3EEDA

Crystal structure of human protein kinase ck2 regulatory subunit (ck2beta; mutant 1-193)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
183
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The interaction of CK2{alpha} and CK2{beta}, the subunits of protein kinase CK2, requires CK2{beta} in a preformed conformation and is enthalpically driven
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Casein kinase II subunit beta
total genus 54
structure length 183
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 3eedA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3eedA02
4MD9A 1JWHC 2R6MA 4MD7A 4NH1C 4MD8A 2M48A 2JMOA 1QF8A 2RT9A 3EEDA 2M6NA 4DGLA 1RQFA
chains in the Genus database with same CATH superfamily
2OZKA 3CCMZ 1VQ6Z 3I551 2GU2A 2JMOA 2VUMI 2I3CA 2V8JA 4MRIA 1TWCI 3CD61 2O53A 2RPRA 1QVFZ 5LL6f 1QVFY 2R92I 3HOVI 3PO3I 1FDOA 1RNIA 2DE6A 2O4HA 3CME1 4HH4A 4NB9A 1YJNZ 4NB8A 4QTTA 3I561 4HGYA 1USPA 3NH8A 3GTKI 3M4OI 3GTMS 5IP7I 4A3II 2OTJ1 2E2HI 4Y7NI 4RS4A 1Q821 1VQ4Z 4A3GI 2OOXB 1VQ91 2KI7B 3ESWA 1WJ2A 1VQ41 1SIWA 1VQ9Z 2RHBA 1YJWZ 4E30A 4BBRI 1VQ71 1VQ5Z 1VQLZ 1VQ51 3NFZA 4E31A 2V8KA 1WIIA 3KIFA 3MZLB 1WCMI 3CCVZ 3D9XA 5D1OB 3S1MI 1YUKA 3CQZI 3HOYI 2JA7I 3CCSZ 4BBSI 3CCS1 4RVGA 2W04A 2V8IA 3CPWZ 1JJ2Z 2OTJZ 5T6BA 4RVDA 1RO2A 5D1OA 2JIPA 3MONA 2IZ3A 2YU9I 3CCUZ 1VQ81 4HGZA 5A2Qb 1I3QI 3F3FC 1YUAA 2VPYA 3HOXI 1NJI2 1Z03A 4E2YA 2VPZA 1X3WA 3CCV1 2AKLA 2E2JI 2QR1B 4MONA 2V3VA 2B63I 2ZAEB 3PO2I 3CXCZ 1YIT1 4MXUA 3S1NI 3S1QI 3CCQ1 2JIQA 4MD7A 1Y8CA 3GTQI 1QF8A 3CCU1 3CC71 2RT9A 3U50C 3J81b 4DQYB 3CMA1 1S7MA 4A3BI 2VPXA 1I50I 2NAPA 4MD9A 3D2LA 5D1PA 1KQSZ 2G2KA 2K5RA 1KQSY 1KRLA 1K731 5FLXb 1SFOI 5IP9I 1YITZ 3T4NB 2QEX1 2R7ZI 3CD6Z 2QEXZ 2AYDA 3NDJA 2QRCB 2JS4A 2JA6I 3CCQZ 1KC81 4DGLA 2JUBA 4S1TA 3VMHA 1K732 1ML8A 3PO3S 3G4SZ 2QA41 1QVGY 3J7A4 3HKZA 4DK1A 1YJN1 2W03A 3GTJI 3VMGA 1DL6A 5CM2M 3CC2Z 4MD8A 3CC4Z 3JAMf 3NH4A 3CC41 2J6AA 3OW2Y 1TWFI 2F4OA 1YJW1 1WW9A 4NBCA 2LFUA 1VQL1 3RZOI 2EGTA 4NBAA 1W2BY 2P28A 3S2DI 1NJI1 3D6WA 1Q812 3BG1B 2JIRA 4BY7I 2E2II 1QXFA 1NUIA 3FQMA 1VQO1 1M902 2LIYA 1RLYA 1I6HI 3GTLI 3TE5B 3I56Z 3S1RI 4A3DI 2QREB 1Q811 4QTUA 5IT9b 4X6AI 1M901 2VPWA 2PMZA 1JWHC 2V45A 3S15I 3G711 1VLAA 2JA5I 3Q87A 2LEXA 4A3MI 3G71Z 1QYPA 2Y0SA 2OTLZ 2JA8I 2RBLA 1PFTA 1Y1VI 1K83I 1NP6A 2H85A 3IR7A 5C3EI 3IX0A 4BY1I 5A2Qf 3IFUA 3TDHB 3F3PC 4EWCA 2NVQI 3BG0B 2PM9A 3HOZI 1S721 3J80b 2IV2X 3P5JB 3GKQA 1S72Z 4E2WA 3I4MI 2BJOA 1TFIA 4E33A 2PK7A 2NVTI 1KC82 1P9NA 3NDIA 2M48A 3CCJ1 3S2HI 1YJ9Z 2HU9A 1KD11 3S14I 4RVHA 1VQN1 3CCLZ 3HOWI 1VQNZ 3S17I 1USPB 1Q861 3G6EZ 2DE5A 2HF1A 3VMIA 1X3ZA 3G6E1 1KD12 2OOYB 4BXXI 3CCM1 1VQ61 4NBHA 2JR6A 4E32A 1X0TA 3FKII 1YI21 3I55Z 2IZ4A 3QWUA 5FLXf 3J80f 2NVYI 5C4XI 3G4S1 1N2FA 1YHQZ 3GTPI 5C44I 4A3FI 5T64A 2R93I 2YADA 1N8R2 3CPWY 3JAMb 1JJ2Y 2K3RA 3CCL1 2DE7A 4Y52I 4E2ZA 1RQFA 3H3VJ 4NBBA 3CC21 2JIMA 2Q4ZA 1N8R1 3VB9A 3CCE1 3EEDA 3RZDI 1YI2Z 1VQ7Z 2GTIA 3VTNA 3I07A 4NH1C 1VQKZ 1TWHI 1W2BZ 1K8A2 1Z02A 3MZKB 3I4NI 3S16I 4CL1A 1WZNA 1YIJ1 2QA4Z 1YIJZ 2GTHA 3CMEZ 1ZB8A 1K8A1 1K9M1 1RO4A 4TNUA 4A3KI 3GTOI 3GTGI 1L1OC 4XX2A 3J81f 1ZH1A 1Q7Y2 2VUGA 2RIQA 3CCEZ 4NBDA 2QKDA 2E9HA 1VQP1 3FQQA 1VQK1 4NBEA 2OTL1 1TWAI 1Q862 2JNYA 2QLVB 4RVFA 3M3YI 1VQOZ 3HOUI 5T67A 1ZB9A 2WAQA 2QRDB 1QVGZ 1AA6A 2VF1A 2WB1A 3NH5A 4RV9A 1VQMZ 1Q822 1LQLA 5C4JI 3CCR1 2JIOA 1VQPZ 1TWGI 1VQ8Z 3EERA 3GTMI 3CCRZ 3OW2Z 1M1K1 1Z01A 4MH4A 3CMAZ 5AN9F 2NVXI 2P3YA 4NFRA 2KPIA 1Y1WI 4A3JI 1M1K2 1R9TI 5FLMI 3CXCY 2F4MA 5IT9f 1RO0A 1FDIA 1Y1VS 2E7ZA 4NBFA 1YHQ1 1VQM1 3K7AI 3H0GI 3LUSA 4A3CI 3IF8A 1Q16A 3CCJZ 4A3EI 4AYBA 1YJ91 4NOZA 2Q51A 4E2XA 3CC7Z 1K9M2 3GCFA 4A93I 2R6MA 4A3LI 4NBGA 3KIHA 1Q7Y1 2M6NA
chains in the Genus database with same CATH topology
2OZKA 3CCMZ 1VQ6Z 3I551 2GU2A 2JMOA 2VUMI 2I3CA 2V8JA 4MRIA 1TWCI 3CD61 2O53A 2RPRA 1QVFZ 5LL6f 1QVFY 2R92I 3HOVI 3PO3I 1RNIA 2DE6A 2O4HA 3CME1 4HH4A 4NB9A 1YJNZ 4NB8A 4QTTA 3I561 4HGYA 1USPA 3NH8A 3GTKI 3M4OI 3GTMS 5IP7I 4A3II 2OTJ1 2E2HI 4Y7NI 4RS4A 1Q821 1VQ4Z 4A3GI 2OOXB 1VQ91 2KI7B 3ESWA 1VQ41 1VQ9Z 2RHBA 1YJWZ 4E30A 4BBRI 1VQ71 1VQ5Z 1VQLZ 1VQ51 3NFZA 4E31A 2V8KA 1WIIA 3KIFA 3MZLB 1WCMI 3CCVZ 3D9XA 5D1OB 3S1MI 1YUKA 3CQZI 3HOYI 2JA7I 3CCSZ 4BBSI 3CCS1 4RVGA 2W04A 2V8IA 3CPWZ 1JJ2Z 2OTJZ 5T6BA 4RVDA 1RO2A 5D1OA 3MONA 2IZ3A 2YU9I 3CCUZ 1VQ81 4HGZA 5A2Qb 1I3QI 3F3FC 1YUAA 3HOXI 1NJI2 1Z03A 4E2YA 1X3WA 3CCV1 2AKLA 2E2JI 2QR1B 4MONA 2B63I 2ZAEB 3PO2I 3CXCZ 1YIT1 4MXUA 3S1NI 3S1QI 3CCQ1 4MD7A 3GTQI 1QF8A 3CCU1 3CC71 2RT9A 3U50C 3J81b 4DQYB 3CMA1 1S7MA 4A3BI 1I50I 4MD9A 5D1PA 1KQSZ 2G2KA 2K5RA 1KQSY 1KRLA 1K731 5FLXb 1SFOI 5IP9I 1YITZ 3T4NB 2QEX1 2R7ZI 3CD6Z 2QEXZ 3NDJA 2QRCB 2JS4A 2JA6I 3CCQZ 1KC81 4DGLA 2JUBA 4S1TA 3VMHA 1K732 1ML8A 3PO3S 3G4SZ 2QA41 1QVGY 3J7A4 3HKZA 4DK1A 1YJN1 2W03A 3GTJI 3VMGA 1DL6A 5CM2M 3CC2Z 4MD8A 3CC4Z 3JAMf 3NH4A 3CC41 2J6AA 3OW2Y 1TWFI 2F4OA 1YJW1 1WW9A 4NBCA 2LFUA 1VQL1 3RZOI 2EGTA 4NBAA 1W2BY 2P28A 3S2DI 1NJI1 3D6WA 1Q812 3BG1B 4BY7I 2E2II 1NUIA 3FQMA 1VQO1 1M902 2LIYA 1RLYA 1I6HI 3GTLI 3TE5B 3I56Z 3S1RI 4A3DI 2QREB 1Q811 4QTUA 5IT9b 4X6AI 1M901 2PMZA 1JWHC 3S15I 3G711 1VLAA 2JA5I 3Q87A 4A3MI 3G71Z 1QYPA 2Y0SA 2OTLZ 2JA8I 2RBLA 1PFTA 1Y1VI 1K83I 1NP6A 2H85A 5C3EI 4BY1I 3IX0A 5A2Qf 3IFUA 3TDHB 3F3PC 4EWCA 2NVQI 3BG0B 2PM9A 3HOZI 1S721 3J80b 3P5JB 3GKQA 1S72Z 4E2WA 3I4MI 2BJOA 1TFIA 4E33A 2PK7A 2NVTI 1KC82 1P9NA 3NDIA 2M48A 3CCJ1 3S2HI 1YJ9Z 2HU9A 1KD11 3S14I 4RVHA 1VQN1 3CCLZ 3HOWI 1VQNZ 3S17I 1USPB 1Q861 3G6EZ 2DE5A 2HF1A 3VMIA 1X3ZA 3G6E1 1KD12 2OOYB 4BXXI 3CCM1 1VQ61 4NBHA 2JR6A 4E32A 1X0TA 3FKII 1YI21 3I55Z 2IZ4A 3QWUA 5FLXf 3J80f 2NVYI 5C4XI 3G4S1 1N2FA 1YHQZ 3GTPI 5C44I 4A3FI 5T64A 2R93I 2YADA 1N8R2 3CPWY 3JAMb 1JJ2Y 2K3RA 3CCL1 2DE7A 4Y52I 4E2ZA 1RQFA 3H3VJ 4NBBA 3CC21 2Q4ZA 1N8R1 3VB9A 3CCE1 3EEDA 3RZDI 1YI2Z 1VQ7Z 2GTIA 3VTNA 3I07A 4NH1C 1VQKZ 1TWHI 1W2BZ 1K8A2 1Z02A 3MZKB 3I4NI 3S16I 4CL1A 1YIJ1 2QA4Z 1YIJZ 2GTHA 3CMEZ 1ZB8A 1K8A1 1K9M1 1RO4A 4TNUA 4A3KI 3GTOI 3GTGI 1L1OC 4XX2A 3J81f 1ZH1A 1Q7Y2 2VUGA 2RIQA 3CCEZ 4NBDA 2QKDA 2E9HA 1VQP1 3FQQA 1VQK1 4NBEA 2OTL1 1TWAI 1Q862 2JNYA 2QLVB 4RVFA 3M3YI 1VQOZ 3HOUI 5T67A 1ZB9A 2WAQA 2QRDB 1QVGZ 2VF1A 2WB1A 3NH5A 4RV9A 1VQMZ 1Q822 1LQLA 5C4JI 3CCR1 1VQPZ 1TWGI 1VQ8Z 3EERA 3GTMI 3CCRZ 3OW2Z 1M1K1 1Z01A 4MH4A 3CMAZ 5AN9F 2NVXI 2P3YA 4NFRA 2KPIA 1Y1WI 4A3JI 1M1K2 1R9TI 5FLMI 3CXCY 2F4MA 5IT9f 1RO0A 1Y1VS 4NBFA 1YHQ1 1VQM1 3K7AI 3H0GI 3LUSA 4A3CI 3IF8A 3CCJZ 4A3EI 4AYBA 1YJ91 4NOZA 2Q51A 4E2XA 3CC7Z 1K9M2 3GCFA 4A93I 2R6MA 4A3LI 4NBGA 3KIHA 1Q7Y1 2M6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MD9 A;  1JWH C;  2R6M A;  4MD7 A;  4NH1 C;  4MD8 A;  2M48 A;  2JMO A;  1QF8 A;  2RT9 A;  3EED A;  2M6N A;  4DGL A;  1RQF A; 
#chains in the Genus database with same CATH topology
 2OZK A;  3CCM Z;  1VQ6 Z;  3I55 1;  2GU2 A;  2JMO A;  2VUM I;  2I3C A;  2V8J A;  4MRI A;  1TWC I;  3CD6 1;  2O53 A;  2RPR A;  1QVF Z;  5LL6 f;  1QVF Y;  2R92 I;  3HOV I;  3PO3 I;  1FDO A;  1RNI A;  2DE6 A;  2O4H A;  3CME 1;  4HH4 A;  4NB9 A;  1YJN Z;  4NB8 A;  4QTT A;  3I56 1;  4HGY A;  1USP A;  3NH8 A;  3GTK I;  3M4O I;  3GTM S;  5IP7 I;  4A3I I;  2OTJ 1;  2E2H I;  4Y7N I;  4RS4 A;  1Q82 1;  1VQ4 Z;  4A3G I;  2OOX B;  1VQ9 1;  2KI7 B;  3ESW A;  1WJ2 A;  1VQ4 1;  1SIW A;  1VQ9 Z;  2RHB A;  1YJW Z;  4E30 A;  4BBR I;  1VQ7 1;  1VQ5 Z;  1VQL Z;  1VQ5 1;  3NFZ A;  4E31 A;  2V8K A;  1WII A;  3KIF A;  3MZL B;  1WCM I;  3CCV Z;  3D9X A;  5D1O B;  3S1M I;  1YUK A;  3CQZ I;  3HOY I;  2JA7 I;  3CCS Z;  4BBS I;  3CCS 1;  4RVG A;  2W04 A;  2V8I A;  3CPW Z;  1JJ2 Z;  2OTJ Z;  5T6B A;  4RVD A;  1RO2 A;  5D1O A;  2JIP A;  3MON A;  2IZ3 A;  2YU9 I;  3CCU Z;  1VQ8 1;  4HGZ A;  5A2Q b;  1I3Q I;  3F3F C;  1YUA A;  2VPY A;  3HOX I;  1NJI 2;  1Z03 A;  4E2Y A;  2VPZ A;  1X3W A;  3CCV 1;  2AKL A;  2E2J I;  2QR1 B;  4MON A;  2V3V A;  2B63 I;  2ZAE B;  3PO2 I;  3CXC Z;  1YIT 1;  4MXU A;  3S1N I;  3S1Q I;  3CCQ 1;  2JIQ A;  4MD7 A;  1Y8C A;  3GTQ I;  1QF8 A;  3CCU 1;  3CC7 1;  2RT9 A;  3U50 C;  3J81 b;  4DQY B;  3CMA 1;  1S7M A;  4A3B I;  2VPX A;  1I50 I;  2NAP A;  4MD9 A;  3D2L A;  5D1P A;  1KQS Z;  2G2K A;  2K5R A;  1KQS Y;  1KRL A;  1K73 1;  5FLX b;  1SFO I;  5IP9 I;  1YIT Z;  3T4N B;  2QEX 1;  2R7Z I;  3CD6 Z;  2QEX Z;  2AYD A;  3NDJ A;  2QRC B;  2JS4 A;  2JA6 I;  3CCQ Z;  1KC8 1;  4DGL A;  2JUB A;  4S1T A;  3VMH A;  1K73 2;  1ML8 A;  3PO3 S;  3G4S Z;  2QA4 1;  1QVG Y;  3J7A 4;  3HKZ A;  4DK1 A;  1YJN 1;  2W03 A;  3GTJ I;  3VMG A;  1DL6 A;  5CM2 M;  3CC2 Z;  4MD8 A;  3CC4 Z;  3JAM f;  3NH4 A;  3CC4 1;  2J6A A;  3OW2 Y;  1TWF I;  2F4O A;  1YJW 1;  1WW9 A;  4NBC A;  2LFU A;  1VQL 1;  3RZO I;  2EGT A;  4NBA A;  1W2B Y;  2P28 A;  3S2D I;  1NJI 1;  3D6W A;  1Q81 2;  3BG1 B;  2JIR A;  4BY7 I;  2E2I I;  1QXF A;  1NUI A;  3FQM A;  1VQO 1;  1M90 2;  2LIY A;  1RLY A;  1I6H I;  3GTL I;  3TE5 B;  3I56 Z;  3S1R I;  4A3D I;  2QRE B;  1Q81 1;  4QTU A;  5IT9 b;  4X6A I;  1M90 1;  2VPW A;  2PMZ A;  1JWH C;  2V45 A;  3S15 I;  3G71 1;  1VLA A;  2JA5 I;  3Q87 A;  2LEX A;  4A3M I;  3G71 Z;  1QYP A;  2Y0S A;  2OTL Z;  2JA8 I;  2RBL A;  1PFT A;  1Y1V I;  1K83 I;  1NP6 A;  2H85 A;  3IR7 A;  5C3E I;  3IX0 A;  4BY1 I;  5A2Q f;  3IFU A;  3TDH B;  3F3P C;  4EWC A;  2NVQ I;  3BG0 B;  2PM9 A;  3HOZ I;  1S72 1;  3J80 b;  2IV2 X;  3P5J B;  3GKQ A;  1S72 Z;  4E2W A;  3I4M I;  2BJO A;  1TFI A;  4E33 A;  2PK7 A;  2NVT I;  1KC8 2;  1P9N A;  3NDI A;  2M48 A;  3CCJ 1;  3S2H I;  1YJ9 Z;  2HU9 A;  1KD1 1;  3S14 I;  4RVH A;  1VQN 1;  3CCL Z;  3HOW I;  1VQN Z;  3S17 I;  1USP B;  1Q86 1;  3G6E Z;  2DE5 A;  2HF1 A;  3VMI A;  1X3Z A;  3G6E 1;  1KD1 2;  2OOY B;  4BXX I;  3CCM 1;  1VQ6 1;  4NBH A;  2JR6 A;  4E32 A;  1X0T A;  3FKI I;  1YI2 1;  3I55 Z;  2IZ4 A;  3QWU A;  5FLX f;  3J80 f;  2NVY I;  5C4X I;  3G4S 1;  1N2F A;  1YHQ Z;  3GTP I;  5C44 I;  4A3F I;  5T64 A;  2R93 I;  2YAD A;  1N8R 2;  3CPW Y;  3JAM b;  1JJ2 Y;  2K3R A;  3CCL 1;  2DE7 A;  4Y52 I;  4E2Z A;  1RQF A;  3H3V J;  4NBB A;  3CC2 1;  2JIM A;  2Q4Z A;  1N8R 1;  3VB9 A;  3CCE 1;  3EED A;  3RZD I;  1YI2 Z;  1VQ7 Z;  2GTI A;  3VTN A;  3I07 A;  4NH1 C;  1VQK Z;  1TWH I;  1W2B Z;  1K8A 2;  1Z02 A;  3MZK B;  3I4N I;  3S16 I;  4CL1 A;  1WZN A;  1YIJ 1;  2QA4 Z;  1YIJ Z;  2GTH A;  3CME Z;  1ZB8 A;  1K8A 1;  1K9M 1;  1RO4 A;  4TNU A;  4A3K I;  3GTO I;  3GTG I;  1L1O C;  4XX2 A;  3J81 f;  1ZH1 A;  1Q7Y 2;  2VUG A;  2RIQ A;  3CCE Z;  4NBD A;  2QKD A;  2E9H A;  1VQP 1;  3FQQ A;  1VQK 1;  4NBE A;  2OTL 1;  1TWA I;  1Q86 2;  2JNY A;  2QLV B;  4RVF A;  3M3Y I;  1VQO Z;  3HOU I;  5T67 A;  1ZB9 A;  2WAQ A;  2QRD B;  1QVG Z;  1AA6 A;  2VF1 A;  2WB1 A;  3NH5 A;  4RV9 A;  1VQM Z;  1Q82 2;  1LQL A;  5C4J I;  3CCR 1;  2JIO A;  1VQP Z;  1TWG I;  1VQ8 Z;  3EER A;  3GTM I;  3CCR Z;  3OW2 Z;  1M1K 1;  1Z01 A;  4MH4 A;  3CMA Z;  5AN9 F;  2NVX I;  2P3Y A;  4NFR A;  2KPI A;  1Y1W I;  4A3J I;  1M1K 2;  1R9T I;  5FLM I;  3CXC Y;  2F4M A;  5IT9 f;  1RO0 A;  1FDI A;  1Y1V S;  2E7Z A;  4NBF A;  1YHQ 1;  1VQM 1;  3K7A I;  3H0G I;  3LUS A;  4A3C I;  3IF8 A;  1Q16 A;  3CCJ Z;  4A3E I;  4AYB A;  1YJ9 1;  4NOZ A;  2Q51 A;  4E2X A;  3CC7 Z;  1K9M 2;  3GCF A;  4A93 I;  2R6M A;  4A3L I;  4NBG A;  3KIH A;  1Q7Y 1;  2M6N A; 
#chains in the Genus database with same CATH homology
 2OZK A;  3CCM Z;  1VQ6 Z;  3I55 1;  2GU2 A;  2JMO A;  2VUM I;  2I3C A;  2V8J A;  4MRI A;  1TWC I;  3CD6 1;  2O53 A;  2RPR A;  1QVF Z;  5LL6 f;  1QVF Y;  2R92 I;  3HOV I;  3PO3 I;  1RNI A;  2DE6 A;  2O4H A;  3CME 1;  4HH4 A;  4NB9 A;  1YJN Z;  4NB8 A;  4QTT A;  3I56 1;  4HGY A;  1USP A;  3NH8 A;  3GTK I;  3M4O I;  3GTM S;  5IP7 I;  4A3I I;  2OTJ 1;  2E2H I;  4Y7N I;  4RS4 A;  1Q82 1;  1VQ4 Z;  4A3G I;  2OOX B;  1VQ9 1;  2KI7 B;  3ESW A;  1VQ4 1;  1VQ9 Z;  2RHB A;  1YJW Z;  4E30 A;  4BBR I;  1VQ7 1;  1VQ5 Z;  1VQL Z;  1VQ5 1;  3NFZ A;  4E31 A;  2V8K A;  1WII A;  3KIF A;  3MZL B;  1WCM I;  3CCV Z;  3D9X A;  5D1O B;  3S1M I;  1YUK A;  3CQZ I;  3HOY I;  2JA7 I;  3CCS Z;  4BBS I;  3CCS 1;  4RVG A;  2W04 A;  2V8I A;  3CPW Z;  1JJ2 Z;  2OTJ Z;  5T6B A;  4RVD A;  1RO2 A;  5D1O A;  3MON A;  2IZ3 A;  2YU9 I;  3CCU Z;  1VQ8 1;  4HGZ A;  5A2Q b;  1I3Q I;  3F3F C;  1YUA A;  3HOX I;  1NJI 2;  1Z03 A;  4E2Y A;  1X3W A;  3CCV 1;  2AKL A;  2E2J I;  2QR1 B;  4MON A;  2B63 I;  2ZAE B;  3PO2 I;  3CXC Z;  1YIT 1;  4MXU A;  3S1N I;  3S1Q I;  3CCQ 1;  4MD7 A;  3GTQ I;  1QF8 A;  3CCU 1;  3CC7 1;  2RT9 A;  3U50 C;  3J81 b;  4DQY B;  3CMA 1;  1S7M A;  4A3B I;  1I50 I;  4MD9 A;  5D1P A;  1KQS Z;  2G2K A;  2K5R A;  1KQS Y;  1KRL A;  1K73 1;  5FLX b;  1SFO I;  5IP9 I;  1YIT Z;  3T4N B;  2QEX 1;  2R7Z I;  3CD6 Z;  2QEX Z;  3NDJ A;  2QRC B;  2JS4 A;  2JA6 I;  3CCQ Z;  1KC8 1;  4DGL A;  2JUB A;  4S1T A;  3VMH A;  1K73 2;  1ML8 A;  3PO3 S;  3G4S Z;  2QA4 1;  1QVG Y;  3J7A 4;  3HKZ A;  4DK1 A;  1YJN 1;  2W03 A;  3GTJ I;  3VMG A;  1DL6 A;  5CM2 M;  3CC2 Z;  4MD8 A;  3CC4 Z;  3JAM f;  3NH4 A;  3CC4 1;  2J6A A;  3OW2 Y;  1TWF I;  2F4O A;  1YJW 1;  1WW9 A;  4NBC A;  2LFU A;  1VQL 1;  3RZO I;  2EGT A;  4NBA A;  1W2B Y;  2P28 A;  3S2D I;  1NJI 1;  3D6W A;  1Q81 2;  3BG1 B;  4BY7 I;  2E2I I;  1NUI A;  3FQM A;  1VQO 1;  1M90 2;  2LIY A;  1RLY A;  1I6H I;  3GTL I;  3TE5 B;  3I56 Z;  3S1R I;  4A3D I;  2QRE B;  1Q81 1;  4QTU A;  5IT9 b;  4X6A I;  1M90 1;  2PMZ A;  1JWH C;  3S15 I;  3G71 1;  1VLA A;  2JA5 I;  3Q87 A;  4A3M I;  3G71 Z;  1QYP A;  2Y0S A;  2OTL Z;  2JA8 I;  2RBL A;  1PFT A;  1Y1V I;  1K83 I;  1NP6 A;  2H85 A;  5C3E I;  4BY1 I;  3IX0 A;  5A2Q f;  3IFU A;  3TDH B;  3F3P C;  4EWC A;  2NVQ I;  3BG0 B;  2PM9 A;  3HOZ I;  1S72 1;  3J80 b;  3P5J B;  3GKQ A;  1S72 Z;  4E2W A;  3I4M I;  2BJO A;  1TFI A;  4E33 A;  2PK7 A;  2NVT I;  1KC8 2;  1P9N A;  3NDI A;  2M48 A;  3CCJ 1;  3S2H I;  1YJ9 Z;  2HU9 A;  1KD1 1;  3S14 I;  4RVH A;  1VQN 1;  3CCL Z;  3HOW I;  1VQN Z;  3S17 I;  1USP B;  1Q86 1;  3G6E Z;  2DE5 A;  2HF1 A;  3VMI A;  1X3Z A;  3G6E 1;  1KD1 2;  2OOY B;  4BXX I;  3CCM 1;  1VQ6 1;  4NBH A;  2JR6 A;  4E32 A;  1X0T A;  3FKI I;  1YI2 1;  3I55 Z;  2IZ4 A;  3QWU A;  5FLX f;  3J80 f;  2NVY I;  5C4X I;  3G4S 1;  1N2F A;  1YHQ Z;  3GTP I;  5C44 I;  4A3F I;  5T64 A;  2R93 I;  2YAD A;  1N8R 2;  3CPW Y;  3JAM b;  1JJ2 Y;  2K3R A;  3CCL 1;  2DE7 A;  4Y52 I;  4E2Z A;  1RQF A;  3H3V J;  4NBB A;  3CC2 1;  2Q4Z A;  1N8R 1;  3VB9 A;  3CCE 1;  3EED A;  3RZD I;  1YI2 Z;  1VQ7 Z;  2GTI A;  3VTN A;  3I07 A;  4NH1 C;  1VQK Z;  1TWH I;  1W2B Z;  1K8A 2;  1Z02 A;  3MZK B;  3I4N I;  3S16 I;  4CL1 A;  1YIJ 1;  2QA4 Z;  1YIJ Z;  2GTH A;  3CME Z;  1ZB8 A;  1K8A 1;  1K9M 1;  1RO4 A;  4TNU A;  4A3K I;  3GTO I;  3GTG I;  1L1O C;  4XX2 A;  3J81 f;  1ZH1 A;  1Q7Y 2;  2VUG A;  2RIQ A;  3CCE Z;  4NBD A;  2QKD A;  2E9H A;  1VQP 1;  3FQQ A;  1VQK 1;  4NBE A;  2OTL 1;  1TWA I;  1Q86 2;  2JNY A;  2QLV B;  4RVF A;  3M3Y I;  1VQO Z;  3HOU I;  5T67 A;  1ZB9 A;  2WAQ A;  2QRD B;  1QVG Z;  2VF1 A;  2WB1 A;  3NH5 A;  4RV9 A;  1VQM Z;  1Q82 2;  1LQL A;  5C4J I;  3CCR 1;  1VQP Z;  1TWG I;  1VQ8 Z;  3EER A;  3GTM I;  3CCR Z;  3OW2 Z;  1M1K 1;  1Z01 A;  4MH4 A;  3CMA Z;  5AN9 F;  2NVX I;  2P3Y A;  4NFR A;  2KPI A;  1Y1W I;  4A3J I;  1M1K 2;  1R9T I;  5FLM I;  3CXC Y;  2F4M A;  5IT9 f;  1RO0 A;  1Y1V S;  4NBF A;  1YHQ 1;  1VQM 1;  3K7A I;  3H0G I;  3LUS A;  4A3C I;  3IF8 A;  3CCJ Z;  4A3E I;  4AYB A;  1YJ9 1;  4NOZ A;  2Q51 A;  4E2X A;  3CC7 Z;  1K9M 2;  3GCF A;  4A93 I;  2R6M A;  4A3L I;  4NBG A;  3KIH A;  1Q7Y 1;  2M6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...