1WJ2A

Solution structure of the c-terminal wrky domain of atwrky4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
VQTTSEVDLLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Probable WRKY transcription factor 4
publication title Solution structure of an Arabidopsis WRKY DNA binding domain.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 1wj2A00
2AYDA 1WJ2A 2LEXA
chains in the Genus database with same CATH superfamily
1VQNZ 4CL1A 2V8IA 3FQQA 2VPYA 4MD9A 4DQYB 4A3KI 3M4OI 1VQ41 2IZ4A 2YADA 1S7MA 2QRCB 5IT9f 4MXUA 2OTLZ 3KIFA 5FLMI 2W03A 5FLXb 3GTQI 3CD6Z 2VPWA 2R92I 3I55Z 2V3VA 1WW9A 4A93I 1K9M2 1KD11 1KQSZ 5C4XI 4NBCA 1ZB8A 3GTPI 3LUSA 3VMHA 1S721 3S1QI 3CXCZ 2JA6I 4NH1C 2RHBA 4DK1A 2JS4A 1Y1VI 2V8KA 3CQZI 1W2BZ 4QTUA 2HU9A 3GTJI 3GTMS 1USPB 1VQ8Z 3J80b 5IP9I 1JJ2Y 1WZNA 4NB8A 3OW2Z 2NAPA 3D2LA 3CCLZ 3CXCY 2E2II 1YJ9Z 1QXFA 1SFOI 1Q862 3CCMZ 1W2BY 2P28A 2Q4ZA 1VQP1 3CCJ1 1X3ZA 1KRLA 2VUGA 2JA8I 1M1K1 3T4NB 3OW2Y 2JA7I 5CM2M 1FDOA 1VQ4Z 2JIPA 3S1RI 3S14I 1RLYA 2F4MA 1TWAI 4BY7I 3CCQ1 1Q822 3VMIA 1YUAA 4E32A 4E31A 4NBEA 1YHQ1 1P9NA 3VMGA 1TWGI 2WB1A 3NDIA 1Z03A 5A2Qb 4NBBA 2QA41 4DGLA 4HH4A 4RV9A 4A3JI 3G6E1 2O53A 1VQK1 5D1OB 4Y7NI 4BY1I 5C44I 2M48A 3CCV1 1TWCI 2OZKA 2PK7A 2JIQA 2QREB 3G71Z 4A3LI 1R9TI 4MONA 2E2HI 3CME1 3PO3I 4AYBA 1KD12 3GTKI 3JAMf 1AA6A 3PO3S 1I6HI 4HGYA 4A3MI 3NH5A 3I561 3HOYI 1VQPZ 3CCJZ 3Q87A 3IX0A 3HKZA 1ZB9A 2KI7B 2DE6A 3J7A4 3D9XA 2I3CA 3P5JB 3J81b 3CCU1 5C4JI 3CCQZ 1NJI2 4RVFA 1USPA 2JR6A 1YHQZ 1YJN1 2F4OA 3RZDI 1I3QI 3MZKB 1ML8A 4E30A 2LIYA 2QA4Z 1Y8CA 2Q51A 4HGZA 2BJOA 4RS4A 1KC81 1VQM1 2E7ZA 3S16I 3G6EZ 3H3VJ 4RVHA 1JJ2Z 3CC21 1VQKZ 1VQ91 1VQ61 2DE5A 2H85A 3CCVZ 3MZLB 1QVFZ 1VQ5Z 1X0TA 3GTMI 5T67A 3D6WA 4A3DI 1Z02A 3CMEZ 1YIJ1 1YJW1 3GCFA 4MRIA 1RO4A 4XX2A 3CMAZ 2OOYB 3BG1B 4A3FI 1WJ2A 1YIT1 2VUMI 3CC71 5AN9F 1QVFY 2AYDA 4A3CI 1QYPA 2JA5I 2Y0SA 1N8R1 2E2JI 3S1NI 4E2XA 4E2ZA 3NDJA 4NBDA 3VTNA 5D1OA 5IP7I 1QVGY 1SIWA 2G2KA 2RPRA 2OTJ1 1YJNZ 3S2DI 2NVXI 3CCR1 2QRDB 1VQ71 3TE5B 2JIRA 1VQL1 1VQMZ 2PMZA 3HOUI 4NFRA 1M901 5A2Qf 3HOVI 3I4MI 4Y52I 1VQO1 4MD7A 1S72Z 4NBGA 4MH4A 1VQ6Z 3CPWZ 3S15I 3EEDA 3NH8A 3S1MI 1YJWZ 1KC82 5C3EI 2RIQA 1K83I 3IR7A 1FDIA 2NVTI 3CPWY 1YITZ 3CCE1 1YUKA 2B63I 2VPXA 2JNYA 4NBFA 2KPIA 3F3FC 4E33A 1TFIA 3JAMb 1VQ81 4NBAA 3ESWA 2PM9A 3GTOI 2OTJZ 2EGTA 1K731 2RT9A 2IZ3A 2GTIA 1Q821 3J81f 3HOXI 1JWHC 3CCRZ 1NP6A 2J6AA 4NB9A 4RVDA 3G4S1 1Q7Y1 3U50C 2ZAEB 5D1PA 1Q811 1N8R2 4X6AI 4BXXI 2R93I 1ZH1A 1VQLZ 5FLXf 2WAQA 2IV2X 1M1K2 1VQOZ 5IT9b 1LQLA 2QLVB 2K5RA 1K8A1 3CCS1 3GTLI 3CC41 2RBLA 2LEXA 4A3II 3M3YI 1QF8A 2JMOA 2QEX1 2HF1A 1M902 4NOZA 1WCMI 2QKDA 3I4NI 1QVGZ 3FKII 3CCEZ 3IF8A 2O4HA 3J80f 3IFUA 4NBHA 3I56Z 3H0GI 3MONA 4A3EI 3K7AI 5T6BA 4BBRI 3G711 4S1TA 1Y1VS 1KQSY 2AKLA 2V45A 3HOZI 3BG0B 2LFUA 1Z01A 3CCUZ 1PFTA 2M6NA 1YI21 1Q16A 3VB9A 1NJI1 2QR1B 3S17I 3G4SZ 3HOWI 3GTGI 2P3YA 3I07A 2JIOA 3TDHB 1RQFA 1VQN1 3PO2I 3KIHA 1TWFI 4MD8A 2R6MA 3F3PC 1K9M1 2OOXB 1RO2A 2DE7A 2V8JA 3NH4A 3CC2Z 1NUIA 4E2YA 1RO0A 2JUBA 1VQ9Z 1Y1WI 1K732 1VLAA 2GTHA 2JIMA 3CCSZ 2OTL1 1TWHI 1Q7Y2 3CC4Z 4TNUA 1Q812 4BBSI 1N2FA 3CD61 2NVYI 1RNIA 4RVGA 4A3BI 2QEXZ 4QTTA 1YIJZ 3I551 3RZOI 1X3WA 2R7ZI 4A3GI 5T64A 3CC7Z 3FQMA 2YU9I 1I50I 1K8A2 1Q861 1VQ51 2VPZA 4EWCA 2K3RA 1WIIA 3S2HI 5LL6f 3GKQA 1YI2Z 2E9HA 3CMA1 3CCL1 4E2WA 2W04A 3EERA 2NVQI 1DL6A 2VF1A 1YJ91 1L1OC 3QWUA 1VQ7Z 2GU2A 3NFZA 3CCM1
chains in the Genus database with same CATH topology
2AYDA 1WJ2A 2LEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYD A;  1WJ2 A;  2LEX A; 
#chains in the Genus database with same CATH topology
 1VQN Z;  4CL1 A;  2V8I A;  3FQQ A;  2VPY A;  4MD9 A;  4DQY B;  4A3K I;  3M4O I;  1VQ4 1;  2IZ4 A;  2YAD A;  1S7M A;  2QRC B;  5IT9 f;  4MXU A;  2OTL Z;  3KIF A;  5FLM I;  2W03 A;  5FLX b;  3GTQ I;  3CD6 Z;  2VPW A;  2R92 I;  3I55 Z;  2V3V A;  1WW9 A;  4A93 I;  1K9M 2;  1KD1 1;  1KQS Z;  5C4X I;  4NBC A;  1ZB8 A;  3GTP I;  3LUS A;  3VMH A;  1S72 1;  3S1Q I;  3CXC Z;  2JA6 I;  4NH1 C;  2RHB A;  4DK1 A;  2JS4 A;  1Y1V I;  2V8K A;  3CQZ I;  1W2B Z;  4QTU A;  2HU9 A;  3GTJ I;  3GTM S;  1USP B;  1VQ8 Z;  3J80 b;  5IP9 I;  1JJ2 Y;  1WZN A;  4NB8 A;  3OW2 Z;  2NAP A;  3D2L A;  3CCL Z;  3CXC Y;  2E2I I;  1YJ9 Z;  1QXF A;  1SFO I;  1Q86 2;  3CCM Z;  1W2B Y;  2P28 A;  2Q4Z A;  1VQP 1;  3CCJ 1;  1X3Z A;  1KRL A;  2VUG A;  2JA8 I;  1M1K 1;  3T4N B;  3OW2 Y;  2JA7 I;  5CM2 M;  1FDO A;  1VQ4 Z;  2JIP A;  3S1R I;  3S14 I;  1RLY A;  2F4M A;  1TWA I;  4BY7 I;  3CCQ 1;  1Q82 2;  3VMI A;  1YUA A;  4E32 A;  4E31 A;  4NBE A;  1YHQ 1;  1P9N A;  3VMG A;  1TWG I;  2WB1 A;  3NDI A;  1Z03 A;  5A2Q b;  4NBB A;  2QA4 1;  4DGL A;  4HH4 A;  4RV9 A;  4A3J I;  3G6E 1;  2O53 A;  1VQK 1;  5D1O B;  4Y7N I;  4BY1 I;  5C44 I;  2M48 A;  3CCV 1;  1TWC I;  2OZK A;  2PK7 A;  2JIQ A;  2QRE B;  3G71 Z;  4A3L I;  1R9T I;  4MON A;  2E2H I;  3CME 1;  3PO3 I;  4AYB A;  1KD1 2;  3GTK I;  3JAM f;  1AA6 A;  3PO3 S;  1I6H I;  4HGY A;  4A3M I;  3NH5 A;  3I56 1;  3HOY I;  1VQP Z;  3CCJ Z;  3Q87 A;  3IX0 A;  3HKZ A;  1ZB9 A;  2KI7 B;  2DE6 A;  3J7A 4;  3D9X A;  2I3C A;  3P5J B;  3J81 b;  3CCU 1;  5C4J I;  3CCQ Z;  1NJI 2;  4RVF A;  1USP A;  2JR6 A;  1YHQ Z;  1YJN 1;  2F4O A;  3RZD I;  1I3Q I;  3MZK B;  1ML8 A;  4E30 A;  2LIY A;  2QA4 Z;  1Y8C A;  2Q51 A;  4HGZ A;  2BJO A;  4RS4 A;  1KC8 1;  1VQM 1;  2E7Z A;  3S16 I;  3G6E Z;  3H3V J;  4RVH A;  1JJ2 Z;  3CC2 1;  1VQK Z;  1VQ9 1;  1VQ6 1;  2DE5 A;  2H85 A;  3CCV Z;  3MZL B;  1QVF Z;  1VQ5 Z;  1X0T A;  3GTM I;  5T67 A;  3D6W A;  4A3D I;  1Z02 A;  3CME Z;  1YIJ 1;  1YJW 1;  3GCF A;  4MRI A;  1RO4 A;  4XX2 A;  3CMA Z;  2OOY B;  3BG1 B;  4A3F I;  1WJ2 A;  1YIT 1;  2VUM I;  3CC7 1;  5AN9 F;  1QVF Y;  2AYD A;  4A3C I;  1QYP A;  2JA5 I;  2Y0S A;  1N8R 1;  2E2J I;  3S1N I;  4E2X A;  4E2Z A;  3NDJ A;  4NBD A;  3VTN A;  5D1O A;  5IP7 I;  1QVG Y;  1SIW A;  2G2K A;  2RPR A;  2OTJ 1;  1YJN Z;  3S2D I;  2NVX I;  3CCR 1;  2QRD B;  1VQ7 1;  3TE5 B;  2JIR A;  1VQL 1;  1VQM Z;  2PMZ A;  3HOU I;  4NFR A;  1M90 1;  5A2Q f;  3HOV I;  3I4M I;  4Y52 I;  1VQO 1;  4MD7 A;  1S72 Z;  4NBG A;  4MH4 A;  1VQ6 Z;  3CPW Z;  3S15 I;  3EED A;  3NH8 A;  3S1M I;  1YJW Z;  1KC8 2;  5C3E I;  2RIQ A;  1K83 I;  3IR7 A;  1FDI A;  2NVT I;  3CPW Y;  1YIT Z;  3CCE 1;  1YUK A;  2B63 I;  2VPX A;  2JNY A;  4NBF A;  2KPI A;  3F3F C;  4E33 A;  1TFI A;  3JAM b;  1VQ8 1;  4NBA A;  3ESW A;  2PM9 A;  3GTO I;  2OTJ Z;  2EGT A;  1K73 1;  2RT9 A;  2IZ3 A;  2GTI A;  1Q82 1;  3J81 f;  3HOX I;  1JWH C;  3CCR Z;  1NP6 A;  2J6A A;  4NB9 A;  4RVD A;  3G4S 1;  1Q7Y 1;  3U50 C;  2ZAE B;  5D1P A;  1Q81 1;  1N8R 2;  4X6A I;  4BXX I;  2R93 I;  1ZH1 A;  1VQL Z;  5FLX f;  2WAQ A;  2IV2 X;  1M1K 2;  1VQO Z;  5IT9 b;  1LQL A;  2QLV B;  2K5R A;  1K8A 1;  3CCS 1;  3GTL I;  3CC4 1;  2RBL A;  2LEX A;  4A3I I;  3M3Y I;  1QF8 A;  2JMO A;  2QEX 1;  2HF1 A;  1M90 2;  4NOZ A;  1WCM I;  2QKD A;  3I4N I;  1QVG Z;  3FKI I;  3CCE Z;  3IF8 A;  2O4H A;  3J80 f;  3IFU A;  4NBH A;  3I56 Z;  3H0G I;  3MON A;  4A3E I;  3K7A I;  5T6B A;  4BBR I;  3G71 1;  4S1T A;  1Y1V S;  1KQS Y;  2AKL A;  2V45 A;  3HOZ I;  3BG0 B;  2LFU A;  1Z01 A;  3CCU Z;  1PFT A;  2M6N A;  1YI2 1;  1Q16 A;  3VB9 A;  1NJI 1;  2QR1 B;  3S17 I;  3G4S Z;  3HOW I;  3GTG I;  2P3Y A;  3I07 A;  2JIO A;  3TDH B;  1RQF A;  1VQN 1;  3PO2 I;  3KIH A;  1TWF I;  4MD8 A;  2R6M A;  3F3P C;  1K9M 1;  2OOX B;  1RO2 A;  2DE7 A;  2V8J A;  3NH4 A;  3CC2 Z;  1NUI A;  4E2Y A;  1RO0 A;  2JUB A;  1VQ9 Z;  1Y1W I;  1K73 2;  1VLA A;  2GTH A;  2JIM A;  3CCS Z;  2OTL 1;  1TWH I;  1Q7Y 2;  3CC4 Z;  4TNU A;  1Q81 2;  4BBS I;  1N2F A;  3CD6 1;  2NVY I;  1RNI A;  4RVG A;  4A3B I;  2QEX Z;  4QTT A;  1YIJ Z;  3I55 1;  3RZO I;  1X3W A;  2R7Z I;  4A3G I;  5T64 A;  3CC7 Z;  3FQM A;  2YU9 I;  1I50 I;  1K8A 2;  1Q86 1;  1VQ5 1;  2VPZ A;  4EWC A;  2K3R A;  1WII A;  3S2H I;  5LL6 f;  3GKQ A;  1YI2 Z;  2E9H A;  3CMA 1;  3CCL 1;  4E2W A;  2W04 A;  3EER A;  2NVQ I;  1DL6 A;  2VF1 A;  1YJ9 1;  1L1O C;  3QWU A;  1VQ7 Z;  2GU2 A;  3NFZ A;  3CCM 1; 
#chains in the Genus database with same CATH homology
 2AYD A;  1WJ2 A;  2LEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...