 2WUUA 2LFUA 3I55Z 4ZX8A 1Z03A 1N8R1 4KSAA 2JUBA 1I1DA 5IT9b 1YW6A 3PB8X 3PO3S 3DR8A 2WYRA 4E2WA 1YITZ 2LEXA 1K732 1XE4A 4XPDC 3OWCA 2VUMI 3JAMf 4X3RA 3CPAA 3IU1A 5F49A 4B5OA 2V8KA 4CS0B 4P10A 4YGOA 1IU8A 3K7AI 2PJ9A 1VQ41 1YLEA 3IC1A 3FVLA 2C27A 1YUAA 5T64A 4NCZA 3D7HA 3CC7Z 4M85A 4Q38A 3K9TA 4CPAA 5I4MA 3TOAA 3N7ZA 4NF1A 3L2NA 2R6MA 3EFAA 1Y1VI 4OC3A 1BLLE 3VWDA 4BBRI 2FSRA 4QVTA 4A3LI 5LYFA 4MH4A 2RC4A 3WC6A 2ZELA 3G71Z 1Z4RA 4CGMA 2PJ8A 3GY9A 1P9NA 1Z9UA 2ZEMA 1YIJ1 4WJBA 1S7FA 4AXVA 2D4OA 2RHBA 5JQ4A 4ONWA 4AB7A 2B4DA 1FNOA 5AG4A 4R7MA 4OC5A 4U5YA 1XJOA 3T9YA 3HUVA 1ZG7A 4RS4A 2BOAA 4C7IA 3CXPA 4RVGA 1N71A 3VTNA 1Q2YA 4JJXA 1P0HA 3LWUA 2P6GA 4KVME 1KQSY 4F0XA 2Q0YA 5A28A 2YADA 2CIJA 3KR4A 1SFOI 4PK2A 4F0YA 2AFMA 3IR7A 3TT2A 1Z5RA 4KOWA 3KL9A 4MHNA 2PJ3A 3CC21 4Z65A 4DK1A 2NVTI 3R95A 3S6HA 3CZXA 2BUEA 4KUAA 5KTDA 5CPAA 1KQSZ 1WWZA 2J9AA 4KOXA 4L89A 4IHMA 4MBUA 3S17I 4A2ZA 4QTTA 4KOYA 5I0CA 1DL6A 2QEX1 1TF9A 3WABA 2GLFA 2Q7BA 4PXDA 4TWEA 3PO2I 1PFTA 1TKHA 1R3NA 4NBBA 3FKII 3ISXA 2JIPA 4JXQA 2R8VA 3RAMA 4M6IA 5F48A 3PB4X 2VZYA 2OU2A 1Y0RA 2GTIA 2Q43A 1CBXA 1JQGA 1VQOZ 4NBEA 1L0CA 4Y49C 2OOTA 5A2Qb 4ZI6A 2JIQA 2GANA 3SJXA 4HNXB 5HMNA 3NDJA 1Q7Y1 3CCMZ 4A3MI 4F8ZA 1LQLA 5G20A 1CJWA 2QIRA 1JWHC 4GM5A 2F7VA 1VQPZ 2EVNA 2GTHA 3GTQI 1CPSA 4E8OA 3LD2A 4E30A 4BXXI 1ZB8A 2QYVA 4MONA 3SJFA 2E7ZA 4A31A 2M48A 4FBEA 4FD6A 5A27A 3OW2Z 5G22A 1VQ91 3GTOI 5CM2M 2BEIA 4DUKA 4HH4A 4BMHA 5K8PA
chains in the Genus database with same CATH topology
4EMEA 3TDHB 2WZNA 3B35A 2PJ4A 2EK9A 4NGRA 4B6ZA 1W2BZ 3B3VA 5C4XI 3FECA 1QVFY 2ZOFA 4Y52I 4P4FA 4NBGA 4TNUA 3HOVI 8CPAA 3CC2Z 2C6PA 2IJZA 1YJW1 3PB9X 4YWYA 4E2YA 2JA7I 1IGBA 1YLOA 1X3ZA 3CCLZ 2V8JA 4UF4A 2P28A 3VMGA 5DS0A 2XEGA 3WC7A 1OBRA 3VARA 5D8NA 3IO1A 3EEDA 1YJWZ 1ZLHA 3B7IA 3FQMA 1N2FA 2F4MA 1BPMA 2ZEHA 3J7A4 2RPRA 3H8GA 2AFUA 2JBKA 2ABZA 4MHPA 5F09A 2VF1A 2QKDA 4JYWA 3KIFA 6CPAA 2BJOA 3HOZI 2NSMA 3WT4A 1VQ8Z 3NH5A 5LRJA 4MD9A 3BI1A 1KD12 3BHXA 5IT9f 5LRGA 3VMIA 1DE4C 3TX8A 2PCUA 1BPNA 4P4EA 3CPWY 3CXCY 3M3YI 3CXCZ 3I4MI 2AFSA 1YJ91 2PVVA 1ELMP 3KASA 3S1QI 4NGSA 3I56Z 2J6AA 4NFRA 3I1UA 3EERA 2IZ4A 3JAMb 3N5FA 4UEZA 5C4JI 1ZG9A 3PFEA 4MCPA 1VHOA 2OR4A 1WW9A 1TWFI 3IFUA 3VMHA 1VQ51 4QTUA 1QVGY 4UEEA 4DYOA 2QLVB 1VHEA 3S1RI 1Q822 3SJEA 2HC9A 3D7GA 5T6BA 1PYTB 4UEFA 1K8A1 2RFHA 1USPB 2ZEOA 4PXCA 2W04A 1VQ5Z 3GUXA 3SI1A 3CCL1 2PRQA 4E32A 3I551 2R7ZI 2AFOA 4X2TA 2DE7A 4MMOA 1EE3P 2VUGA 4MCRA 3FEEA 4MHZA 3KIHA 1M901 4OMEA 4RUHA 5K8OA 2OTJ1 4P45A 2GREA 4OC2A 1LOKA 5HVFA 1IY7A 2QR1B 4FAIA 4EFDA 1Q7Y2 1QYPA 2IQ6A 1JJ2Y 2Q51A 4P4IA 3VATA 2RT9A 3H8FA 5J1QA 3CCEZ 3VH9A 3HKZA 4NJRA 3IJ3A 1DTDA 4NH1C 2JBJA 3KR5A 2PJ5A 4PXEA 4P4JA 3FEDA 2NYQA 4A3CI 1NP6A 2QVPA 3S2HI 1WIIA 1ZLIA 3VB9A 4OIDA 3PBBA 1LAMA 4OKOA 3CCQZ 4A38A 2KPIA 3S16I 4BY1I 2NVXI 5LYLA 1TKJA 4Q7AA 1CP7A 3CC4Z 1M1K1 4O23A 3HOUI 3D9XA 2C6GA 2FVGA 1I3QI 4ZY0A 1KC81 2V8IA 2QREB 4S1TA 3CCV1 3F3PC 3NH8A 1M1K2 3MZKB 3I07A 2E9HA 2EGTA 2AFWA 2G9DA 3CCR1 3FQQA 1LFWA 4MD7A 2Q4ZA 1VQLZ 1ZG8A 4OC1A 2YU9I 3NFZA 4A3FI 2R93I 1F2PA 3S14I 1KRLA 3SI0A 3BG1B 1RTQA 2PK7A 3IF8A 2K5RA 1S721 2W03A 1WCMI 3CQZI 2HF1A 3JRUA 1VQL1 3NA6A 1K731 1K9M2 3GTLI 1AYEA 4X6AI 1CPXA 2R92I 2PJ1A 1TXRA 2RB7A 3D67A 1Q862 1VQ9Z 4IAVA 1Y7EA 3ESWA 3HOYI 2I3CA 3PBEA 1NJI2 4NOZA 1HDQA 1RLYA 1M4LA 1X0TA 5C3EI 1K9M1 1CG2A 2VL1A 3KHXA 5HVGA 4A3GI 1RNIA 1BAVA 3CCE1 1LAPA 5FLXf 4NBAA 5IB9A 3D4UA 1YHQZ 3CCSZ 2C1CA 1Y1VS 3CDXA 2BO9A 5HXDA 1Q821 1Z8LA 4E31A 1RQFA 5JH9A 3OW2Y 7CPAA 3MZLB 1USPA 4NB9A 1KWMA 3IIBA 2C6CA 3K2KA 1VQO1 3J80b 4A93I 4P44A 3HLPA 3PB7X 1YJ9Z 3RZDI 3I561 1YJNZ 5FLMI 3KI9A 1CP6A 4MCSA 3CCRZ 3PB6X 1L1OC 4KSIA 3TC8A 4R8FA 5AN9F 1HEEA 2PMZA 3NH4A 1VQMZ 3CMA1 3S2DI 3CCVZ 1QMUA 2ZEEA 2PVWA 4G1PA 4W9YA 5LRKA 2NVYI 4NGPA 3B3WA 4DGLA 1YMEA 3G6E1 3Q87A 1QVFZ 2JEWA 2PJ0A 3QNVA 3ISZA 2QA41 2PJ7A 4A39A 4FUUA 2LFUA 3I55Z 1K8A2 2E2II 2OZKA 4ZX8A 1Z03A 2QRDB 1QF8A 4ZY2A 1N8R1 2EWBA 2KI7B 2JUBA 2QA4Z 2CTBA 1Q861 5IT9b 1YW6A 3PB8X 3PO3S 3B3TA 4OP4A 1RO0A 3WC5A 3CCS1 2WYRA 4E2WA 2ZEPA 1YITZ 4UIAA 1K732 1N8R2 4A3BI 3BI0A 4R76A 3G711 1VQKZ 5JM6A 2VUMI 3JAMf 1LANA 4X3RA 2PJ6A 2JA5I 1TWCI 3CPAA 4H2KA 2OTLZ 1W2BY 2OTJZ 1VQ71 4NGMA 1YI2Z 4IK2A 2V8KA 3B3CA 4P10A 2POKA 2ANPA 1YIJZ 4RV9A 1XBUA 3K7AI 1TWAI 2IZ3A 2PJ9A 1VQ41 2V8DA 5D29A 1YJN1 2RIQA 1R43A 4BD9A 2AKLA 3KHZA 1VGYA 1ARMA 3IC1A 3FVLA 3F3FC 1YUAA 4NGTA 5T64A 1Z01A 3D7HA 4MRIA 1K83I 3CC7Z 2AFXA 4WWVA 3TE5B 3CMEZ 1Z02A 2HB6A 3CC41 1YW4A 4A3II 4Y7NI 3K9TA 3PFOA 4CPAA 4XX2A 4PQAA 5I4MA 2QRCB 1GYTA 2PJ2A 2V77A 4K3NA 1ZB9A 2QJ8A 3L2NA 2QEXZ 3S15I 2R6MA 2M6NA 4E2ZA 1NSAA 1Y1VI 1VQK1 3J81b 1LCPA 4OC3A 1BLLE 4EWTA 4BBRI 4MCQA 4PPZA 2RBLA 3DLJA 3CCM1 4A3LI 1XFOA 5LYFA 2HU9A 3H0GI 4MH4A 1TWGI 1M902 3WC6A 2ZELA 3S9MA 1TKFA 4OC4A 4BBSI 3G71Z 3DGVA 2WB1A 2ZEDA 3IEHA 4MXUA 2PJ8A 1XMBA 3I4NI 1YHQ1 1P9NA 1YUKA 3IX0A 3B3SA 4OC0A 3T4NB 1XRYA 3BXMA 1QQ9A 3LMSA 1TWHI 3S1NI 1AMPA 2ZEMA 1UWYA 1YIJ1 3HOXI 4WJBA 5C44I 4AXVA 3GTMS 3FH4A 2RHBA 5THWA 4ONWA 2PJBA 4NBHA 3GTGI 1VIXA 1FNOA 4E33A 2EK8A 3KQZA 4R7MA 3CCUZ 4F9UA 4OIWA 3H3VJ 3CC71 4OC5A 2DE5A 1Q811 1I6HI 2JA6I 1XJOA 3HUVA 2F4OA 3PO3I 1ZG7A 4A3JI 3HOWI 2O4HA 3D66A 2WAQA 1F57A 4RS4A 3U50C 2BOAA 3CMAZ 1ARLA 3KQXA 2JMOA 2DEAA 4RVGA 1VQ61 2B63I 4PXBA 3BG0B 3VTNA 3QWUA 3J81f 5FLXb 4A37A 4NB8A 3V38A 1RO2A 3MN8A 2ZAEB 3G4SZ 1QVGZ 2GLJA 2ZEGA 3LWUA 2PIYA 5LYIA 1ML8A 2H85A 3S9NA 4BY7I 1VQ81 1KQSY 4YU9A 2PE3A 2V8VA 5HVHA 5D1OB 2YADA 5IP9I 4FWUA 1KD11 2P3YA 2AFZA 2CIJA 3D7FA 3CCJ1 3KR4A 3CD6Z 2OTL1 1SFOI 4NGNA 3GTKI 5ELYA 2JS4A 4RVFA 2GU2A 2AFMA 3FMCA 4NJQA 2DE6A 1I50I 4LQGA 3S1MI 4F9VA 1Z5RA 3MRUA 4R6TA 2V8GA 3H8EA 5CBMA 2F8HA 1VQ4Z 3GB0A 3KL9A 3G6EZ 2PJ3A 3CC21 4MHNA 4MHYA 3NDIA 3FJUA 4Z65A 4DK1A 1RO4A 4HGZA 2NVTI 3CCU1 3RZAA 1H8LA 3FX6A 2OOYB 3FF3A 2LIYA 1VQ6Z 4NBCA 4E2XA 1ZH1A 5A2Qf 3KZWA 3GTPI 5CPAA 2ZENA 1KQSZ 3GCFA 4X8IA 2E2JI 3D6WA 2J9AA 3IWWA 3RBUA 3RZOI 4IHMA 3D68A 3J80f 3S17I 4QTTA 3GLJA 4P6YA 2ZOGA 1DL6A 2QEX1 1TF9A 3WABA 3LUSA 4P4DA 1S72Z 2GLFA 3CPWZ 2XEJA 5LYDA 3G4S1 4PXDA 3P5JB 1NJI1 4TWEA 2XEFA 3PO2I 1CX8A 1PFTA 1VQP1 3IFEA 2PM9A 1TKHA 1R3NA 2PIZA 4NBBA 1YI21 5K8MA 3GTMI 3S9LA 2K3RA 3FKII 1R9TI 3ISXA 4A3DI 1S7MA 3CT9A 4NBFA 3CD61 2Y0SA 3RAMA 5T67A 4JZ0A 4A3EI 1Q812 3PB4X 1Y0RA 1TF8A 3GKQA 2ZEFA 2JR6A 2NVQI 1VQN1 3GTJI 2GTIA 2Q43A 1CBXA 1JQGA 1VQOZ 3SJGA 4NGQA 4A94A 3CME1 2OOXB 1KC82 4ZY1A 4RVDA 2G2KA 4CL1A 4NBEA 1X3WA 3CPXA 2XEIA 3T8WA 1VQM1 5JGFA 2OOTA 5A2Qb 2JNYA 1JJ2Z 4ZI6A 3B2YA 2CF4A 3SJXA 2CTCA 1NUIA 4EWCA 4DJLA 3NDJA 1Q7Y1 3CCMZ 4A3MI 4UIBA 4F8ZA 4NBDA 1VLAA 1LQLA 3M4OI 1PCAA 4ZX9A 3SI2A 2V8HA 2O53A 1JWHC 5D1PA 1HDUA 4ZYQA 4GM5A 2F7VA 1VQPZ 4HGYA 2GTHA 3GTQI 1CPSA 1YIT1 1YSJA 2PJAA 2E2HI 2PJCA 4E30A 4BXXI 1ZB8A 1Z2LA 2QYVA 4RVHA 5D1OA 5K8NA 4P4BA 3KGQA 4MONA 4DQYB 3V7ZA 3PEIA 3SJFA 2M48A 4FBEA 3D7DA 1VQ7Z 3CCJZ 3OW2Z 1Q7LA 1TFIA 4AYBA 1VQ91 3GTOI 1FT7A 1F2OA 2JA8I 1Y1WI 5CM2M 2BCOA 4A3KI 5IP7I 2IMOA 4DUKA 1ELLP 5LL6f 1VQNZ 3CCQ1 4HH4A 4MD8A 1Y0YA 3MONA 5K8PA 3PRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EME A;  2WZN A;  3B35 A;  2PJ4 A;  2EK9 A;  4NGR A;  4B6Z A;  3B3V A;  3FEC A;  2ZOF A;  4P4F A;  4TNU A;  8CPA A;  2IJZ A;  2C6P A;  3PB9 X;  4YWY A;  1IGB A;  1YLO A;  4UF4 A;  5DS0 A;  2XEG A;  3WC7 A;  1OBR A;  3VAR A;  3IO1 A;  1ZLH A;  3B7I A;  1BPM A;  2ZEH A;  3H8G A;  2AFU A;  2JBK A;  2ABZ A;  4MHP A;  5F09 A;  4JYW A;  6CPA A;  2NSM A;  3WT4 A;  3NH5 A;  5LRJ A;  3BI1 A;  3BHX A;  5LRG A;  1DE4 C;  3TX8 A;  2PCU A;  1BPN A;  4P4E A;  3KAS A;  2PVV A;  2AFS A;  1ELM P;  4NGS A;  4NFR A;  3I1U A;  3N5F A;  4UEZ A;  1ZG9 A;  3PFE A;  4MCP A;  1VHO A;  2OR4 A;  4UEE A;  4DYO A;  1VHE A;  3SJE A;  2HC9 A;  3D7G A;  1PYT B;  4UEF A;  2ZEO A;  2RFH A;  4PXC A;  3GUX A;  3SI1 A;  2PRQ A;  2AFO A;  4X2T A;  4MMO A;  1EE3 P;  4MCR A;  3FEE A;  4MHZ A;  4OME A;  4RUH A;  5K8O A;  4P45 A;  2GRE A;  4OC2 A;  1LOK A;  5HVF A;  1IY7 A;  4FAI A;  4EFD A;  2IQ6 A;  3VAT A;  4P4I A;  2Q51 A;  3H8F A;  5J1Q A;  3VH9 A;  4NJR A;  3IJ3 A;  1DTD A;  2JBJ A;  3KR5 A;  2PJ5 A;  4PXE A;  4P4J A;  3FED A;  2NYQ A;  2QVP A;  1ZLI A;  4OID A;  3PBB A;  1LAM A;  4OKO A;  4A38 A;  5LYL A;  1TKJ A;  4Q7A A;  1CP7 A;  4O23 A;  2C6G A;  2FVG A;  4ZY0 A;  3NH8 A;  2AFW A;  2G9D A;  1LFW A;  2Q4Z A;  1ZG8 A;  4OC1 A;  3NFZ A;  1F2P A;  3SI0 A;  1RTQ A;  3JRU A;  3NA6 A;  1AYE A;  1CPX A;  2PJ1 A;  1TXR A;  2RB7 A;  3D67 A;  4IAV A;  1Y7E A;  2I3C A;  3PBE A;  5D8N A;  1M4L A;  1HDQ A;  3KHX A;  2VL1 A;  1CG2 A;  5HVG A;  1BAV A;  1LAP A;  5IB9 A;  3D4U A;  2C1C A;  3CDX A;  2BO9 A;  5HXD A;  1Z8L A;  5JH9 A;  7CPA A;  1KWM A;  3IIB A;  2C6C A;  3K2K A;  4P44 A;  3HLP A;  3PB7 X;  4MCS A;  3KI9 A;  1CP6 A;  3PB6 X;  4KSI A;  3TC8 A;  4R8F A;  1HEE A;  3NH4 A;  2ZEE A;  4W9Y A;  1QMU A;  4G1P A;  5LRK A;  2PVW A;  4NGP A;  3B3W A;  1YME A;  2JEW A;  2PJ0 A;  3QNV A;  3ISZ A;  2PJ7 A;  4A39 A;  4FUU A;  4ZX8 A;  4ZY2 A;  2EWB A;  2CTB A;  3PB8 X;  1YW6 A;  3B3T A;  4OP4 A;  3WC5 A;  2WYR A;  2ZEP A;  4UIA A;  3BI0 A;  4R76 A;  5JM6 A;  1LAN A;  4X3R A;  2PJ6 A;  3CPA A;  4H2K A;  4NGM A;  4IK2 A;  3B3C A;  4P10 A;  2POK A;  2ANP A;  1XBU A;  2V8D A;  2PJ9 A;  5D29 A;  1R43 A;  4BD9 A;  3KHZ A;  1VGY A;  1ARM A;  3IC1 A;  3FVL A;  4NGT A;  3D7H A;  4MRI A;  2AFX A;  4WWV A;  2HB6 A;  1YW4 A;  3PFO A;  3K9T A;  4CPA A;  4PQA A;  5I4M A;  1GYT A;  2PJ2 A;  2V77 A;  4K3N A;  2QJ8 A;  3L2N A;  1NSA A;  4OC3 A;  1LCP A;  1BLL E;  4EWT A;  4MCQ A;  4PPZ A;  3DLJ A;  1XFO A;  5LYF A;  3WC6 A;  2ZEL A;  3S9M A;  1TKF A;  4OC4 A;  3DGV A;  2ZED A;  3IEH A;  4MXU A;  2PJ8 A;  1XMB A;  3B3S A;  4OC0 A;  1XRY A;  3BXM A;  1QQ9 A;  3LMS A;  1AMP A;  2ZEM A;  1UWY A;  4WJB A;  4AXV A;  3FH4 A;  5THW A;  4ONW A;  2PJB A;  1VIX A;  1FNO A;  2EK8 A;  3KQZ A;  4R7M A;  4F9U A;  4OIW A;  4OC5 A;  1XJO A;  3HUV A;  1ZG7 A;  2O4H A;  3D66 A;  1F57 A;  2BOA A;  1ARL A;  3KQX A;  2DEA A;  4PXB A;  4A37 A;  3V38 A;  3MN8 A;  2GLJ A;  2ZEG A;  3LWU A;  2PIY A;  5LYI A;  3S9N A;  4YU9 A;  2PE3 A;  2V8V A;  5HVH A;  4FWU A;  2AFZ A;  2CIJ A;  3D7F A;  3KR4 A;  4NGN A;  5ELY A;  2GU2 A;  2AFM A;  3FMC A;  4NJQ A;  4LQG A;  4F9V A;  1Z5R A;  3MRU A;  4R6T A;  2V8G A;  3H8E A;  5CBM A;  3KL9 A;  3GB0 A;  4MHN A;  2F8H A;  2PJ3 A;  4MHY A;  3FJU A;  4Z65 A;  3RZA A;  1H8L A;  3FX6 A;  3FF3 A;  3KZW A;  5CPA A;  2ZEN A;  4X8I A;  2J9A A;  3IWW A;  3RBU A;  4IHM A;  3D68 A;  3GLJ A;  4P6Y A;  2ZOG A;  1TF9 A;  3WAB A;  4P4D A;  2GLF A;  2XEJ A;  5LYD A;  4PXD A;  4TWE A;  2XEF A;  1CX8 A;  3IFE A;  1TKH A;  1R3N A;  2PIZ A;  5K8M A;  3S9L A;  3ISX A;  3CT9 A;  3RAM A;  4JZ0 A;  3PB4 X;  1Y0R A;  1TF8 A;  2ZEF A;  2Q43 A;  1CBX A;  1JQG A;  3SJG A;  4NGQ A;  4A94 A;  4ZY1 A;  3T8W A;  3CPX A;  2XEI A;  5JGF A;  2OOT A;  4ZI6 A;  3B2Y A;  2CF4 A;  3SJX A;  2CTC A;  4DJL A;  4UIB A;  4F8Z A;  4ZX9 A;  1PCA A;  3SI2 A;  2V8H A;  2O53 A;  1HDU A;  4ZYQ A;  4GM5 A;  2F7V A;  1CPS A;  1YSJ A;  2PJA A;  2PJC A;  2QYV A;  1Z2L A;  5K8N A;  4P4B A;  3KGQ A;  3V7Z A;  3PEI A;  3SJF A;  4FBE A;  3D7D A;  1Q7L A;  1FT7 A;  1F2O A;  2BCO A;  2IMO A;  4DUK A;  1ELL P;  1Y0Y A;  5K8P A;  3PRT A; 
#chains in the Genus database with same CATH topology
 2VPX A;  3TDH B;  2PJ4 A;  1RO5 A;  2JLM A;  4P4F A;  4NBG A;  4YRH A;  3PB9 X;  4YWY A;  3CCL Z;  1YQE A;  2ARH A;  2Z0Z A;  3VMG A;  5DS0 A;  3EED A;  3B8G A;  4C2Y A;  2WPW A;  4ONU A;  1N2F A;  4B11 A;  1BOB A;  3H8G A;  3KIF A;  4GS4 A;  3WT4 A;  1V0C A;  5LRG A;  3VMI A;  4P4E A;  4HNY B;  2J6A A;  3EER A;  4CAW A;  4MCP A;  4MY3 A;  2OR4 A;  1WW9 A;  1TWF I;  4QTU A;  1QVG Y;  2B3V A;  2ZEO A;  4PXC A;  1VQ5 Z;  2HQY A;  5F46 A;  4E32 A;  3I55 1;  1FY7 A;  4EVY A;  4RN7 A;  1EE3 P;  4XNH B;  1UFH A;  5K8O A;  2OTJ 1;  4UCN A;  1LOK A;  1Q7Y 2;  4P4I A;  4QC6 A;  1QSR A;  1NE9 A;  3FBU A;  3VH9 A;  4NH1 C;  4CRY B;  3DNS A;  1I21 A;  2NYQ A;  4A3C I;  1I12 A;  1WII A;  3VB9 A;  4OID A;  3PBB A;  4A38 A;  4YFJ A;  3S16 I;  5LYL A;  4RI1 A;  2FVG A;  1KC8 1;  2VPY A;  1S5K A;  3F3P C;  4PK3 A;  2JIO A;  2Q4Z A;  1K4J A;  4QUS A;  3S14 I;  2V3V A;  3SI0 A;  3IF8 A;  3F8K A;  3GIU A;  4KVX A;  4CRZ B;  1WCM I;  3CQZ I;  4UCP A;  3JVN A;  1K73 1;  2R92 I;  4OAD A;  3ESW A;  3HOY I;  1MJB A;  4NOZ A;  1RLY A;  1X0T A;  5C3E I;  2VL1 A;  1CG2 A;  5AGE A;  5HVG A;  1RNI A;  3CCE 1;  1LAP A;  1YX0 A;  3CDX A;  1XF8 A;  5JH9 A;  7CPA A;  1USP A;  2Z3K A;  1VQO 1;  3BJ7 A;  1YJ9 Z;  3RZD I;  3CCR Z;  3D3S A;  4KLW A;  4R8F A;  5AN9 F;  1QSN A;  1HEE A;  3NH4 A;  3S2D I;  1J4J A;  4G1P A;  3FXT A;  3RO0 A;  3Q87 A;  2PJ0 A;  3QNV A;  3ISZ A;  2G0B A;  2QA4 1;  2JDD A;  1Z8X A;  2P0W A;  3TOB A;  4XPK A;  2QRD B;  4ZY2 A;  2EWB A;  2KI7 B;  1Q86 1;  1YRE A;  4OP4 A;  3WC5 A;  2ZEP A;  4UIA A;  1N8R 2;  3G71 1;  1ON0 A;  2VPW A;  2Q04 A;  1LAN A;  4H2K A;  4CGL A;  2KCW A;  1VQ7 1;  1YI2 Z;  2Z3P A;  3I3G A;  3G8W A;  2H5M A;  2PC1 A;  4IK2 A;  4R3L A;  2ANP A;  1XBU A;  1TWA I;  2V8D A;  5D29 A;  1YJN 1;  1YK3 A;  3TE5 B;  4PSW A;  3CC4 1;  4Y7N I;  1GYT A;  2QEX Z;  3S15 I;  4KS9 A;  2OH1 A;  2M6N A;  3PP9 A;  4E2Z A;  3J81 b;  4EWT A;  2PR1 A;  2RBL A;  2HU9 A;  1TWG I;  1TKF A;  4OC4 A;  4CAE A;  4UWJ A;  2JIR A;  1XMB A;  3MGD A;  4B13 A;  1FDI A;  1FDO A;  3T4N B;  1TWH I;  2YND A;  3VWE A;  1VHS A;  2PJB A;  4E33 A;  3KQZ A;  4PV6 A;  4F9U A;  2Z11 A;  3CC7 1;  3PO3 I;  4XNH C;  3V8I A;  4JXR A;  3D66 A;  2WAQ A;  1F57 A;  4I49 A;  3U50 C;  4BBH A;  4IUS A;  3D2M A;  1VQ6 1;  2ZW4 A;  3BG0 B;  4A37 A;  4NB8 A;  3V38 A;  1RO2 A;  1LRZ A;  1QVG Z;  1QST A;  4LQ6 A;  2PIY A;  1ML8 A;  1XIX A;  4B5P B;  4YU9 A;  2PE3 A;  4FWU A;  2P3Y A;  3D7F A;  1U6M A;  5ELY A;  2JS4 A;  1CM0 A;  2GU2 A;  3FMC A;  4NJQ A;  4R6T A;  5CBM A;  4A32 A;  3GB0 A;  4ZBG A;  4MJ8 A;  3G6E Z;  5IB0 A;  3NDI A;  3E0K A;  3FJU A;  1RO4 A;  2OOY B;  4U9Y A;  4NBC A;  1Z8W A;  4E2X A;  5A2Q f;  3GTP I;  2ZEN A;  2Q4Y A;  1NMT A;  2FIW A;  3PZJ A;  3RZO I;  4AVB A;  1AA6 A;  3GLJ A;  4P6Y A;  5JPH A;  2ZOG A;  4C2X A;  4P4D A;  1S72 Z;  5LYD A;  3CPW Z;  2X7B A;  2PIZ A;  2DPS A;  4OAE A;  4B14 A;  2K3R A;  2GFQ A;  3CT9 A;  4KOS A;  2DPT A;  5T67 A;  4JZ0 A;  1Q81 2;  3GKQ A;  5IX3 A;  1VQN 1;  3GTJ I;  3CME 1;  1KC8 2;  4ZY1 A;  4RVD A;  4R9M A;  2VBQ A;  3T8W A;  4C68 A;  1KUV A;  3B2Y A;  2CF4 A;  3SXN A;  4DJL A;  4QB9 A;  4UIB A;  1IOI A;  2VZZ A;  3M4O I;  4ZX9 A;  1PCA A;  1IOF A;  2OZU A;  5D1P A;  4ZYQ A;  2VEZ A;  4HGY A;  2PJC A;  2E2H I;  2WSA A;  2CNT A;  4DQY B;  3RNZ A;  3V7Z A;  3D7D A;  1VQ7 Z;  3CCJ Z;  1S60 A;  2FIA A;  1Y1W I;  4E0A A;  4A3K I;  4B12 A;  1Y0Y A;  3MON A;  3PRT A;  4EME A;  3QAH A;  3FIX A;  4NGR A;  4B6Z A;  3B3V A;  1QVF Y;  4TNU A;  3HOV I;  8CPA A;  2C6P A;  1YJW 1;  2JA7 I;  1YLO A;  4K30 A;  1X3Z A;  2B4D B;  4UF4 A;  1WK4 A;  3VAR A;  4KUB A;  3B7I A;  3FQM A;  1BPM A;  3J7A 4;  2ABZ A;  1IID A;  2O28 A;  2QKD A;  2BJO A;  3HOZ I;  1GHE A;  2NSM A;  3NH5 A;  4KSF A;  1Q16 A;  4R3K A;  3BHX A;  1DE4 C;  3TX8 A;  2PCU A;  4NSQ A;  3CXC Y;  2AFS A;  1YJ9 1;  3I56 Z;  1ZG9 A;  3IFU A;  1Q2D A;  2YGW A;  3VMH A;  1VQ5 1;  2ZXV A;  4UEE A;  1Q82 2;  3SJE A;  2HV2 A;  1PYT B;  4UEF A;  2RFH A;  1USP B;  4LUA A;  2W04 A;  4MFZ A;  3IWE A;  4KOT A;  3SI1 A;  2PRQ A;  2R7Z I;  2AFO A;  2ZPA A;  5H86 A;  1IYK A;  4X2T A;  2PRB A;  4MMO A;  4NXY A;  4MHZ A;  4OME A;  1M90 1;  3GYA A;  4P45 A;  4OC2 A;  2A4N A;  4CGO A;  4EFD A;  1QYP A;  4U9Z A;  3VAT A;  4NEX A;  5KTC A;  2Z3N A;  2Q4V A;  4NJR A;  1DTD A;  3KR5 A;  2PJ5 A;  4PXE A;  3FED A;  2QVP A;  1ZLI A;  2ATR A;  2WPX A;  4OKO A;  5AG5 A;  3DR6 A;  2V45 A;  1M1K 1;  4HNW B;  3D9X A;  2C6G A;  4S1T A;  3CCV 1;  4KOR A;  2E9H A;  2G9D A;  3FQQ A;  1ZG8 A;  2YU9 I;  3NFZ A;  4ZGY B;  4UFV A;  2R93 I;  1Z8T A;  1KRL A;  2PK7 A;  4X5K A;  3JRU A;  1MJ9 A;  3SXO A;  2PJ1 A;  1TXR A;  2RB7 A;  1PUA A;  1VQ9 Z;  4IAV A;  1Y7E A;  2I3C A;  5D8N A;  3KHX A;  4L8A A;  1K9M 1;  4A3G I;  2FE7 A;  1AUG A;  5FLX f;  5IB9 A;  1YHQ Z;  1Q2C A;  3P2H A;  2EBJ A;  4NB9 A;  3J80 b;  3PB7 X;  2ZW7 A;  3I56 1;  4MCS A;  3KI9 A;  1CP6 A;  1L1O C;  2PMZ A;  1VQM Z;  4W9Y A;  3CMA 1;  1QMU A;  2CNS A;  2NVY I;  4DGL A;  1QVF Z;  2NMT A;  5GCN A;  2PR8 A;  2PJ7 A;  4A39 A;  3S6G A;  1VKC A;  2ZW6 A;  2E2I I;  4CGP A;  2OZK A;  3TO6 A;  4C7H A;  2CTB A;  4R87 A;  2Y0M A;  1RO0 A;  4J3G A;  3CCS 1;  3PGP A;  4R76 A;  1JWQ A;  1W2B Y;  4NGM A;  1YVO A;  3B3C A;  1XEB A;  2POK A;  1YIJ Z;  4RV9 A;  2EUI A;  2IZ3 A;  1R43 A;  2RIQ A;  2AKL A;  3KHZ A;  1ARM A;  3F3F C;  4NGT A;  3TO9 A;  3D8P A;  1Z4E A;  2D4P A;  3NE8 A;  4XX2 A;  2PJ2 A;  2V77 A;  1ZB9 A;  3ZJ0 A;  2FT0 A;  2QJ8 A;  1NSA A;  1VQK 1;  2B5G B;  4PPZ A;  4KOV A;  1S7N A;  4JLY A;  3DLJ A;  3CCM 1;  1XFO A;  3H0G I;  4UWI A;  4CAV A;  3S9M A;  4BBS I;  1KUY A;  3I9S A;  2ZED A;  3IEH A;  2R1I A;  4RS2 A;  3I4N I;  1YHQ 1;  1YUK A;  3IX0 A;  4OC0 A;  1XRY A;  4UFW A;  3BXM A;  4M6H A;  3LMS A;  1AMP A;  2CNM A;  3HOX I;  5C44 I;  3GTM S;  1M1D A;  3GTG I;  2EK8 A;  3CCU Z;  4OIW A;  2QEC A;  2CY2 A;  1Y8C A;  4A3J I;  3HOW I;  3BJ8 A;  3CXQ A;  2B63 I;  4PXB A;  2PQ8 A;  3QWU A;  5FLX b;  2I00 A;  1M4G A;  2FL4 A;  5E96 A;  1TIQ A;  3G4S Z;  5LYI A;  2H85 A;  4R57 A;  2B58 A;  4CAF A;  2VQY A;  1KD1 1;  1BO4 A;  3CCJ 1;  2PSW A;  3CD6 Z;  2OTL 1;  3GTK I;  4RVF A;  4XPL A;  3FRM A;  4UBR A;  4LQG A;  3S1M I;  2IV2 X;  4F9V A;  3MRU A;  2V8G A;  3H8E A;  2F8H A;  2BL1 A;  2Z3O A;  4MHY A;  4HGZ A;  2JDC A;  3CCU 1;  3FYN A;  3FX6 A;  2B3U A;  3FF3 A;  3IWG A;  4X8I A;  3D6W A;  4KZT A;  2K5T A;  1YR0 A;  3J80 f;  4F6A A;  2FXF A;  2XEJ A;  3P5J B;  1NJI 1;  3F5B A;  1CX8 A;  1VQP 1;  2PM9 A;  5F47 A;  1IIC A;  4A3D I;  1S7M A;  3CD6 1;  2Y0S A;  3FB3 A;  4PSX A;  4A3E I;  3P2F A;  3DSB A;  4GXH A;  2ZEF A;  1XMT A;  2J8M A;  3SJG A;  4M6G A;  3W6X A;  2G2K A;  2IL4 A;  1X3W A;  3CPX A;  2XEI A;  3TE4 A;  2YNC A;  1VQM 1;  5JGF A;  4A95 A;  2CTC A;  3R96 A;  4FD5 A;  2JEV A;  5DWN A;  4AG9 A;  2FCK A;  1QSM A;  3SI2 A;  3IU2 A;  3EC4 A;  3H5Z A;  3C26 A;  1QSO A;  5DWM A;  2EO8 A;  1YIT 1;  5AG6 A;  4RVH A;  5D1O A;  2B4B A;  3PEI A;  2J8R A;  5H84 A;  1Q7L A;  1TFI A;  4AYB A;  3S6F A;  3TCV A;  2BCO A;  3DDD A;  2IMO A;  5LL6 f;  4CYQ A;  3CCQ 1;  4B10 A;  2WZN A;  3B35 A;  2EK9 A;  1W2B Z;  5C4X I;  2ZOF A;  5BWA B;  1IYL A;  3CC2 Z;  2REE A;  4E2Y A;  1IGB A;  4MFL A;  3WC7 A;  2XEG A;  1OBR A;  4JWP A;  3IO1 A;  1ZLH A;  1S7K A;  4QBJ A;  2F4M A;  2ZEH A;  2GE3 A;  2AFU A;  2JBK A;  2VF1 A;  4JYW A;  6CPA A;  1VQ8 Z;  5LRJ A;  3BI1 A;  1ZO0 A;  1BPN A;  4JD6 A;  3KAS A;  3M3Y I;  3I4M I;  2PVV A;  1ELM P;  4NGS A;  4NFR A;  3I1U A;  3JAM b;  4ORF A;  5C4J I;  1VHO A;  5KTA A;  3W6S A;  4DYO A;  2HUZ A;  3D7G A;  1K8A 1;  3K9U A;  4Y49 B;  3CCL 1;  2J8N A;  2DE7 A;  5C82 A;  2VUG A;  2G3A A;  4UFX A;  3FEE A;  5CNP A;  3KIH A;  5HVF A;  2QR1 B;  2Z3M A;  2IQ6 A;  4XPD B;  1JJ2 Y;  2Q51 A;  1RXT A;  3H8F A;  5J1Q A;  3HKZ A;  3IJ3 A;  2BSW A;  2JBJ A;  4IF5 A;  1NP6 A;  3S2H I;  2G3T A;  3CCQ Z;  2KPI A;  4KLV A;  4BY1 I;  2NVX I;  1TKJ A;  4Q7A A;  1KUX A;  4O23 A;  1I3Q I;  4ZY0 A;  2V8I A;  3GKR A;  1M1K 2;  2AFW A;  2EGT A;  3CCR 1;  1B6B A;  4MD7 A;  4OC1 A;  4A3F I;  2PDO A;  1F2P A;  1SIW A;  3BG1 B;  2K5R A;  1S72 1;  2W03 A;  4LX9 A;  1VQL 1;  4MFK A;  1K9M 2;  1AYE A;  4X6A I;  3D67 A;  3NE7 A;  3D4U A;  3CCS Z;  5HXD A;  1RQF A;  3SHP A;  3OW2 Y;  4FD4 A;  3K2K A;  4P44 A;  3BLN A;  2Q44 A;  1YJN Z;  4E2A A;  1MK4 A;  4KSI A;  2ZEE A;  5LRK A;  2PVW A;  3B3W A;  1YME A;  3G6E 1;  4BIN A;  4A33 A;  4FUU A;  1K8A 2;  1QF8 A;  2QA4 Z;  3B3T A;  2QML A;  4A3B I;  3BI0 A;  2B5G A;  5JM6 A;  1VQK Z;  2AE6 A;  2PJ6 A;  2JA5 I;  1TWC I;  4H6U A;  3RYO A;  2OTL Z;  2OTJ Z;  5C88 A;  4BD9 A;  1VGY A;  4AVC A;  4UCM A;  3QAY A;  1Z01 A;  1IB1 E;  4MRI A;  1K83 I;  2AFX A;  4WWV A;  1OZP A;  5HH1 A;  3CME Z;  1Z02 A;  2HB6 A;  1YW4 A;  4A3I I;  3PFO A;  4PQA A;  2DXQ A;  2QRC B;  3D2P A;  4K3N A;  3EY5 A;  1LCP A;  3TFY A;  4MCQ A;  1Y9W A;  1M90 2;  2VI7 A;  3DGV A;  2WB1 A;  4MXU A;  2REF A;  3B3S A;  1QQ9 A;  3S1N I;  1UWY A;  2R7H A;  3FH4 A;  2R98 A;  1Y9K A;  5THW A;  1XOV A;  4NBH A;  1VIX A;  5EMI A;  3H3V J;  2DE5 A;  1Q81 1;  1I6H I;  2JA6 I;  1B87 A;  2F4O A;  4DNC A;  2O4H A;  3G3S A;  3S6K A;  3CMA Z;  1ARL A;  3KQX A;  2JMO A;  2DEA A;  3J81 f;  3MN8 A;  4A30 A;  2ZAE B;  2VPZ A;  2GLJ A;  2ZEG A;  2AYD A;  2YNC C;  3S9N A;  4BY7 I;  2V8V A;  5HVH A;  5D1O B;  5IP9 I;  2AFZ A;  4NGN A;  5FVJ A;  3R9G A;  2DE6 A;  1I50 I;  3H4Q A;  2Z10 A;  4KVO E;  1VQ4 Z;  4H6Z A;  3WR7 A;  2P6E A;  3RZA A;  1H8L A;  2LIY A;  1VQ6 Z;  3LOD A;  1ZH1 A;  3KZW A;  3GCF A;  2E2J I;  3IWW A;  3RBU A;  3D68 A;  2NAP A;  3LUS A;  3R9E A;  3G4S 1;  2XEF A;  2P6F A;  1WZN A;  3IFE A;  2ODF A;  1YI2 1;  3UY5 A;  5K8M A;  3GTM I;  3S9L A;  1R9T I;  4NBF A;  1TF8 A;  2JR6 A;  3KKW A;  2NVQ I;  5G21 A;  4MFP A;  3IGR A;  2JIM A;  4NGQ A;  4A94 A;  3R9F A;  2OOX B;  3EO4 A;  4CL1 A;  4OLL A;  1X12 A;  2FS5 A;  2JNY A;  4H89 A;  5J8C A;  1JJ2 Z;  1NUI A;  4EWC A;  5EC4 A;  4NBD A;  1MJA A;  1VLA A;  3TTH A;  2V8H A;  2O53 A;  1S7L A;  1HDU A;  5AG7 A;  2I79 A;  5G1Z A;  4M3S A;  3W91 A;  3JTK A;  4CAX A;  4CYN A;  1YSJ A;  2PJA A;  1Z2L A;  1M44 A;  5K8N A;  4P4B A;  3KGQ A;  4KOU A;  4MFQ A;  4AVA A;  3D2L A;  1FT7 A;  1F2O A;  3EXN A;  2YNE A;  2JA8 I;  3TO7 A;  5IP7 I;  1ELL P;  1VQN Z;  5EBV A;  4MD8 A;  3R1K A;  5J8F A;  1VQ8 1;  1M4D A;  4HKF A;  3FEC A;  4Y52 I;  2AJ6 A;  4MI4 A;  1M4I A;  2IJZ A;  4CGN A;  3A9L A;  2V8J A;  2P28 A;  1YJW Z;  3QB8 A;  4II9 A;  4B5P A;  2RPR A;  4MHP A;  5F09 A;  4HPS A;  4MD9 A;  1KD1 2;  1YVK A;  5IT9 f;  1YGH A;  3CPW Y;  3CXC Z;  3S1Q I;  2IZ4 A;  3N5F A;  4UEZ A;  3CXS A;  3PFE A;  3T90 A;  2QLV B;  1VHE A;  3S1R I;  2HC9 A;  5T6B A;  3GUX A;  4MCR A;  4RUH A;  2GRE A;  1IY7 A;  4UA3 A;  4FAI A;  3LAC A;  4FD7 A;  2RT9 A;  3CCE Z;  3JUW A;  1NSL A;  4Q36 A;  3ZZI A;  4P4J A;  2DF5 A;  2Q7S A;  1LAM A;  4CYP A;  2CXA A;  1QXF A;  1CP7 A;  3CC4 Z;  3HOU I;  4CYO A;  2QRE B;  4MFJ A;  3NH8 A;  3MZK B;  3I07 A;  2OZG A;  1LFW A;  2F5I A;  1VQL Z;  1WJ2 A;  1X10 A;  3F0A A;  1R57 A;  2OB0 A;  2OZH A;  4MHD A;  1RTQ A;  4MY0 A;  2Z3L A;  2HF1 A;  3NA6 A;  2VXK A;  3GTL I;  1PU9 A;  2ZW5 A;  1CPX A;  1Y7R A;  1SQH A;  1Q86 2;  3PBE A;  1NJI 2;  1M4L A;  1HDQ A;  1A2Z A;  4AG7 A;  1BAV A;  1P4N A;  4NBA A;  2C1C A;  1Y1V S;  2GIV A;  2BO9 A;  1Q82 1;  1Z8L A;  4E31 A;  3MZL B;  1S3Z A;  1KWM A;  3IIB A;  5IV0 A;  2C6C A;  4A93 I;  3HLP A;  5ISV A;  5FLM I;  3FNC A;  3PB6 X;  3TC8 A;  3CCV Z;  1KZF A;  4C2Z A;  4NGP A;  2JEW A;  2WUU A;  2LFU A;  3I55 Z;  4ZX8 A;  1Z03 A;  1N8R 1;  4KSA A;  2JUB A;  1I1D A;  5IT9 b;  1YW6 A;  3PB8 X;  3PO3 S;  3DR8 A;  2WYR A;  4E2W A;  1YIT Z;  2LEX A;  1K73 2;  1XE4 A;  4XPD C;  3OWC A;  2VUM I;  3JAM f;  4X3R A;  3CPA A;  3IU1 A;  5F49 A;  4B5O A;  2V8K A;  4CS0 B;  4P10 A;  4YGO A;  1IU8 A;  3K7A I;  2PJ9 A;  1VQ4 1;  1YLE A;  3IC1 A;  3FVL A;  2C27 A;  1YUA A;  5T64 A;  4NCZ A;  3D7H A;  3CC7 Z;  4M85 A;  4Q38 A;  3K9T A;  4CPA A;  5I4M A;  3TOA A;  3N7Z A;  4NF1 A;  3L2N A;  2R6M A;  3EFA A;  1Y1V I;  4OC3 A;  1BLL E;  3VWD A;  4BBR I;  2FSR A;  4QVT A;  4A3L I;  5LYF A;  4MH4 A;  2RC4 A;  3WC6 A;  2ZEL A;  3G71 Z;  1Z4R A;  4CGM A;  2PJ8 A;  3GY9 A;  1P9N A;  1Z9U A;  2ZEM A;  1YIJ 1;  4WJB A;  1S7F A;  4AXV A;  2D4O A;  2RHB A;  5JQ4 A;  4ONW A;  4AB7 A;  2B4D A;  1FNO A;  5AG4 A;  4R7M A;  4OC5 A;  4U5Y A;  1XJO A;  3T9Y A;  3HUV A;  1ZG7 A;  4RS4 A;  2BOA A;  4C7I A;  3CXP A;  4RVG A;  1N71 A;  3VTN A;  1Q2Y A;  4JJX A;  1P0H A;  3LWU A;  2P6G A;  4KVM E;  1KQS Y;  4F0X A;  2Q0Y A;  5A28 A;  2YAD A;  2CIJ A;  3KR4 A;  1SFO I;  4PK2 A;  4F0Y A;  2AFM A;  3IR7 A;  3TT2 A;  1Z5R A;  4KOW A;  3KL9 A;  4MHN A;  2PJ3 A;  3CC2 1;  4Z65 A;  4DK1 A;  2NVT I;  3R95 A;  3S6H A;  3CZX A;  2BUE A;  4KUA A;  5KTD A;  5CPA A;  1KQS Z;  1WWZ A;  2J9A A;  4KOX A;  4L89 A;  4IHM A;  4MBU A;  3S17 I;  4A2Z A;  4QTT A;  4KOY A;  5I0C A;  1DL6 A;  2QEX 1;  1TF9 A;  3WAB A;  2GLF A;  2Q7B A;  4PXD A;  4TWE A;  3PO2 I;  1PFT A;  1TKH A;  1R3N A;  4NBB A;  3FKI I;  3ISX A;  2JIP A;  4JXQ A;  2R8V A;  3RAM A;  4M6I A;  5F48 A;  3PB4 X;  2VZY A;  2OU2 A;  1Y0R A;  2GTI A;  2Q43 A;  1CBX A;  1JQG A;  1VQO Z;  4NBE A;  1L0C A;  4Y49 C;  2OOT A;  5A2Q b;  4ZI6 A;  2JIQ A;  2GAN A;  3SJX A;  4HNX B;  5HMN A;  3NDJ A;  1Q7Y 1;  3CCM Z;  4A3M I;  4F8Z A;  1LQL A;  5G20 A;  1CJW A;  2QIR A;  1JWH C;  4GM5 A;  2F7V A;  1VQP Z;  2EVN A;  2GTH A;  3GTQ I;  1CPS A;  4E8O A;  3LD2 A;  4E30 A;  4BXX I;  1ZB8 A;  2QYV A;  4MON A;  3SJF A;  2E7Z A;  4A31 A;  2M48 A;  4FBE A;  4FD6 A;  5A27 A;  3OW2 Z;  5G22 A;  1VQ9 1;  3GTO I;  5CM2 M;  2BEI A;  4DUK A;  4HH4 A;  4BMH A;  5K8P A; 
#chains in the Genus database with same CATH homology
 4EME A;  3TDH B;  2WZN A;  3B35 A;  2PJ4 A;  2EK9 A;  4NGR A;  4B6Z A;  1W2B Z;  3B3V A;  5C4X I;  3FEC A;  1QVF Y;  2ZOF A;  4Y52 I;  4P4F A;  4NBG A;  4TNU A;  3HOV I;  8CPA A;  3CC2 Z;  2C6P A;  2IJZ A;  1YJW 1;  3PB9 X;  4YWY A;  4E2Y A;  2JA7 I;  1IGB A;  1YLO A;  1X3Z A;  3CCL Z;  2V8J A;  4UF4 A;  2P28 A;  3VMG A;  5DS0 A;  2XEG A;  3WC7 A;  1OBR A;  3VAR A;  5D8N A;  3IO1 A;  3EED A;  1YJW Z;  1ZLH A;  3B7I A;  3FQM A;  1N2F A;  2F4M A;  1BPM A;  2ZEH A;  3J7A 4;  2RPR A;  3H8G A;  2AFU A;  2JBK A;  2ABZ A;  4MHP A;  5F09 A;  2VF1 A;  2QKD A;  4JYW A;  3KIF A;  6CPA A;  2BJO A;  3HOZ I;  2NSM A;  3WT4 A;  1VQ8 Z;  3NH5 A;  5LRJ A;  4MD9 A;  3BI1 A;  1KD1 2;  3BHX A;  5IT9 f;  5LRG A;  3VMI A;  1DE4 C;  3TX8 A;  2PCU A;  1BPN A;  4P4E A;  3CPW Y;  3CXC Y;  3M3Y I;  3CXC Z;  3I4M I;  2AFS A;  1YJ9 1;  2PVV A;  1ELM P;  3KAS A;  3S1Q I;  4NGS A;  3I56 Z;  2J6A A;  4NFR A;  3I1U A;  3EER A;  2IZ4 A;  3JAM b;  3N5F A;  4UEZ A;  5C4J I;  1ZG9 A;  3PFE A;  4MCP A;  1VHO A;  2OR4 A;  1WW9 A;  1TWF I;  3IFU A;  3VMH A;  1VQ5 1;  4QTU A;  1QVG Y;  4UEE A;  4DYO A;  2QLV B;  1VHE A;  3S1R I;  1Q82 2;  3SJE A;  2HC9 A;  3D7G A;  5T6B A;  1PYT B;  4UEF A;  1K8A 1;  2RFH A;  1USP B;  2ZEO A;  4PXC A;  2W04 A;  1VQ5 Z;  3GUX A;  3SI1 A;  3CCL 1;  2PRQ A;  4E32 A;  3I55 1;  2R7Z I;  2AFO A;  4X2T A;  2DE7 A;  4MMO A;  1EE3 P;  2VUG A;  4MCR A;  3FEE A;  4MHZ A;  3KIH A;  1M90 1;  4OME A;  4RUH A;  5K8O A;  2OTJ 1;  4P45 A;  2GRE A;  4OC2 A;  1LOK A;  5HVF A;  1IY7 A;  2QR1 B;  4FAI A;  4EFD A;  1Q7Y 2;  1QYP A;  2IQ6 A;  1JJ2 Y;  2Q51 A;  4P4I A;  3VAT A;  2RT9 A;  3H8F A;  5J1Q A;  3CCE Z;  3VH9 A;  3HKZ A;  4NJR A;  3IJ3 A;  1DTD A;  4NH1 C;  2JBJ A;  3KR5 A;  2PJ5 A;  4PXE A;  4P4J A;  3FED A;  2NYQ A;  4A3C I;  1NP6 A;  2QVP A;  3S2H I;  1WII A;  1ZLI A;  3VB9 A;  4OID A;  3PBB A;  1LAM A;  4OKO A;  3CCQ Z;  4A38 A;  2KPI A;  3S16 I;  4BY1 I;  2NVX I;  5LYL A;  1TKJ A;  4Q7A A;  1CP7 A;  3CC4 Z;  1M1K 1;  4O23 A;  3HOU I;  3D9X A;  2C6G A;  2FVG A;  1I3Q I;  4ZY0 A;  1KC8 1;  2V8I A;  2QRE B;  4S1T A;  3CCV 1;  3F3P C;  3NH8 A;  1M1K 2;  3MZK B;  3I07 A;  2E9H A;  2EGT A;  2AFW A;  2G9D A;  3CCR 1;  3FQQ A;  1LFW A;  4MD7 A;  2Q4Z A;  1VQL Z;  1ZG8 A;  4OC1 A;  2YU9 I;  3NFZ A;  4A3F I;  2R93 I;  1F2P A;  3S14 I;  1KRL A;  3SI0 A;  3BG1 B;  1RTQ A;  2PK7 A;  3IF8 A;  2K5R A;  1S72 1;  2W03 A;  1WCM I;  3CQZ I;  2HF1 A;  3JRU A;  1VQL 1;  3NA6 A;  1K73 1;  1K9M 2;  3GTL I;  1AYE A;  4X6A I;  1CPX A;  2R92 I;  2PJ1 A;  1TXR A;  2RB7 A;  3D67 A;  1Q86 2;  1VQ9 Z;  4IAV A;  1Y7E A;  3ESW A;  3HOY I;  2I3C A;  3PBE A;  1NJI 2;  4NOZ A;  1HDQ A;  1RLY A;  1M4L A;  1X0T A;  5C3E I;  1K9M 1;  1CG2 A;  2VL1 A;  3KHX A;  5HVG A;  4A3G I;  1RNI A;  1BAV A;  3CCE 1;  1LAP A;  5FLX f;  4NBA A;  5IB9 A;  3D4U A;  1YHQ Z;  3CCS Z;  2C1C A;  1Y1V S;  3CDX A;  2BO9 A;  5HXD A;  1Q82 1;  1Z8L A;  4E31 A;  1RQF A;  5JH9 A;  3OW2 Y;  7CPA A;  3MZL B;  1USP A;  4NB9 A;  1KWM A;  3IIB A;  2C6C A;  3K2K A;  1VQO 1;  3J80 b;  4A93 I;  4P44 A;  3HLP A;  3PB7 X;  1YJ9 Z;  3RZD I;  3I56 1;  1YJN Z;  5FLM I;  3KI9 A;  1CP6 A;  4MCS A;  3CCR Z;  3PB6 X;  1L1O C;  4KSI A;  3TC8 A;  4R8F A;  5AN9 F;  1HEE A;  2PMZ A;  3NH4 A;  1VQM Z;  3CMA 1;  3S2D I;  3CCV Z;  1QMU A;  2ZEE A;  2PVW A;  4G1P A;  4W9Y A;  5LRK A;  2NVY I;  4NGP A;  3B3W A;  4DGL A;  1YME A;  3G6E 1;  3Q87 A;  1QVF Z;  2JEW A;  2PJ0 A;  3QNV A;  3ISZ A;  2QA4 1;  2PJ7 A;  4A39 A;  4FUU A;  2LFU A;  3I55 Z;  1K8A 2;  2E2I I;  2OZK A;  4ZX8 A;  1Z03 A;  2QRD B;  1QF8 A;  4ZY2 A;  1N8R 1;  2EWB A;  2KI7 B;  2JUB A;  2QA4 Z;  2CTB A;  1Q86 1;  5IT9 b;  1YW6 A;  3PB8 X;  3PO3 S;  3B3T A;  4OP4 A;  1RO0 A;  3WC5 A;  3CCS 1;  2WYR A;  4E2W A;  2ZEP A;  1YIT Z;  4UIA A;  1K73 2;  1N8R 2;  4A3B I;  3BI0 A;  4R76 A;  3G71 1;  1VQK Z;  5JM6 A;  2VUM I;  3JAM f;  1LAN A;  4X3R A;  2PJ6 A;  2JA5 I;  1TWC I;  3CPA A;  4H2K A;  2OTL Z;  1W2B Y;  2OTJ Z;  1VQ7 1;  4NGM A;  1YI2 Z;  4IK2 A;  2V8K A;  3B3C A;  4P10 A;  2POK A;  2ANP A;  1YIJ Z;  4RV9 A;  1XBU A;  3K7A I;  1TWA I;  2IZ3 A;  2PJ9 A;  1VQ4 1;  2V8D A;  5D29 A;  1YJN 1;  2RIQ A;  1R43 A;  4BD9 A;  2AKL A;  3KHZ A;  1VGY A;  1ARM A;  3IC1 A;  3FVL A;  3F3F C;  1YUA A;  4NGT A;  5T64 A;  1Z01 A;  3D7H A;  4MRI A;  1K83 I;  3CC7 Z;  2AFX A;  4WWV A;  3TE5 B;  3CME Z;  1Z02 A;  2HB6 A;  3CC4 1;  1YW4 A;  4A3I I;  4Y7N I;  3K9T A;  3PFO A;  4CPA A;  4XX2 A;  4PQA A;  5I4M A;  2QRC B;  1GYT A;  2PJ2 A;  2V77 A;  4K3N A;  1ZB9 A;  2QJ8 A;  3L2N A;  2QEX Z;  3S15 I;  2R6M A;  2M6N A;  4E2Z A;  1NSA A;  1Y1V I;  1VQK 1;  3J81 b;  1LCP A;  4OC3 A;  1BLL E;  4EWT A;  4BBR I;  4MCQ A;  4PPZ A;  2RBL A;  3DLJ A;  3CCM 1;  4A3L I;  1XFO A;  5LYF A;  2HU9 A;  3H0G I;  4MH4 A;  1TWG I;  1M90 2;  3WC6 A;  2ZEL A;  3S9M A;  1TKF A;  4OC4 A;  4BBS I;  3G71 Z;  3DGV A;  2WB1 A;  2ZED A;  3IEH A;  4MXU A;  2PJ8 A;  1XMB A;  3I4N I;  1YHQ 1;  1P9N A;  1YUK A;  3IX0 A;  3B3S A;  4OC0 A;  3T4N B;  1XRY A;  3BXM A;  1QQ9 A;  3LMS A;  1TWH I;  3S1N I;  1AMP A;  2ZEM A;  1UWY A;  1YIJ 1;  3HOX I;  4WJB A;  5C44 I;  4AXV A;  3GTM S;  3FH4 A;  2RHB A;  5THW A;  4ONW A;  2PJB A;  4NBH A;  3GTG I;  1VIX A;  1FNO A;  4E33 A;  2EK8 A;  3KQZ A;  4R7M A;  3CCU Z;  4F9U A;  4OIW A;  3H3V J;  3CC7 1;  4OC5 A;  2DE5 A;  1Q81 1;  1I6H I;  2JA6 I;  1XJO A;  3HUV A;  2F4O A;  3PO3 I;  1ZG7 A;  4A3J I;  3HOW I;  2O4H A;  3D66 A;  2WAQ A;  1F57 A;  4RS4 A;  3U50 C;  2BOA A;  3CMA Z;  1ARL A;  3KQX A;  2JMO A;  2DEA A;  4RVG A;  1VQ6 1;  2B63 I;  4PXB A;  3BG0 B;  3VTN A;  3QWU A;  3J81 f;  5FLX b;  4A37 A;  4NB8 A;  3V38 A;  1RO2 A;  3MN8 A;  2ZAE B;  3G4S Z;  1QVG Z;  2GLJ A;  2ZEG A;  3LWU A;  2PIY A;  5LYI A;  1ML8 A;  2H85 A;  3S9N A;  4BY7 I;  1VQ8 1;  1KQS Y;  4YU9 A;  2PE3 A;  2V8V A;  5HVH A;  5D1O B;  2YAD A;  5IP9 I;  4FWU A;  1KD1 1;  2P3Y A;  2AFZ A;  2CIJ A;  3D7F A;  3CCJ 1;  3KR4 A;  3CD6 Z;  2OTL 1;  1SFO I;  4NGN A;  3GTK I;  5ELY A;  2JS4 A;  4RVF A;  2GU2 A;  2AFM A;  3FMC A;  4NJQ A;  2DE6 A;  1I50 I;  4LQG A;  3S1M I;  4F9V A;  1Z5R A;  3MRU A;  4R6T A;  2V8G A;  3H8E A;  5CBM A;  2F8H A;  1VQ4 Z;  3GB0 A;  3KL9 A;  3G6E Z;  2PJ3 A;  3CC2 1;  4MHN A;  4MHY A;  3NDI A;  3FJU A;  4Z65 A;  4DK1 A;  1RO4 A;  4HGZ A;  2NVT I;  3CCU 1;  3RZA A;  1H8L A;  3FX6 A;  2OOY B;  3FF3 A;  2LIY A;  1VQ6 Z;  4NBC A;  4E2X A;  1ZH1 A;  5A2Q f;  3KZW A;  3GTP I;  5CPA A;  2ZEN A;  1KQS Z;  3GCF A;  4X8I A;  2E2J I;  3D6W A;  2J9A A;  3IWW A;  3RBU A;  3RZO I;  4IHM A;  3D68 A;  3J80 f;  3S17 I;  4QTT A;  3GLJ A;  4P6Y A;  2ZOG A;  1DL6 A;  2QEX 1;  1TF9 A;  3WAB A;  3LUS A;  4P4D A;  1S72 Z;  2GLF A;  3CPW Z;  2XEJ A;  5LYD A;  3G4S 1;  4PXD A;  3P5J B;  1NJI 1;  4TWE A;  2XEF A;  3PO2 I;  1CX8 A;  1PFT A;  1VQP 1;  3IFE A;  2PM9 A;  1TKH A;  1R3N A;  2PIZ A;  4NBB A;  1YI2 1;  5K8M A;  3GTM I;  3S9L A;  2K3R A;  3FKI I;  1R9T I;  3ISX A;  4A3D I;  1S7M A;  3CT9 A;  4NBF A;  3CD6 1;  2Y0S A;  3RAM A;  5T67 A;  4JZ0 A;  4A3E I;  1Q81 2;  3PB4 X;  1Y0R A;  1TF8 A;  3GKQ A;  2ZEF A;  2JR6 A;  2NVQ I;  1VQN 1;  3GTJ I;  2GTI A;  2Q43 A;  1CBX A;  1JQG A;  1VQO Z;  3SJG A;  4NGQ A;  4A94 A;  3CME 1;  2OOX B;  1KC8 2;  4ZY1 A;  4RVD A;  2G2K A;  4CL1 A;  4NBE A;  1X3W A;  3CPX A;  2XEI A;  3T8W A;  1VQM 1;  5JGF A;  2OOT A;  5A2Q b;  2JNY A;  1JJ2 Z;  4ZI6 A;  3B2Y A;  2CF4 A;  3SJX A;  2CTC A;  1NUI A;  4EWC A;  4DJL A;  3NDJ A;  1Q7Y 1;  3CCM Z;  4A3M I;  4UIB A;  4F8Z A;  4NBD A;  1VLA A;  1LQL A;  3M4O I;  1PCA A;  4ZX9 A;  3SI2 A;  2V8H A;  2O53 A;  1JWH C;  5D1P A;  1HDU A;  4ZYQ A;  4GM5 A;  2F7V A;  1VQP Z;  4HGY A;  2GTH A;  3GTQ I;  1CPS A;  1YIT 1;  1YSJ A;  2PJA A;  2E2H I;  2PJC A;  4E30 A;  4BXX I;  1ZB8 A;  1Z2L A;  2QYV A;  4RVH A;  5D1O A;  5K8N A;  4P4B A;  3KGQ A;  4MON A;  4DQY B;  3V7Z A;  3PEI A;  3SJF A;  2M48 A;  4FBE A;  3D7D A;  1VQ7 Z;  3CCJ Z;  3OW2 Z;  1Q7L A;  1TFI A;  4AYB A;  1VQ9 1;  3GTO I;  1FT7 A;  1F2O A;  2JA8 I;  1Y1W I;  5CM2 M;  2BCO A;  4A3K I;  5IP7 I;  2IMO A;  4DUK A;  1ELL P;  5LL6 f;  1VQN Z;  3CCQ 1;  4HH4 A;  4MD8 A;  1Y0Y A;  3MON A;  5K8P A;  3PRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...