1WJ2A

Solution structure of the c-terminal wrky domain of atwrky4
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
b'VQTTSEVDLLDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable WRKY transcription factor 4
publication title Solution structure of an Arabidopsis WRKY DNA binding domain.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Dna binding protein
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03106 WRKY WRKY DNA -binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.80 Mainly Beta Single Sheet N-terminal domain of TfIIb WRKY domain 1wj2A00
2AYDA 2LEXA 1WJ2A
chains in the Genus database with same CATH superfamily
4E31A 1R9TI 2E7ZA 1PFTA 3CCVZ 1USPB 1QF8A 1VQ4Z 2JUBA 2JA6I 3K7AI 1VQ91 2W04A 2V8KA 2LEXA 3VB9A 3CC2Z 1RNIA 2PM9A 4NBEA 1P9NA 4E30A 2VPZA 2O53A 1NJI1 3I07A 1QYPA 3JAMb 2V45A 1TWFI 2NVYI 3GTMI 3HOUI 1RLYA 2OOXB 3S2HI 3G6E1 3G711 4NB9A 5CM2M 1Q16A 1Q7Y1 4A3MI 3M3YI 3NH8A 3FQMA 1YHQZ 1VQM1 2QEXZ 3S15I 1YJN1 2JA7I 3GCFA 5C3EI 3CCRZ 3T4NB 2QR1B 4Y52I 3S1MI 2P3YA 3OW2Z 2VF1A 4X6AI 5C4XI 2NVTI 4QTTA 1I3QI 2P28A 3GTPI 3I561 1NP6A 1M1K1 3GTJI 2VUGA 2OTJZ 3IFUA 2WB1A 3CCM1 2K3RA 2B63I 3I4MI 2M6NA 1AA6A 3MZKB 3S14I 1VQ9Z 4BXXI 3D9XA 3CCV1 4NBBA 3MONA 1VQ41 1VQK1 4NFRA 3G4S1 1I50I 3QWUA 2V8IA 1M902 1QVGZ 3FKII 1L1OC 3CD61 2DE5A 3G6EZ 1Q861 2IV2X 2R93I 1FDOA 3IR7A 1VQMZ 1DL6A 1YJNZ 1K8A2 2PMZA 4A3CI 1N8R2 1YJW1 1K9M2 1S7MA 4E2WA 1JWHC 2YADA 3HKZA 3J81f 2RPRA 1W2BY 2OTL1 5IT9f 1KQSZ 3I56Z 4MD7A 3TE5B 2DE7A 2RT9A 2JIOA 1KD12 3J7A4 1RQFA 4A3GI 3CCMZ 3GTQI 1VQLZ 3GTGI 3I4NI 1ZB8A 4NBAA 3ESWA 2OOYB 1SIWA 2E2JI 1KQSY 1X0TA 2OTJ1 2AKLA 4A3LI 1Q811 1VQKZ 3J80f 2AYDA 3G4SZ 1Y1VS 4E32A 2VPWA 4MD8A 2NVQI 3J81b 3CCU1 4XX2A 3CD6Z 3CCQZ 4NH1C 3CCJ1 3CCS1 5IT9b 2QREB 1LQLA 4MONA 1K732 4CL1A 3HOYI 3I551 2DE6A 4HGYA 1YJWZ 3CQZI 1WJ2A 2YU9I 2LFUA 1FDIA 3TDHB 5AN9F 2VPXA 4DQYB 5FLXf 2OTLZ 2VUMI 1ZH1A 2NAPA 1Q7Y2 3IX0A 2VPYA 3BG1B 2Q4ZA 3J80b 2QRDB 2M48A 5C4JI 4BBSI 5T6BA 5IP9I 4NBCA 2F4OA 1QXFA 2QA41 3BG0B 5C44I 3VTNA 1QVFZ 3GTOI 5D1PA 3CXCY 3PO3S 3H0GI 5IP7I 1VQL1 1WCMI 3D2LA 1M1K2 1KRLA 1WW9A 3VMHA 4MH4A 3CCUZ 1RO4A 4RS4A 5FLXb 3CCSZ 1VQ51 3CCJZ 1Q822 2GTIA 4Y7NI 1QVFY 4MXUA 4A3II 3VMGA 3VMIA 2ZAEB 4RVFA 4A3BI 4MD9A 2V3VA 3I55Z 2HF1A 3CCQ1 1RO2A 3PO3I 4A3DI 1W2BZ 3CCL1 1M901 1N2FA 3FQQA 2R6MA 1VQOZ 3GKQA 4E2ZA 1VQ71 1YUKA 1VLAA 4DGLA 2E2II 3IF8A 1ZB9A 2QKDA 5D1OA 1Q862 1VQ81 1TFIA 2H85A 3EERA 1VQP1 5T64A 4NBHA 1N8R1 1K9M1 1KC81 4NBFA 1YIT1 4A3KI 2JIRA 4A93I 3GTLI 2IZ3A 3HOXI 2QA4Z 5FLMI 5D1OB 2RBLA 3CCE1 2RIQA 2QLVB 2JIQA 3S17I 2Q51A 1KD11 3KIHA 1ML8A 2JR6A 3NDJA 1TWGI 1VQ5Z 1Z01A 1USPA 3NFZA 1Y1WI 4RV9A 1X3ZA 3MZLB 2F4MA 2LIYA 4TNUA 1S721 3D6WA 3CCLZ 3EEDA 2IZ4A 2JA5I 1YI21 1VQ7Z 1JJ2Y 4RVHA 5A2Qf 1VQ8Z 1K731 3CMAZ 4MRIA 3HOZI 1NJI2 1VQO1 4BY1I 1VQPZ 4NB8A 4S1TA 2JNYA 4E2YA 3CC7Z 4A3FI 1Y1VI 1YITZ 1YJ91 3CXCZ 3NDIA 3Q87A 3M4OI 3PO2I 3NH4A 4DK1A 2QRCB 3CCEZ 4NBGA 3P5JB 5LL6f 2J6AA 4EWCA 1VQN1 1YIJ1 3NH5A 3RZDI 2JS4A 2JA8I 3S16I 3LUSA 3CMEZ 1TWAI 3S2DI 2O4HA 3H3VJ 5A2Qb 2E2HI 2GU2A 3CPWZ 2JMOA 2V8JA 3RZOI 2KPIA 4BY7I 1S72Z 2R92I 3CC41 2WAQA 1RO0A 3GTKI 1Q821 5T67A 1YUAA 1YI2Z 3OW2Y 3S1NI 1VQ61 4HH4A 4QTUA 3CPWY 4E2XA 1WZNA 2NVXI 2W03A 4HGZA 4A3JI 4E33A 3CMA1 1YJ9Z 1I6HI 1WIIA 3CC21 4NOZA 1Z03A 3CC71 2HU9A 1K8A1 2E9HA 2G2KA 1Z02A 4AYBA 3G71Z 4RVDA 1VQNZ 2K5RA 2KI7B 1YIJZ 3F3PC 3F3FC 2R7ZI 1TWCI 1KC82 1QVGY 2JIMA 4NBDA 2I3CA 3S1RI 1YHQ1 1SFOI 2QEX1 3HOWI 3KIFA 3HOVI 2GTHA 2EGTA 3JAMf 2PK7A 3CME1 3CCR1 2BJOA 1K83I 2JIPA 4BBRI 2RHBA 3U50C 1TWHI 1JJ2Z 3CC4Z 1NUIA 1X3WA 1VQ6Z 2OZKA 2Y0SA 1Q812 3GTMS 1Y8CA 3S1QI 4A3EI 4RVGA
chains in the Genus database with same CATH topology
2AYDA 2LEXA 1WJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AYD A;  2LEX A;  1WJ2 A; 
#chains in the Genus database with same CATH topology
 4E31 A;  1R9T I;  2E7Z A;  1PFT A;  3CCV Z;  1USP B;  1QF8 A;  1VQ4 Z;  2JUB A;  2JA6 I;  3K7A I;  1VQ9 1;  2W04 A;  2V8K A;  2LEX A;  3VB9 A;  3CC2 Z;  1RNI A;  2PM9 A;  4NBE A;  1P9N A;  4E30 A;  2VPZ A;  2O53 A;  1NJI 1;  3I07 A;  1QYP A;  3JAM b;  2V45 A;  1TWF I;  2NVY I;  3GTM I;  3HOU I;  1RLY A;  2OOX B;  3S2H I;  3G6E 1;  3G71 1;  4NB9 A;  5CM2 M;  1Q16 A;  1Q7Y 1;  4A3M I;  3M3Y I;  3NH8 A;  3FQM A;  1YHQ Z;  1VQM 1;  2QEX Z;  3S15 I;  1YJN 1;  2JA7 I;  3GCF A;  5C3E I;  3CCR Z;  3T4N B;  2QR1 B;  4Y52 I;  3S1M I;  2P3Y A;  3OW2 Z;  2VF1 A;  4X6A I;  5C4X I;  2NVT I;  4QTT A;  1I3Q I;  2P28 A;  3GTP I;  3I56 1;  1NP6 A;  1M1K 1;  3GTJ I;  2VUG A;  2OTJ Z;  3IFU A;  2WB1 A;  3CCM 1;  2K3R A;  2B63 I;  3I4M I;  2M6N A;  1AA6 A;  3MZK B;  3S14 I;  1VQ9 Z;  4BXX I;  3D9X A;  3CCV 1;  4NBB A;  3MON A;  1VQ4 1;  1VQK 1;  4NFR A;  3G4S 1;  1I50 I;  3QWU A;  2V8I A;  1M90 2;  1QVG Z;  3FKI I;  1L1O C;  3CD6 1;  2DE5 A;  3G6E Z;  1Q86 1;  2IV2 X;  2R93 I;  1FDO A;  3IR7 A;  1VQM Z;  1DL6 A;  1YJN Z;  1K8A 2;  2PMZ A;  4A3C I;  1N8R 2;  1YJW 1;  1K9M 2;  1S7M A;  4E2W A;  1JWH C;  2YAD A;  3HKZ A;  3J81 f;  2RPR A;  1W2B Y;  2OTL 1;  5IT9 f;  1KQS Z;  3I56 Z;  4MD7 A;  3TE5 B;  2DE7 A;  2RT9 A;  2JIO A;  1KD1 2;  3J7A 4;  1RQF A;  4A3G I;  3CCM Z;  3GTQ I;  1VQL Z;  3GTG I;  3I4N I;  1ZB8 A;  4NBA A;  3ESW A;  2OOY B;  1SIW A;  2E2J I;  1KQS Y;  1X0T A;  2OTJ 1;  2AKL A;  4A3L I;  1Q81 1;  1VQK Z;  3J80 f;  2AYD A;  3G4S Z;  1Y1V S;  4E32 A;  2VPW A;  4MD8 A;  2NVQ I;  3J81 b;  3CCU 1;  4XX2 A;  3CD6 Z;  3CCQ Z;  4NH1 C;  3CCJ 1;  3CCS 1;  5IT9 b;  2QRE B;  1LQL A;  4MON A;  1K73 2;  4CL1 A;  3HOY I;  3I55 1;  2DE6 A;  4HGY A;  1YJW Z;  3CQZ I;  1WJ2 A;  2YU9 I;  2LFU A;  1FDI A;  3TDH B;  5AN9 F;  2VPX A;  4DQY B;  5FLX f;  2OTL Z;  2VUM I;  1ZH1 A;  2NAP A;  1Q7Y 2;  3IX0 A;  2VPY A;  3BG1 B;  2Q4Z A;  3J80 b;  2QRD B;  2M48 A;  5C4J I;  4BBS I;  5T6B A;  5IP9 I;  4NBC A;  2F4O A;  1QXF A;  2QA4 1;  3BG0 B;  5C44 I;  3VTN A;  1QVF Z;  3GTO I;  5D1P A;  3CXC Y;  3PO3 S;  3H0G I;  5IP7 I;  1VQL 1;  1WCM I;  3D2L A;  1M1K 2;  1KRL A;  1WW9 A;  3VMH A;  4MH4 A;  3CCU Z;  1RO4 A;  4RS4 A;  5FLX b;  3CCS Z;  1VQ5 1;  3CCJ Z;  1Q82 2;  2GTI A;  4Y7N I;  1QVF Y;  4MXU A;  4A3I I;  3VMG A;  3VMI A;  2ZAE B;  4RVF A;  4A3B I;  4MD9 A;  2V3V A;  3I55 Z;  2HF1 A;  3CCQ 1;  1RO2 A;  3PO3 I;  4A3D I;  1W2B Z;  3CCL 1;  1M90 1;  1N2F A;  3FQQ A;  2R6M A;  1VQO Z;  3GKQ A;  4E2Z A;  1VQ7 1;  1YUK A;  1VLA A;  4DGL A;  2E2I I;  3IF8 A;  1ZB9 A;  2QKD A;  5D1O A;  1Q86 2;  1VQ8 1;  1TFI A;  2H85 A;  3EER A;  1VQP 1;  5T64 A;  4NBH A;  1N8R 1;  1K9M 1;  1KC8 1;  4NBF A;  1YIT 1;  4A3K I;  2JIR A;  4A93 I;  3GTL I;  2IZ3 A;  3HOX I;  2QA4 Z;  5FLM I;  5D1O B;  2RBL A;  3CCE 1;  2RIQ A;  2QLV B;  2JIQ A;  3S17 I;  2Q51 A;  1KD1 1;  3KIH A;  1ML8 A;  2JR6 A;  3NDJ A;  1TWG I;  1VQ5 Z;  1Z01 A;  1USP A;  3NFZ A;  1Y1W I;  4RV9 A;  1X3Z A;  3MZL B;  2F4M A;  2LIY A;  4TNU A;  1S72 1;  3D6W A;  3CCL Z;  3EED A;  2IZ4 A;  2JA5 I;  1YI2 1;  1VQ7 Z;  1JJ2 Y;  4RVH A;  5A2Q f;  1VQ8 Z;  1K73 1;  3CMA Z;  4MRI A;  3HOZ I;  1NJI 2;  1VQO 1;  4BY1 I;  1VQP Z;  4NB8 A;  4S1T A;  2JNY A;  4E2Y A;  3CC7 Z;  4A3F I;  1Y1V I;  1YIT Z;  1YJ9 1;  3CXC Z;  3NDI A;  3Q87 A;  3M4O I;  3PO2 I;  3NH4 A;  4DK1 A;  2QRC B;  3CCE Z;  4NBG A;  3P5J B;  5LL6 f;  2J6A A;  4EWC A;  1VQN 1;  1YIJ 1;  3NH5 A;  3RZD I;  2JS4 A;  2JA8 I;  3S16 I;  3LUS A;  3CME Z;  1TWA I;  3S2D I;  2O4H A;  3H3V J;  5A2Q b;  2E2H I;  2GU2 A;  3CPW Z;  2JMO A;  2V8J A;  3RZO I;  2KPI A;  4BY7 I;  1S72 Z;  2R92 I;  3CC4 1;  2WAQ A;  1RO0 A;  3GTK I;  1Q82 1;  5T67 A;  1YUA A;  1YI2 Z;  3OW2 Y;  3S1N I;  1VQ6 1;  4HH4 A;  4QTU A;  3CPW Y;  4E2X A;  1WZN A;  2NVX I;  2W03 A;  4HGZ A;  4A3J I;  4E33 A;  3CMA 1;  1YJ9 Z;  1I6H I;  1WII A;  3CC2 1;  4NOZ A;  1Z03 A;  3CC7 1;  2HU9 A;  1K8A 1;  2E9H A;  2G2K A;  1Z02 A;  4AYB A;  3G71 Z;  4RVD A;  1VQN Z;  2K5R A;  2KI7 B;  1YIJ Z;  3F3P C;  3F3F C;  2R7Z I;  1TWC I;  1KC8 2;  1QVG Y;  2JIM A;  4NBD A;  2I3C A;  3S1R I;  1YHQ 1;  1SFO I;  2QEX 1;  3HOW I;  3KIF A;  3HOV I;  2GTH A;  2EGT A;  3JAM f;  2PK7 A;  3CME 1;  3CCR 1;  2BJO A;  1K83 I;  2JIP A;  4BBR I;  2RHB A;  3U50 C;  1TWH I;  1JJ2 Z;  3CC4 Z;  1NUI A;  1X3W A;  1VQ6 Z;  2OZK A;  2Y0S A;  1Q81 2;  3GTM S;  1Y8C A;  3S1Q I;  4A3E I;  4RVG A; 
#chains in the Genus database with same CATH homology
 2AYD A;  2LEX A;  1WJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...