3EEDA

Crystal structure of human protein kinase ck2 regulatory subunit (ck2beta; mutant 1-193)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
183
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
publication title The interaction of CK2{alpha} and CK2{beta}, the subunits of protein kinase CK2, requires CK2{beta} in a preformed conformation and is enthalpically driven
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 183
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 3eedA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3eedA02
1RQFA 4DGLA 4NH1C 2M6NA 2RT9A 1JWHC 4MD8A 2JMOA 2M48A 4MD7A 1QF8A 2R6MA 4MD9A 3EEDA
chains in the Genus database with same CATH superfamily
2VUMI 2G2KA 3CC21 3BG0B 1WJ2A 1Y1VI 2JUBA 1LQLA 3RZOI 2PMZA 1M901 1L1OC 1TWAI 1Q7Y1 3GTLI 3GTQI 2F4MA 3FQQA 4NBBA 2RHBA 1RO4A 3FKII 2RPRA 2VF1A 3CC41 3HKZA 2B63I 1K731 4MRIA 1YIJ1 4NBEA 3CXCZ 3VMHA 3CCUZ 1VQ8Z 2J6AA 1W2BY 2IV2X 4NBHA 4BXXI 4S1TA 3FQMA 2OZKA 1JJ2Z 1VQ51 2JA5I 4DK1A 2HU9A 3S1RI 4E2ZA 4RVDA 1Q811 4A3EI 3NH4A 4NBFA 4TNUA 3GTGI 3RZDI 2IZ4A 4MONA 3J81f 2RT9A 2E2II 2OTLZ 3VTNA 1K9M1 3G711 3KIFA 5FLXb 4RVHA 3HOYI 3HOVI 3IX0A 3VMGA 3CPWY 3VMIA 5CM2M 4CL1A 4NBGA 1VQ9Z 3CCQZ 2AYDA 3CC71 2E7ZA 2JMOA 1RLYA 3CCMZ 2Q51A 3F3PC 2E2JI 3Q87A 3S1MI 1JWHC 3TDHB 3CCV1 3CD61 3K7AI 1QVGY 3CCJ1 3CCLZ 1R9TI 5IP9I 3S15I 4E2WA 2V8IA 3GTMS 5T67A 2W03A 3S16I 2JIQA 1X0TA 3NFZA 1FDIA 2LFUA 3J80f 2JIPA 3J81b 3VB9A 2R93I 1VQL1 2WB1A 2QR1B 1K83I 1KD12 5A2Qb 1P9NA 2OTJZ 1YJN1 2NVQI 3G6EZ 2JA6I 1S721 2YADA 1VQK1 4A93I 1Q821 3GTPI 1YITZ 2P28A 4AYBA 1Q861 5FLXf 1KQSY 4EWCA 3CMEZ 1VQN1 1VQ71 2QEX1 2ZAEB 3CCSZ 3MONA 3HOXI 1TWCI 1Y8CA 2F4OA 1VQMZ 1DL6A 2I3CA 4E2YA 1Z03A 2YU9I 3IFUA 1ML8A 3OW2Y 2QRDB 3NH8A 4HGYA 1I50I 1USPA 3LUSA 3TE5B 1YJWZ 3I56Z 2OOYB 1M1K2 2QA41 1QF8A 3QWUA 4QTUA 1VQ6Z 1VLAA 4NBCA 1YI2Z 1ZB9A 4E30A 1K8A2 1Z02A 1YJ91 1YHQZ 3HOZI 3J80b 1VQO1 3EEDA 2VPWA 2QKDA 1RO2A 2M6NA 1QVFZ 3S1QI 1WW9A 3H3VJ 2VUGA 5A2Qf 1VQP1 4RS4A 3T4NB 3CC2Z 2H85A 2NVTI 2R6MA 4A3KI 4BBSI 3I55Z 3CCR1 2K5RA 5LL6f 1NUIA 4BY7I 1WIIA 3M3YI 3I4MI 5C44I 2JA7I 3CMAZ 2HF1A 1KC82 2GTIA 1YIJZ 5D1OB 1RQFA 2V3VA 4A3II 4E32A 3NDIA 4NH1C 1KRLA 2VPXA 4DGLA 5C4JI 3I4NI 3PO3S 3CXCY 4A3CI 2V45A 1RNIA 4X6AI 1VQ5Z 2GU2A 2OTJ1 1QYPA 2NVYI 1NJI2 4A3GI 3G4S1 1JJ2Y 1X3WA 4A3FI 3PO3I 2RIQA 4NB8A 4BBRI 5FLMI 2NVXI 4Y7NI 2NAPA 3IF8A 3D9XA 1WCMI 3CCE1 2O53A 3G71Z 1VQM1 4RVFA 5IT9f 1N8R2 3S2HI 3GCFA 1VQ4Z 3D2LA 2DE5A 5C3EI 3S1NI 1S7MA 4NFRA 4MH4A 2RBLA 4A3LI 1ZB8A 1NP6A 1I6HI 1W2BZ 3PO2I 4A3JI 3CCU1 2JA8I 1VQ81 3CC7Z 2W04A 1YUKA 1Z01A 2KPIA 3S2DI 2VPZA 5IP7I 2PM9A 1N2FA 1KD11 5D1OA 1TWGI 2DE7A 1I3QI 5D1PA 4RV9A 2Q4ZA 3U50C 3HOUI 1M902 2JIRA 1Q7Y2 3CCVZ 3I07A 3HOWI 1TWHI 3CCJZ 1TWFI 2OTL1 1X3ZA 2R92I 1K732 3H0GI 4XX2A 4HH4A 5AN9F 5C4XI 3S14I 1ZH1A 1RO0A 1TFIA 3I551 3CPWZ 4NBDA 2M48A 2O4HA 1VQLZ 2R7ZI 3CMA1 1YJNZ 2LIYA 3IR7A 1VQ91 5IT9b 1S72Z 1M1K1 1Y1WI 3CCQ1 3JAMf 1VQKZ 1Q812 4E33A 1PFTA 3GTKI 1Q16A 4NOZA 1VQNZ 1QXFA 3CCM1 1VQ7Z 2QEXZ 2KI7B 1K8A1 4MXUA 2GTHA 3NDJA 1QVGZ 1K9M2 2DE6A 1SIWA 3CQZI 4QTTA 2OOXB 3CCL1 3CC4Z 3D6WA 4MD7A 3ESWA 2EGTA 3M4OI 4A3DI 1YUAA 3MZKB 2QA4Z 3GKQA 3GTOI 4A3BI 2WAQA 2QRCB 1VQ41 4RVGA 3F3FC 1KC81 2JS4A 3G6E1 5T6BA 1KQSZ 1YJ9Z 2E2HI 2QLVB 1YIT1 1VQOZ 4DQYB 1FDOA 3P5JB 3CME1 3MZLB 3GTJI 4Y52I 4MD9A 3S17I 3JAMb 3CCS1 4MD8A 1NJI1 2IZ3A 1VQPZ 2V8KA 1QVFY 3EERA 3J7A4 1USPB 3OW2Z 1SFOI 2P3YA 2VPYA 2AKLA 3CCRZ 2BJOA 2QREB 3NH5A 2K3RA 4E31A 4HGZA 1YJW1 4E2XA 3I561 1AA6A 2E9HA 5T64A 1Q822 1VQ61 4BY1I 2PK7A 3KIHA 1N8R1 1Q862 3BG1B 1YI21 4NBAA 2V8JA 2Y0SA 2JIMA 1YHQ1 3GTMI 1Y1VS 3G4SZ 2LEXA 3CD6Z 4NB9A 4A3MI 2JR6A 1WZNA 2JNYA 2JIOA 3CCEZ
chains in the Genus database with same CATH topology
2VUMI 2G2KA 3CC21 3BG0B 1Y1VI 2JUBA 1LQLA 3RZOI 2PMZA 1M901 1L1OC 1TWAI 1Q7Y1 3GTLI 3GTQI 2F4MA 3FQQA 4NBBA 2RHBA 1RO4A 3FKII 2RPRA 2VF1A 3CC41 3HKZA 2B63I 1K731 4MRIA 1YIJ1 4NBEA 3CXCZ 3VMHA 3CCUZ 1VQ8Z 2J6AA 1W2BY 4NBHA 4BXXI 4S1TA 3FQMA 2OZKA 1JJ2Z 1VQ51 2JA5I 4DK1A 2HU9A 3S1RI 4E2ZA 4RVDA 1Q811 4A3EI 3NH4A 4NBFA 4TNUA 3GTGI 3RZDI 2IZ4A 4MONA 3J81f 2RT9A 2E2II 2OTLZ 3VTNA 1K9M1 3G711 3KIFA 5FLXb 4RVHA 3HOYI 3HOVI 3IX0A 3VMGA 3CPWY 3VMIA 5CM2M 4CL1A 4NBGA 1VQ9Z 3CCQZ 3CC71 2JMOA 1RLYA 3CCMZ 2Q51A 3F3PC 2E2JI 3Q87A 3S1MI 1JWHC 3TDHB 3CCV1 3CD61 3K7AI 1QVGY 3CCJ1 3CCLZ 1R9TI 5IP9I 3S15I 4E2WA 2V8IA 3GTMS 5T67A 2W03A 3S16I 1X0TA 3NFZA 2LFUA 3J80f 3J81b 3VB9A 2R93I 1VQL1 2WB1A 2QR1B 1K83I 1KD12 5A2Qb 1P9NA 2OTJZ 1YJN1 2NVQI 3G6EZ 2JA6I 1S721 2YADA 1VQK1 4A93I 1Q821 3GTPI 1YITZ 2P28A 4AYBA 1Q861 5FLXf 1KQSY 4EWCA 3CMEZ 1VQN1 1VQ71 2QEX1 2ZAEB 3CCSZ 3MONA 3HOXI 1TWCI 2F4OA 1VQMZ 1DL6A 2I3CA 4E2YA 1Z03A 2YU9I 3IFUA 1ML8A 3OW2Y 2QRDB 3NH8A 4HGYA 1I50I 1USPA 3LUSA 3TE5B 1YJWZ 3I56Z 2OOYB 1M1K2 2QA41 1QF8A 3QWUA 4QTUA 1VQ6Z 1VLAA 4NBCA 1YI2Z 1ZB9A 4E30A 1K8A2 1Z02A 1YJ91 1YHQZ 3HOZI 3J80b 1VQO1 3EEDA 2QKDA 1RO2A 2M6NA 1QVFZ 3S1QI 1WW9A 3H3VJ 2VUGA 5A2Qf 1VQP1 4RS4A 3T4NB 3CC2Z 2H85A 2NVTI 2R6MA 4A3KI 4BBSI 3I55Z 3CCR1 2K5RA 5LL6f 1NUIA 4BY7I 1WIIA 3M3YI 3I4MI 5C44I 2JA7I 3CMAZ 2HF1A 1KC82 2GTIA 1YIJZ 5D1OB 1RQFA 4A3II 4E32A 3NDIA 4NH1C 1KRLA 4DGLA 5C4JI 3I4NI 3PO3S 3CXCY 4A3CI 1RNIA 4X6AI 1VQ5Z 2GU2A 2OTJ1 1QYPA 2NVYI 1NJI2 4A3GI 3G4S1 1JJ2Y 1X3WA 4A3FI 3PO3I 2RIQA 4NB8A 4BBRI 5FLMI 2NVXI 4Y7NI 3IF8A 3D9XA 1WCMI 3CCE1 2O53A 3G71Z 1VQM1 4RVFA 5IT9f 1N8R2 3S2HI 3GCFA 1VQ4Z 2DE5A 5C3EI 3S1NI 1S7MA 4NFRA 4MH4A 2RBLA 4A3LI 1ZB8A 1NP6A 1I6HI 1W2BZ 3PO2I 4A3JI 3CCU1 2JA8I 1VQ81 3CC7Z 2W04A 1YUKA 1Z01A 2KPIA 3S2DI 5IP7I 2PM9A 1N2FA 1KD11 5D1OA 1TWGI 2DE7A 1I3QI 5D1PA 4RV9A 2Q4ZA 3U50C 3HOUI 1M902 1Q7Y2 3CCVZ 3I07A 3HOWI 1TWHI 3CCJZ 1TWFI 2OTL1 1X3ZA 2R92I 1K732 3H0GI 4XX2A 4HH4A 5AN9F 5C4XI 3S14I 1ZH1A 1RO0A 1TFIA 3I551 3CPWZ 4NBDA 2M48A 2O4HA 1VQLZ 2R7ZI 3CMA1 1YJNZ 2LIYA 1VQ91 5IT9b 1S72Z 1M1K1 1Y1WI 3CCQ1 3JAMf 1VQKZ 1Q812 4E33A 1PFTA 3GTKI 4NOZA 1VQNZ 3CCM1 1VQ7Z 2QEXZ 2KI7B 1K8A1 4MXUA 2GTHA 3NDJA 1QVGZ 1K9M2 2DE6A 3CQZI 4QTTA 2OOXB 3CCL1 3CC4Z 3D6WA 4MD7A 3ESWA 2EGTA 3M4OI 4A3DI 1YUAA 3MZKB 2QA4Z 3GKQA 3GTOI 4A3BI 2WAQA 2QRCB 1VQ41 4RVGA 3F3FC 1KC81 2JS4A 3G6E1 5T6BA 1KQSZ 1YJ9Z 2E2HI 2QLVB 1YIT1 1VQOZ 4DQYB 3P5JB 3CME1 3MZLB 3GTJI 4Y52I 4MD9A 3S17I 3JAMb 3CCS1 4MD8A 1NJI1 2IZ3A 1VQPZ 2V8KA 1QVFY 3EERA 3J7A4 1USPB 3OW2Z 1SFOI 2P3YA 2AKLA 3CCRZ 2BJOA 2QREB 3NH5A 2K3RA 4E31A 4HGZA 1YJW1 4E2XA 3I561 2E9HA 5T64A 1Q822 1VQ61 4BY1I 2PK7A 3KIHA 1N8R1 1Q862 3BG1B 1YI21 4NBAA 2V8JA 2Y0SA 1YHQ1 3GTMI 1Y1VS 3G4SZ 3CD6Z 4NB9A 4A3MI 2JR6A 2JNYA 3CCEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQF A;  4DGL A;  4NH1 C;  2M6N A;  2RT9 A;  1JWH C;  4MD8 A;  2JMO A;  2M48 A;  4MD7 A;  1QF8 A;  2R6M A;  4MD9 A;  3EED A; 
#chains in the Genus database with same CATH topology
 2VUM I;  2G2K A;  3CC2 1;  3BG0 B;  1WJ2 A;  1Y1V I;  2JUB A;  1LQL A;  3RZO I;  2PMZ A;  1M90 1;  1L1O C;  1TWA I;  1Q7Y 1;  3GTL I;  3GTQ I;  2F4M A;  3FQQ A;  4NBB A;  2RHB A;  1RO4 A;  3FKI I;  2RPR A;  2VF1 A;  3CC4 1;  3HKZ A;  2B63 I;  1K73 1;  4MRI A;  1YIJ 1;  4NBE A;  3CXC Z;  3VMH A;  3CCU Z;  1VQ8 Z;  2J6A A;  1W2B Y;  2IV2 X;  4NBH A;  4BXX I;  4S1T A;  3FQM A;  2OZK A;  1JJ2 Z;  1VQ5 1;  2JA5 I;  4DK1 A;  2HU9 A;  3S1R I;  4E2Z A;  4RVD A;  1Q81 1;  4A3E I;  3NH4 A;  4NBF A;  4TNU A;  3GTG I;  3RZD I;  2IZ4 A;  4MON A;  3J81 f;  2RT9 A;  2E2I I;  2OTL Z;  3VTN A;  1K9M 1;  3G71 1;  3KIF A;  5FLX b;  4RVH A;  3HOY I;  3HOV I;  3IX0 A;  3VMG A;  3CPW Y;  3VMI A;  5CM2 M;  4CL1 A;  4NBG A;  1VQ9 Z;  3CCQ Z;  2AYD A;  3CC7 1;  2E7Z A;  2JMO A;  1RLY A;  3CCM Z;  2Q51 A;  3F3P C;  2E2J I;  3Q87 A;  3S1M I;  1JWH C;  3TDH B;  3CCV 1;  3CD6 1;  3K7A I;  1QVG Y;  3CCJ 1;  3CCL Z;  1R9T I;  5IP9 I;  3S15 I;  4E2W A;  2V8I A;  3GTM S;  5T67 A;  2W03 A;  3S16 I;  2JIQ A;  1X0T A;  3NFZ A;  1FDI A;  2LFU A;  3J80 f;  2JIP A;  3J81 b;  3VB9 A;  2R93 I;  1VQL 1;  2WB1 A;  2QR1 B;  1K83 I;  1KD1 2;  5A2Q b;  1P9N A;  2OTJ Z;  1YJN 1;  2NVQ I;  3G6E Z;  2JA6 I;  1S72 1;  2YAD A;  1VQK 1;  4A93 I;  1Q82 1;  3GTP I;  1YIT Z;  2P28 A;  4AYB A;  1Q86 1;  5FLX f;  1KQS Y;  4EWC A;  3CME Z;  1VQN 1;  1VQ7 1;  2QEX 1;  2ZAE B;  3CCS Z;  3MON A;  3HOX I;  1TWC I;  1Y8C A;  2F4O A;  1VQM Z;  1DL6 A;  2I3C A;  4E2Y A;  1Z03 A;  2YU9 I;  3IFU A;  1ML8 A;  3OW2 Y;  2QRD B;  3NH8 A;  4HGY A;  1I50 I;  1USP A;  3LUS A;  3TE5 B;  1YJW Z;  3I56 Z;  2OOY B;  1M1K 2;  2QA4 1;  1QF8 A;  3QWU A;  4QTU A;  1VQ6 Z;  1VLA A;  4NBC A;  1YI2 Z;  1ZB9 A;  4E30 A;  1K8A 2;  1Z02 A;  1YJ9 1;  1YHQ Z;  3HOZ I;  3J80 b;  1VQO 1;  3EED A;  2VPW A;  2QKD A;  1RO2 A;  2M6N A;  1QVF Z;  3S1Q I;  1WW9 A;  3H3V J;  2VUG A;  5A2Q f;  1VQP 1;  4RS4 A;  3T4N B;  3CC2 Z;  2H85 A;  2NVT I;  2R6M A;  4A3K I;  4BBS I;  3I55 Z;  3CCR 1;  2K5R A;  5LL6 f;  1NUI A;  4BY7 I;  1WII A;  3M3Y I;  3I4M I;  5C44 I;  2JA7 I;  3CMA Z;  2HF1 A;  1KC8 2;  2GTI A;  1YIJ Z;  5D1O B;  1RQF A;  2V3V A;  4A3I I;  4E32 A;  3NDI A;  4NH1 C;  1KRL A;  2VPX A;  4DGL A;  5C4J I;  3I4N I;  3PO3 S;  3CXC Y;  4A3C I;  2V45 A;  1RNI A;  4X6A I;  1VQ5 Z;  2GU2 A;  2OTJ 1;  1QYP A;  2NVY I;  1NJI 2;  4A3G I;  3G4S 1;  1JJ2 Y;  1X3W A;  4A3F I;  3PO3 I;  2RIQ A;  4NB8 A;  4BBR I;  5FLM I;  2NVX I;  4Y7N I;  2NAP A;  3IF8 A;  3D9X A;  1WCM I;  3CCE 1;  2O53 A;  3G71 Z;  1VQM 1;  4RVF A;  5IT9 f;  1N8R 2;  3S2H I;  3GCF A;  1VQ4 Z;  3D2L A;  2DE5 A;  5C3E I;  3S1N I;  1S7M A;  4NFR A;  4MH4 A;  2RBL A;  4A3L I;  1ZB8 A;  1NP6 A;  1I6H I;  1W2B Z;  3PO2 I;  4A3J I;  3CCU 1;  2JA8 I;  1VQ8 1;  3CC7 Z;  2W04 A;  1YUK A;  1Z01 A;  2KPI A;  3S2D I;  2VPZ A;  5IP7 I;  2PM9 A;  1N2F A;  1KD1 1;  5D1O A;  1TWG I;  2DE7 A;  1I3Q I;  5D1P A;  4RV9 A;  2Q4Z A;  3U50 C;  3HOU I;  1M90 2;  2JIR A;  1Q7Y 2;  3CCV Z;  3I07 A;  3HOW I;  1TWH I;  3CCJ Z;  1TWF I;  2OTL 1;  1X3Z A;  2R92 I;  1K73 2;  3H0G I;  4XX2 A;  4HH4 A;  5AN9 F;  5C4X I;  3S14 I;  1ZH1 A;  1RO0 A;  1TFI A;  3I55 1;  3CPW Z;  4NBD A;  2M48 A;  2O4H A;  1VQL Z;  2R7Z I;  3CMA 1;  1YJN Z;  2LIY A;  3IR7 A;  1VQ9 1;  5IT9 b;  1S72 Z;  1M1K 1;  1Y1W I;  3CCQ 1;  3JAM f;  1VQK Z;  1Q81 2;  4E33 A;  1PFT A;  3GTK I;  1Q16 A;  4NOZ A;  1VQN Z;  1QXF A;  3CCM 1;  1VQ7 Z;  2QEX Z;  2KI7 B;  1K8A 1;  4MXU A;  2GTH A;  3NDJ A;  1QVG Z;  1K9M 2;  2DE6 A;  1SIW A;  3CQZ I;  4QTT A;  2OOX B;  3CCL 1;  3CC4 Z;  3D6W A;  4MD7 A;  3ESW A;  2EGT A;  3M4O I;  4A3D I;  1YUA A;  3MZK B;  2QA4 Z;  3GKQ A;  3GTO I;  4A3B I;  2WAQ A;  2QRC B;  1VQ4 1;  4RVG A;  3F3F C;  1KC8 1;  2JS4 A;  3G6E 1;  5T6B A;  1KQS Z;  1YJ9 Z;  2E2H I;  2QLV B;  1YIT 1;  1VQO Z;  4DQY B;  1FDO A;  3P5J B;  3CME 1;  3MZL B;  3GTJ I;  4Y52 I;  4MD9 A;  3S17 I;  3JAM b;  3CCS 1;  4MD8 A;  1NJI 1;  2IZ3 A;  1VQP Z;  2V8K A;  1QVF Y;  3EER A;  3J7A 4;  1USP B;  3OW2 Z;  1SFO I;  2P3Y A;  2VPY A;  2AKL A;  3CCR Z;  2BJO A;  2QRE B;  3NH5 A;  2K3R A;  4E31 A;  4HGZ A;  1YJW 1;  4E2X A;  3I56 1;  1AA6 A;  2E9H A;  5T64 A;  1Q82 2;  1VQ6 1;  4BY1 I;  2PK7 A;  3KIH A;  1N8R 1;  1Q86 2;  3BG1 B;  1YI2 1;  4NBA A;  2V8J A;  2Y0S A;  2JIM A;  1YHQ 1;  3GTM I;  1Y1V S;  3G4S Z;  2LEX A;  3CD6 Z;  4NB9 A;  4A3M I;  2JR6 A;  1WZN A;  2JNY A;  2JIO A;  3CCE Z; 
#chains in the Genus database with same CATH homology
 2VUM I;  2G2K A;  3CC2 1;  3BG0 B;  1Y1V I;  2JUB A;  1LQL A;  3RZO I;  2PMZ A;  1M90 1;  1L1O C;  1TWA I;  1Q7Y 1;  3GTL I;  3GTQ I;  2F4M A;  3FQQ A;  4NBB A;  2RHB A;  1RO4 A;  3FKI I;  2RPR A;  2VF1 A;  3CC4 1;  3HKZ A;  2B63 I;  1K73 1;  4MRI A;  1YIJ 1;  4NBE A;  3CXC Z;  3VMH A;  3CCU Z;  1VQ8 Z;  2J6A A;  1W2B Y;  4NBH A;  4BXX I;  4S1T A;  3FQM A;  2OZK A;  1JJ2 Z;  1VQ5 1;  2JA5 I;  4DK1 A;  2HU9 A;  3S1R I;  4E2Z A;  4RVD A;  1Q81 1;  4A3E I;  3NH4 A;  4NBF A;  4TNU A;  3GTG I;  3RZD I;  2IZ4 A;  4MON A;  3J81 f;  2RT9 A;  2E2I I;  2OTL Z;  3VTN A;  1K9M 1;  3G71 1;  3KIF A;  5FLX b;  4RVH A;  3HOY I;  3HOV I;  3IX0 A;  3VMG A;  3CPW Y;  3VMI A;  5CM2 M;  4CL1 A;  4NBG A;  1VQ9 Z;  3CCQ Z;  3CC7 1;  2JMO A;  1RLY A;  3CCM Z;  2Q51 A;  3F3P C;  2E2J I;  3Q87 A;  3S1M I;  1JWH C;  3TDH B;  3CCV 1;  3CD6 1;  3K7A I;  1QVG Y;  3CCJ 1;  3CCL Z;  1R9T I;  5IP9 I;  3S15 I;  4E2W A;  2V8I A;  3GTM S;  5T67 A;  2W03 A;  3S16 I;  1X0T A;  3NFZ A;  2LFU A;  3J80 f;  3J81 b;  3VB9 A;  2R93 I;  1VQL 1;  2WB1 A;  2QR1 B;  1K83 I;  1KD1 2;  5A2Q b;  1P9N A;  2OTJ Z;  1YJN 1;  2NVQ I;  3G6E Z;  2JA6 I;  1S72 1;  2YAD A;  1VQK 1;  4A93 I;  1Q82 1;  3GTP I;  1YIT Z;  2P28 A;  4AYB A;  1Q86 1;  5FLX f;  1KQS Y;  4EWC A;  3CME Z;  1VQN 1;  1VQ7 1;  2QEX 1;  2ZAE B;  3CCS Z;  3MON A;  3HOX I;  1TWC I;  2F4O A;  1VQM Z;  1DL6 A;  2I3C A;  4E2Y A;  1Z03 A;  2YU9 I;  3IFU A;  1ML8 A;  3OW2 Y;  2QRD B;  3NH8 A;  4HGY A;  1I50 I;  1USP A;  3LUS A;  3TE5 B;  1YJW Z;  3I56 Z;  2OOY B;  1M1K 2;  2QA4 1;  1QF8 A;  3QWU A;  4QTU A;  1VQ6 Z;  1VLA A;  4NBC A;  1YI2 Z;  1ZB9 A;  4E30 A;  1K8A 2;  1Z02 A;  1YJ9 1;  1YHQ Z;  3HOZ I;  3J80 b;  1VQO 1;  3EED A;  2QKD A;  1RO2 A;  2M6N A;  1QVF Z;  3S1Q I;  1WW9 A;  3H3V J;  2VUG A;  5A2Q f;  1VQP 1;  4RS4 A;  3T4N B;  3CC2 Z;  2H85 A;  2NVT I;  2R6M A;  4A3K I;  4BBS I;  3I55 Z;  3CCR 1;  2K5R A;  5LL6 f;  1NUI A;  4BY7 I;  1WII A;  3M3Y I;  3I4M I;  5C44 I;  2JA7 I;  3CMA Z;  2HF1 A;  1KC8 2;  2GTI A;  1YIJ Z;  5D1O B;  1RQF A;  4A3I I;  4E32 A;  3NDI A;  4NH1 C;  1KRL A;  4DGL A;  5C4J I;  3I4N I;  3PO3 S;  3CXC Y;  4A3C I;  1RNI A;  4X6A I;  1VQ5 Z;  2GU2 A;  2OTJ 1;  1QYP A;  2NVY I;  1NJI 2;  4A3G I;  3G4S 1;  1JJ2 Y;  1X3W A;  4A3F I;  3PO3 I;  2RIQ A;  4NB8 A;  4BBR I;  5FLM I;  2NVX I;  4Y7N I;  3IF8 A;  3D9X A;  1WCM I;  3CCE 1;  2O53 A;  3G71 Z;  1VQM 1;  4RVF A;  5IT9 f;  1N8R 2;  3S2H I;  3GCF A;  1VQ4 Z;  2DE5 A;  5C3E I;  3S1N I;  1S7M A;  4NFR A;  4MH4 A;  2RBL A;  4A3L I;  1ZB8 A;  1NP6 A;  1I6H I;  1W2B Z;  3PO2 I;  4A3J I;  3CCU 1;  2JA8 I;  1VQ8 1;  3CC7 Z;  2W04 A;  1YUK A;  1Z01 A;  2KPI A;  3S2D I;  5IP7 I;  2PM9 A;  1N2F A;  1KD1 1;  5D1O A;  1TWG I;  2DE7 A;  1I3Q I;  5D1P A;  4RV9 A;  2Q4Z A;  3U50 C;  3HOU I;  1M90 2;  1Q7Y 2;  3CCV Z;  3I07 A;  3HOW I;  1TWH I;  3CCJ Z;  1TWF I;  2OTL 1;  1X3Z A;  2R92 I;  1K73 2;  3H0G I;  4XX2 A;  4HH4 A;  5AN9 F;  5C4X I;  3S14 I;  1ZH1 A;  1RO0 A;  1TFI A;  3I55 1;  3CPW Z;  4NBD A;  2M48 A;  2O4H A;  1VQL Z;  2R7Z I;  3CMA 1;  1YJN Z;  2LIY A;  1VQ9 1;  5IT9 b;  1S72 Z;  1M1K 1;  1Y1W I;  3CCQ 1;  3JAM f;  1VQK Z;  1Q81 2;  4E33 A;  1PFT A;  3GTK I;  4NOZ A;  1VQN Z;  3CCM 1;  1VQ7 Z;  2QEX Z;  2KI7 B;  1K8A 1;  4MXU A;  2GTH A;  3NDJ A;  1QVG Z;  1K9M 2;  2DE6 A;  3CQZ I;  4QTT A;  2OOX B;  3CCL 1;  3CC4 Z;  3D6W A;  4MD7 A;  3ESW A;  2EGT A;  3M4O I;  4A3D I;  1YUA A;  3MZK B;  2QA4 Z;  3GKQ A;  3GTO I;  4A3B I;  2WAQ A;  2QRC B;  1VQ4 1;  4RVG A;  3F3F C;  1KC8 1;  2JS4 A;  3G6E 1;  5T6B A;  1KQS Z;  1YJ9 Z;  2E2H I;  2QLV B;  1YIT 1;  1VQO Z;  4DQY B;  3P5J B;  3CME 1;  3MZL B;  3GTJ I;  4Y52 I;  4MD9 A;  3S17 I;  3JAM b;  3CCS 1;  4MD8 A;  1NJI 1;  2IZ3 A;  1VQP Z;  2V8K A;  1QVF Y;  3EER A;  3J7A 4;  1USP B;  3OW2 Z;  1SFO I;  2P3Y A;  2AKL A;  3CCR Z;  2BJO A;  2QRE B;  3NH5 A;  2K3R A;  4E31 A;  4HGZ A;  1YJW 1;  4E2X A;  3I56 1;  2E9H A;  5T64 A;  1Q82 2;  1VQ6 1;  4BY1 I;  2PK7 A;  3KIH A;  1N8R 1;  1Q86 2;  3BG1 B;  1YI2 1;  4NBA A;  2V8J A;  2Y0S A;  1YHQ 1;  3GTM I;  1Y1V S;  3G4S Z;  3CD6 Z;  4NB9 A;  4A3M I;  2JR6 A;  2JNY A;  3CCE Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...