1WJ2A

Solution structure of the c-terminal wrky domain of atwrky4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
VQTTSEVDLLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable WRKY transcription factor 4
publication title Solution structure of an Arabidopsis WRKY DNA binding domain.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 1wj2A00
1WJ2A 2AYDA 2LEXA
chains in the Genus database with same CATH superfamily
1TWCI 2E7ZA 1VQN1 1RO4A 4A93I 1RNIA 3I55Z 1S72Z 4MD8A 4NBGA 1Q812 3KIHA 1M1K2 5D1PA 1KD12 3HOYI 1YJW1 2W04A 3MONA 2J6AA 3D9XA 4QTUA 4NBBA 1N8R1 2E9HA 5IP9I 2B63I 4NH1C 1VQ91 3S1MI 3S15I 1VQK1 4E32A 1WIIA 3CXCY 3I561 1FDIA 3H0GI 1X3WA 2R6MA 2PK7A 1FDOA 3J7A4 2M6NA 1WZNA 1R9TI 3JAMb 2E2II 4HGYA 4BBSI 5D1OB 4E2ZA 3CPWZ 1TWHI 1X3ZA 4DGLA 1VQ41 1M902 2JS4A 2QA4Z 2NVXI 2IZ4A 2KI7B 2Y0SA 3NH8A 4A3LI 3CD61 3GTMS 2V8KA 1VQ7Z 4A3KI 3I4MI 4MONA 3U50C 3J80f 5T64A 1L1OC 3CME1 5IT9b 2OTJ1 3CMA1 1I6HI 3J81b 2LFUA 3D2LA 1VQM1 1N8R2 4CL1A 5A2Qf 2JIRA 1QYPA 2W03A 4S1TA 1YI2Z 1K9M1 3GTQI 1KC81 3CCJ1 4XX2A 4NBFA 2OTLZ 3I07A 5C4JI 4E2YA 3VMHA 2JUBA 1YHQ1 5FLXb 3CD6Z 3CCEZ 3CC7Z 3CCU1 4A3GI 1NP6A 4A3CI 2VUGA 1YJNZ 1WW9A 3ESWA 2HU9A 4BXXI 3VMIA 2EGTA 3GTLI 2RIQA 1NUIA 2WAQA 3CMAZ 3T4NB 2JIPA 3GTOI 3CC21 4NBCA 1K731 2O53A 2RT9A 4NBHA 1JJ2Z 1YUKA 4NBAA 1VQP1 4A3FI 3M4OI 4NB8A 4RVHA 1KRLA 3S2DI 2VPWA 3G71Z 1K9M2 1W2BZ 2BJOA 1KC82 1YITZ 4RS4A 2E2JI 3LUSA 3PO3S 4BY1I 1VQ5Z 1WJ2A 1Q7Y1 4NOZA 2F4OA 2KPIA 2V3VA 2LEXA 2O4HA 1NJI1 2OOXB 3EERA 5IP7I 2AYDA 3CCLZ 2PM9A 4NBEA 1Q862 2QEX1 3S17I 1ZH1A 3HOUI 4A3DI 1AA6A 1S7MA 1KQSZ 2JIQA 2VPZA 4MH4A 2RPRA 3CPWY 3GCFA 1VQNZ 2PMZA 2P28A 2VPYA 2Q4ZA 5CM2M 2JIOA 3BG1B 2QRCB 1YJWZ 1K732 5D1OA 4E30A 1YIJ1 1I3QI 3GTJI 1VLAA 3IR7A 3IF8A 3VMGA 3G4S1 3OW2Z 1VQ9Z 2DE6A 3PO2I 3J81f 1VQKZ 4HH4A 3OW2Y 1Q821 1VQ61 3I56Z 3RZDI 1TWFI 3CC41 2E2HI 3P5JB 1VQL1 2QRDB 4E2WA 3F3PC 1VQO1 1VQ81 1LQLA 2R93I 3NDJA 3QWUA 4EWCA 2OOYB 1JWHC 3CCS1 2F4MA 1YJ91 1Q7Y2 3RZOI 2GTHA 2JA8I 3CCM1 2YADA 3S16I 4NB9A 1VQ4Z 3MZKB 1QVFZ 1ZB9A 2NVTI 5FLXf 4A3II 1QVFY 3F3FC 1TWAI 3CCV1 4X6AI 5T67A 3HOWI 2VUMI 2I3CA 2NVYI 4NBDA 1RQFA 4MD7A 1TFIA 2JR6A 4RVFA 5A2Qb 3I551 3VB9A 5C44I 1I50I 4A3EI 3NH5A 3CMEZ 1K83I 2ZAEB 2Q51A 4MRIA 3M3YI 3S14I 2VF1A 1K8A1 1QVGZ 2OTJZ 3NFZA 1QF8A 2P3YA 1VQLZ 4AYBA 1VQMZ 1VQOZ 2JNYA 4A3BI 3GTMI 4Y7NI 1Q16A 2JA6I 2OZKA 3GTGI 3CCJZ 1P9NA 1JJ2Y 1QXFA 1SFOI 1N2FA 4DQYB 3HOVI 2NVQI 4RV9A 2GU2A 3VTNA 5C4XI 1Z01A 1YHQZ 4E33A 4BY7I 3S1RI 1USPB 4MD9A 3CCUZ 3HKZA 1W2BY 4Y52I 2H85A 2V8JA 3MZLB 2QA41 3NDIA 3K7AI 4NFRA 2RBLA 2K3RA 3JAMf 1USPA 1VQ71 3Q87A 1RO2A 3FQMA 4DK1A 3CC2Z 3H3VJ 1Y1VS 1TWGI 5LL6f 3TE5B 3CXCZ 3HOZI 1ZB8A 1Y8CA 2DE7A 2JMOA 4MXUA 5FLMI 1KQSY 4BBRI 1K8A2 2IZ3A 1VQPZ 1Z03A 5AN9F 2VPXA 2YU9I 1YI21 3I4NI 3IX0A 3CCQ1 3S2HI 5IT9f 2OTL1 3GKQA 1X0TA 2K5RA 1SIWA 3TDHB 2QREB 1RLYA 2RHBA 5T6BA 5C3EI 3CQZI 2AKLA 3CCE1 1Z02A 3CC71 1RO0A 3CCR1 3FKII 2QEXZ 4QTTA 1YJN1 4A3JI 4HGZA 2IV2X 1Y1WI 1NJI2 3PO3I 3G6E1 3J80b 3IFUA 3EEDA 4RVDA 1Q811 1PFTA 2LIYA 1ML8A 1M1K1 1KD11 2HF1A 2G2KA 3HOXI 4E31A 4RVGA 1YIJZ 3NH4A 2JIMA 2V8IA 3CCQZ 1S721 3KIFA 2QKDA 3GTPI 3G4SZ 1Y1VI 3S1NI 1VQ6Z 2QLVB 4E2XA 3GTKI 2NAPA 2M48A 3G711 3CC4Z 2WB1A 3FQQA 1YIT1 1QVGY 3D6WA 3BG0B 1Q861 2JA7I 2R7ZI 2QR1B 3CCRZ 3S1QI 1VQ8Z 1VQ51 3CCSZ 1YJ9Z 3CCMZ 2JA5I 2V45A 4TNUA 1Q822 1M901 2DE5A 3CCL1 3G6EZ 2GTIA 3CCVZ 4A3MI 2R92I 1WCMI 1DL6A 1YUAA
chains in the Genus database with same CATH topology
1WJ2A 2AYDA 2LEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJ2 A;  2AYD A;  2LEX A; 
#chains in the Genus database with same CATH topology
 1TWC I;  2E7Z A;  1VQN 1;  1RO4 A;  4A93 I;  1RNI A;  3I55 Z;  1S72 Z;  4MD8 A;  4NBG A;  1Q81 2;  3KIH A;  1M1K 2;  5D1P A;  1KD1 2;  3HOY I;  1YJW 1;  2W04 A;  3MON A;  2J6A A;  3D9X A;  4QTU A;  4NBB A;  1N8R 1;  2E9H A;  5IP9 I;  2B63 I;  4NH1 C;  1VQ9 1;  3S1M I;  3S15 I;  1VQK 1;  4E32 A;  1WII A;  3CXC Y;  3I56 1;  1FDI A;  3H0G I;  1X3W A;  2R6M A;  2PK7 A;  1FDO A;  3J7A 4;  2M6N A;  1WZN A;  1R9T I;  3JAM b;  2E2I I;  4HGY A;  4BBS I;  5D1O B;  4E2Z A;  3CPW Z;  1TWH I;  1X3Z A;  4DGL A;  1VQ4 1;  1M90 2;  2JS4 A;  2QA4 Z;  2NVX I;  2IZ4 A;  2KI7 B;  2Y0S A;  3NH8 A;  4A3L I;  3CD6 1;  3GTM S;  2V8K A;  1VQ7 Z;  4A3K I;  3I4M I;  4MON A;  3U50 C;  3J80 f;  5T64 A;  1L1O C;  3CME 1;  5IT9 b;  2OTJ 1;  3CMA 1;  1I6H I;  3J81 b;  2LFU A;  3D2L A;  1VQM 1;  1N8R 2;  4CL1 A;  5A2Q f;  2JIR A;  1QYP A;  2W03 A;  4S1T A;  1YI2 Z;  1K9M 1;  3GTQ I;  1KC8 1;  3CCJ 1;  4XX2 A;  4NBF A;  2OTL Z;  3I07 A;  5C4J I;  4E2Y A;  3VMH A;  2JUB A;  1YHQ 1;  5FLX b;  3CD6 Z;  3CCE Z;  3CC7 Z;  3CCU 1;  4A3G I;  1NP6 A;  4A3C I;  2VUG A;  1YJN Z;  1WW9 A;  3ESW A;  2HU9 A;  4BXX I;  3VMI A;  2EGT A;  3GTL I;  2RIQ A;  1NUI A;  2WAQ A;  3CMA Z;  3T4N B;  2JIP A;  3GTO I;  3CC2 1;  4NBC A;  1K73 1;  2O53 A;  2RT9 A;  4NBH A;  1JJ2 Z;  1YUK A;  4NBA A;  1VQP 1;  4A3F I;  3M4O I;  4NB8 A;  4RVH A;  1KRL A;  3S2D I;  2VPW A;  3G71 Z;  1K9M 2;  1W2B Z;  2BJO A;  1KC8 2;  1YIT Z;  4RS4 A;  2E2J I;  3LUS A;  3PO3 S;  4BY1 I;  1VQ5 Z;  1WJ2 A;  1Q7Y 1;  4NOZ A;  2F4O A;  2KPI A;  2V3V A;  2LEX A;  2O4H A;  1NJI 1;  2OOX B;  3EER A;  5IP7 I;  2AYD A;  3CCL Z;  2PM9 A;  4NBE A;  1Q86 2;  2QEX 1;  3S17 I;  1ZH1 A;  3HOU I;  4A3D I;  1AA6 A;  1S7M A;  1KQS Z;  2JIQ A;  2VPZ A;  4MH4 A;  2RPR A;  3CPW Y;  3GCF A;  1VQN Z;  2PMZ A;  2P28 A;  2VPY A;  2Q4Z A;  5CM2 M;  2JIO A;  3BG1 B;  2QRC B;  1YJW Z;  1K73 2;  5D1O A;  4E30 A;  1YIJ 1;  1I3Q I;  3GTJ I;  1VLA A;  3IR7 A;  3IF8 A;  3VMG A;  3G4S 1;  3OW2 Z;  1VQ9 Z;  2DE6 A;  3PO2 I;  3J81 f;  1VQK Z;  4HH4 A;  3OW2 Y;  1Q82 1;  1VQ6 1;  3I56 Z;  3RZD I;  1TWF I;  3CC4 1;  2E2H I;  3P5J B;  1VQL 1;  2QRD B;  4E2W A;  3F3P C;  1VQO 1;  1VQ8 1;  1LQL A;  2R93 I;  3NDJ A;  3QWU A;  4EWC A;  2OOY B;  1JWH C;  3CCS 1;  2F4M A;  1YJ9 1;  1Q7Y 2;  3RZO I;  2GTH A;  2JA8 I;  3CCM 1;  2YAD A;  3S16 I;  4NB9 A;  1VQ4 Z;  3MZK B;  1QVF Z;  1ZB9 A;  2NVT I;  5FLX f;  4A3I I;  1QVF Y;  3F3F C;  1TWA I;  3CCV 1;  4X6A I;  5T67 A;  3HOW I;  2VUM I;  2I3C A;  2NVY I;  4NBD A;  1RQF A;  4MD7 A;  1TFI A;  2JR6 A;  4RVF A;  5A2Q b;  3I55 1;  3VB9 A;  5C44 I;  1I50 I;  4A3E I;  3NH5 A;  3CME Z;  1K83 I;  2ZAE B;  2Q51 A;  4MRI A;  3M3Y I;  3S14 I;  2VF1 A;  1K8A 1;  1QVG Z;  2OTJ Z;  3NFZ A;  1QF8 A;  2P3Y A;  1VQL Z;  4AYB A;  1VQM Z;  1VQO Z;  2JNY A;  4A3B I;  3GTM I;  4Y7N I;  1Q16 A;  2JA6 I;  2OZK A;  3GTG I;  3CCJ Z;  1P9N A;  1JJ2 Y;  1QXF A;  1SFO I;  1N2F A;  4DQY B;  3HOV I;  2NVQ I;  4RV9 A;  2GU2 A;  3VTN A;  5C4X I;  1Z01 A;  1YHQ Z;  4E33 A;  4BY7 I;  3S1R I;  1USP B;  4MD9 A;  3CCU Z;  3HKZ A;  1W2B Y;  4Y52 I;  2H85 A;  2V8J A;  3MZL B;  2QA4 1;  3NDI A;  3K7A I;  4NFR A;  2RBL A;  2K3R A;  3JAM f;  1USP A;  1VQ7 1;  3Q87 A;  1RO2 A;  3FQM A;  4DK1 A;  3CC2 Z;  3H3V J;  1Y1V S;  1TWG I;  5LL6 f;  3TE5 B;  3CXC Z;  3HOZ I;  1ZB8 A;  1Y8C A;  2DE7 A;  2JMO A;  4MXU A;  5FLM I;  1KQS Y;  4BBR I;  1K8A 2;  2IZ3 A;  1VQP Z;  1Z03 A;  5AN9 F;  2VPX A;  2YU9 I;  1YI2 1;  3I4N I;  3IX0 A;  3CCQ 1;  3S2H I;  5IT9 f;  2OTL 1;  3GKQ A;  1X0T A;  2K5R A;  1SIW A;  3TDH B;  2QRE B;  1RLY A;  2RHB A;  5T6B A;  5C3E I;  3CQZ I;  2AKL A;  3CCE 1;  1Z02 A;  3CC7 1;  1RO0 A;  3CCR 1;  3FKI I;  2QEX Z;  4QTT A;  1YJN 1;  4A3J I;  4HGZ A;  2IV2 X;  1Y1W I;  1NJI 2;  3PO3 I;  3G6E 1;  3J80 b;  3IFU A;  3EED A;  4RVD A;  1Q81 1;  1PFT A;  2LIY A;  1ML8 A;  1M1K 1;  1KD1 1;  2HF1 A;  2G2K A;  3HOX I;  4E31 A;  4RVG A;  1YIJ Z;  3NH4 A;  2JIM A;  2V8I A;  3CCQ Z;  1S72 1;  3KIF A;  2QKD A;  3GTP I;  3G4S Z;  1Y1V I;  3S1N I;  1VQ6 Z;  2QLV B;  4E2X A;  3GTK I;  2NAP A;  2M48 A;  3G71 1;  3CC4 Z;  2WB1 A;  3FQQ A;  1YIT 1;  1QVG Y;  3D6W A;  3BG0 B;  1Q86 1;  2JA7 I;  2R7Z I;  2QR1 B;  3CCR Z;  3S1Q I;  1VQ8 Z;  1VQ5 1;  3CCS Z;  1YJ9 Z;  3CCM Z;  2JA5 I;  2V45 A;  4TNU A;  1Q82 2;  1M90 1;  2DE5 A;  3CCL 1;  3G6E Z;  2GTI A;  3CCV Z;  4A3M I;  2R92 I;  1WCM I;  1DL6 A;  1YUA A; 
#chains in the Genus database with same CATH homology
 1WJ2 A;  2AYD A;  2LEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...