3EEDA

Crystal structure of human protein kinase ck2 regulatory subunit (ck2beta; mutant 1-193)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
183
Chain Sequence
b'EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title The interaction of CK2{alpha} and CK2{beta}, the subunits of protein kinase CK2, requires CK2{beta} in a preformed conformation and is enthalpically driven
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 54
structure length 183
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 3eedA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3eedA02
1RQFA 2R6MA 4DGLA 2JMOA 4MD8A 2RT9A 2M48A 4NH1C 4MD9A 3EEDA 4MD7A 1JWHC 2M6NA 1QF8A
chains in the Genus database with same CATH superfamily
2IZ3A 3CCJ1 2QA4Z 3CCUZ 3CXCZ 1VQ8Z 5LL6f 4NBGA 3J81b 1YJ9Z 1VQLZ 2QA41 3CCU1 1YJ91 1RLYA 2ZAEB 2J6AA 5A2Qb 1X3ZA 3CD6Z 3PO3I 3MZLB 1QXFA 1VQOZ 1YIJ1 1VQO1 3VTNA 4S1TA 1TWHI 2JUBA 4NBDA 3MZKB 3J80f 2DE5A 1I6HI 1YITZ 4BBSI 3VMHA 3FQQA 1YIT1 4MD8A 2AKLA 3FQMA 4A3II 2JR6A 3MONA 5AN9F 1M902 3CCS1 5IP7I 2W04A 1VQ91 2KPIA 5T64A 5T67A 4MH4A 3GKQA 1RNIA 5T6BA 4BY1I 2JNYA 2NVTI 1NP6A 1TWAI 4A3MI 2QKDA 2RPRA 2V8KA 3GTGI 2OOXB 3VMGA 1YJW1 1Q821 1L1OC 2QREB 3Q87A 2PK7A 3BG1B 1Q7Y1 3H3VJ 3NH4A 2VPWA 1M1K1 4QTTA 1I3QI 3CCEZ 4A3LI 1Q862 2IZ4A 5FLXb 3S1NI 2M6NA 3F3FC 1VQ7Z 4A3EI 3S2DI 1VQ71 3NH5A 5IT9b 3JAMb 1K732 2OTJZ 2RT9A 3I561 3H0GI 4E32A 1N8R1 2Q4ZA 1ML8A 3CPWY 3HOXI 3GTLI 2NVYI 2HU9A 1VQP1 2K5RA 2VPYA 2QLVB 3CC2Z 3P5JB 3U50C 4E2YA 1SFOI 2JIQA 3CMEZ 2I3CA 1ZH1A 2JMOA 2VF1A 3CCVZ 3G6EZ 3D9XA 3CME1 2LFUA 1K9M2 3CCV1 3S15I 1VQM1 3G6E1 4E2XA 3CCJZ 2M48A 3IF8A 1Z01A 2VPXA 3VMIA 1M901 3TDHB 1NJI2 3KIHA 4E30A 2PM9A 2O53A 3GTMI 3HOUI 1YUKA 3I55Z 1VQNZ 2JIOA 2KI7B 3J7A4 3GTKI 3CC41 1NUIA 5C3EI 3I551 2E2JI 1VQN1 1W2BY 1YHQ1 4NH1C 1YUAA 1S721 4NBFA 4EWCA 3I07A 1Y1WI 1YIJZ 4NBEA 2R7ZI 4RV9A 3M3YI 4X6AI 3NH8A 2H85A 3J81f 5D1OB 1N2FA 3QWUA 3NDJA 1KD11 2NVQI 1VQK1 1WIIA 5A2Qf 1Q811 2OTLZ 3IX0A 3GTOI 2OTL1 3S14I 4NBAA 2QR1B 3CCR1 3CCSZ 1QVGY 1SIWA 4A3DI 1JWHC 2BJOA 1VQ9Z 5C4XI 2V3VA 4HH4A 3IFUA 3EEDA 3S1MI 1QVGZ 3S17I 1VLAA 3K7AI 1Y8CA 3EERA 2JA5I 2E7ZA 2NAPA 1VQ5Z 3HOZI 3CC71 3TE5B 2DE7A 1WCMI 1KC82 1VQ51 4QTUA 2JIRA 2R92I 1YJN1 1YJWZ 2B63I 3OW2Y 4MXUA 4HGYA 1Z02A 1TWFI 2QRCB 4A3CI 3CCLZ 3CQZI 3PO2I 5C4JI 3CCL1 3M4OI 1KQSY 3IR7A 4BY7I 3D6WA 4A3KI 4A3FI 3CMA1 2O4HA 3KIFA 2VPZA 1WJ2A 3D2LA 1Q16A 1K83I 4DQYB 3LUSA 1LQLA 3RZOI 4NB8A 3HOYI 3I56Z 4RS4A 5D1PA 2HF1A 2E2HI 2V8IA 1VQ4Z 5IP9I 3NDIA 1QYPA 1VQ41 1VQPZ 3G71Z 1QVFY 3G4S1 1S7MA 2JA7I 2V45A 5FLXf 3G711 4A3GI 3GTQI 3CPWZ 1R9TI 2JIPA 3NFZA 3F3PC 2F4OA 5IT9f 3JAMf 2OZKA 1KRLA 1VQMZ 4MRIA 3I4NI 1P9NA 1TFIA 1WW9A 5CM2M 1ZB8A 2GTHA 1K8A2 3HOWI 1YI21 3GTPI 1USPB 1Y1VS 1RO4A 3HKZA 4RVHA 2R93I 3CC4Z 4MD7A 4HGZA 1YHQZ 3I4MI 1S72Z 1Q7Y2 2OOYB 1M1K2 2GTIA 2Q51A 1X3WA 2VUGA 4NOZA 4BBRI 2G2KA 1W2BZ 4BXXI 2WB1A 1PFTA 2IV2X 1VQKZ 3CCQZ 1TWCI 3BG0B 1VQ6Z 1VQ81 1Y1VI 3CCQ1 3J80b 1VQL1 1VQ61 4E2WA 3CCRZ 1N8R2 5D1OA 3CD61 1Q861 1DL6A 4NBCA 2YU9I 2JA6I 1RO0A 2P28A 4Y7NI 2R6MA 3S1RI 4TNUA 4NFRA 1K731 2QEXZ 3S1QI 3CC7Z 4DGLA 2K3RA 2NVXI 2QEX1 1ZB9A 2GU2A 1YJNZ 2JS4A 4A3BI 3CCMZ 2Y0SA 2W03A 4XX2A 4E31A 4Y52I 3CCM1 1AA6A 3S16I 3GTJI 3OW2Z 3ESWA 1K9M1 2VUMI 4RVDA 3CMAZ 4NBHA 4CL1A 1RQFA 1K8A1 4E33A 4RVFA 3FKII 2RIQA 1KQSZ 1NJI1 1KD12 5C44I 4E2ZA 1TWGI 4NBBA 1WZNA 2F4MA 4MONA 4AYBA 2YADA 1Q812 2QRDB 3T4NB 2DE6A 3G4SZ 2EGTA 3CCE1 4MD9A 4DK1A 1FDIA 1QVFZ 3GCFA 1JJ2Y 2OTJ1 1X0TA 1FDOA 1YI2Z 3VB9A 2WAQA 2E9HA 1JJ2Z 3GTMS 3HOVI 2AYDA 4NB9A 1I50I 2LEXA 1Q822 3RZDI 1Z03A 2RBLA 3CC21 1QF8A 3PO3S 2PMZA 1USPA 4A93I 2V8JA 4A3JI 2LIYA 3S2HI 4RVGA 2E2II 5FLMI 2JA8I 3CXCY 1KC81 2P3YA 2JIMA 2RHBA 1RO2A
chains in the Genus database with same CATH topology
2IZ3A 3CCJ1 2QA4Z 3CCUZ 3CXCZ 1VQ8Z 5LL6f 4NBGA 3J81b 1YJ9Z 1VQLZ 2QA41 3CCU1 1YJ91 1RLYA 2ZAEB 2J6AA 5A2Qb 1X3ZA 3CD6Z 3PO3I 3MZLB 1VQOZ 1YIJ1 1VQO1 3VTNA 4S1TA 1TWHI 2JUBA 4NBDA 3MZKB 3J80f 2DE5A 1I6HI 1YITZ 4BBSI 3VMHA 3FQQA 1YIT1 4MD8A 2AKLA 3FQMA 4A3II 2JR6A 3MONA 5AN9F 1M902 3CCS1 5IP7I 2W04A 1VQ91 2KPIA 5T64A 5T67A 4MH4A 3GKQA 1RNIA 5T6BA 4BY1I 2JNYA 2NVTI 1NP6A 1TWAI 4A3MI 2QKDA 2RPRA 2V8KA 3GTGI 2OOXB 3VMGA 1YJW1 1Q821 1L1OC 2QREB 3Q87A 2PK7A 3BG1B 1Q7Y1 3H3VJ 3NH4A 1M1K1 4QTTA 1I3QI 3CCEZ 4A3LI 1Q862 2IZ4A 5FLXb 3S1NI 2M6NA 3F3FC 1VQ7Z 4A3EI 3S2DI 1VQ71 3NH5A 5IT9b 3JAMb 1K732 2OTJZ 2RT9A 3I561 3H0GI 4E32A 1N8R1 2Q4ZA 1ML8A 3CPWY 3HOXI 3GTLI 2NVYI 2HU9A 1VQP1 2K5RA 2QLVB 3CC2Z 3P5JB 3U50C 4E2YA 1SFOI 3CMEZ 2I3CA 1ZH1A 2JMOA 2VF1A 3CCVZ 3G6EZ 3D9XA 3CME1 2LFUA 1K9M2 3CCV1 3S15I 1VQM1 3G6E1 4E2XA 3CCJZ 2M48A 3IF8A 1Z01A 1M901 3VMIA 3TDHB 1NJI2 3KIHA 4E30A 2PM9A 2O53A 3GTMI 3HOUI 1YUKA 3I55Z 1VQNZ 3J7A4 2KI7B 3GTKI 3CC41 1NUIA 5C3EI 3I551 2E2JI 1VQN1 1W2BY 1YHQ1 4NH1C 1YUAA 1S721 4NBFA 4EWCA 3I07A 1Y1WI 1YIJZ 4NBEA 2R7ZI 4RV9A 3M3YI 4X6AI 3NH8A 2H85A 3J81f 5D1OB 1N2FA 3QWUA 3NDJA 1KD11 2NVQI 1VQK1 1WIIA 5A2Qf 1Q811 2OTLZ 3IX0A 3GTOI 2OTL1 3S14I 4NBAA 2QR1B 3CCR1 3CCSZ 1QVGY 4A3DI 1JWHC 2BJOA 1VQ9Z 5C4XI 4HH4A 3IFUA 3EEDA 3S1MI 1QVGZ 3S17I 1VLAA 3K7AI 3EERA 2JA5I 1VQ5Z 3HOZI 3CC71 3TE5B 2DE7A 1WCMI 1KC82 1VQ51 4QTUA 2R92I 1YJN1 1YJWZ 2B63I 3OW2Y 4MXUA 4HGYA 1Z02A 1TWFI 2QRCB 4A3CI 3CCLZ 3CQZI 3PO2I 5C4JI 3CCL1 3M4OI 1KQSY 4BY7I 3D6WA 4A3KI 4A3FI 3CMA1 2O4HA 3KIFA 1K83I 4DQYB 3LUSA 1LQLA 3RZOI 4NB8A 3HOYI 3I56Z 4RS4A 5D1PA 2HF1A 2E2HI 2V8IA 1VQ4Z 5IP9I 3NDIA 1QYPA 1VQ41 1VQPZ 3G71Z 1QVFY 3G4S1 1S7MA 2JA7I 5FLXf 3G711 4A3GI 3GTQI 3CPWZ 1R9TI 3NFZA 3F3PC 2F4OA 5IT9f 3JAMf 2OZKA 1KRLA 1VQMZ 4MRIA 3I4NI 1P9NA 1TFIA 1WW9A 5CM2M 1ZB8A 2GTHA 1K8A2 3HOWI 1YI21 3GTPI 1USPB 1Y1VS 1RO4A 3HKZA 4RVHA 2R93I 3CC4Z 4MD7A 4HGZA 1YHQZ 3I4MI 1S72Z 1Q7Y2 2OOYB 1M1K2 2GTIA 2Q51A 1X3WA 2VUGA 4NOZA 4BBRI 2G2KA 1W2BZ 4BXXI 2WB1A 1PFTA 1VQKZ 3CCQZ 1TWCI 3BG0B 1VQ6Z 1VQ81 1Y1VI 3CCQ1 3J80b 1VQL1 1VQ61 4E2WA 3CCRZ 1N8R2 5D1OA 3CD61 1Q861 1DL6A 4NBCA 2YU9I 2JA6I 1RO0A 2P28A 4Y7NI 2R6MA 3S1RI 4TNUA 4NFRA 1K731 2QEXZ 3S1QI 3CC7Z 4DGLA 2K3RA 2NVXI 2QEX1 1ZB9A 2GU2A 1YJNZ 2JS4A 4A3BI 3CCMZ 2Y0SA 2W03A 4XX2A 4E31A 4Y52I 3CCM1 3S16I 3GTJI 3OW2Z 3ESWA 1K9M1 2VUMI 4RVDA 3CMAZ 4NBHA 4CL1A 1RQFA 1K8A1 4E33A 4RVFA 3FKII 2RIQA 1KQSZ 1NJI1 1KD12 5C44I 4E2ZA 1TWGI 4NBBA 2F4MA 4MONA 4AYBA 2YADA 1Q812 2QRDB 3T4NB 2DE6A 3G4SZ 2EGTA 3CCE1 4MD9A 4DK1A 1QVFZ 3GCFA 1JJ2Y 2OTJ1 1X0TA 1YI2Z 3VB9A 2WAQA 2E9HA 1JJ2Z 3GTMS 3HOVI 4NB9A 1I50I 1Q822 3RZDI 1Z03A 2RBLA 3CC21 1QF8A 3PO3S 2PMZA 1USPA 4A93I 2V8JA 4A3JI 2LIYA 3S2HI 4RVGA 2E2II 5FLMI 2JA8I 3CXCY 1KC81 2P3YA 2RHBA 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RQF A;  2R6M A;  4DGL A;  2JMO A;  4MD8 A;  2RT9 A;  2M48 A;  4NH1 C;  4MD9 A;  3EED A;  4MD7 A;  1JWH C;  2M6N A;  1QF8 A; 
#chains in the Genus database with same CATH topology
 2IZ3 A;  3CCJ 1;  2QA4 Z;  3CCU Z;  3CXC Z;  1VQ8 Z;  5LL6 f;  4NBG A;  3J81 b;  1YJ9 Z;  1VQL Z;  2QA4 1;  3CCU 1;  1YJ9 1;  1RLY A;  2ZAE B;  2J6A A;  5A2Q b;  1X3Z A;  3CD6 Z;  3PO3 I;  3MZL B;  1QXF A;  1VQO Z;  1YIJ 1;  1VQO 1;  3VTN A;  4S1T A;  1TWH I;  2JUB A;  4NBD A;  3MZK B;  3J80 f;  2DE5 A;  1I6H I;  1YIT Z;  4BBS I;  3VMH A;  3FQQ A;  1YIT 1;  4MD8 A;  2AKL A;  3FQM A;  4A3I I;  2JR6 A;  3MON A;  5AN9 F;  1M90 2;  3CCS 1;  5IP7 I;  2W04 A;  1VQ9 1;  2KPI A;  5T64 A;  5T67 A;  4MH4 A;  3GKQ A;  1RNI A;  5T6B A;  4BY1 I;  2JNY A;  2NVT I;  1NP6 A;  1TWA I;  4A3M I;  2QKD A;  2RPR A;  2V8K A;  3GTG I;  2OOX B;  3VMG A;  1YJW 1;  1Q82 1;  1L1O C;  2QRE B;  3Q87 A;  2PK7 A;  3BG1 B;  1Q7Y 1;  3H3V J;  3NH4 A;  2VPW A;  1M1K 1;  4QTT A;  1I3Q I;  3CCE Z;  4A3L I;  1Q86 2;  2IZ4 A;  5FLX b;  3S1N I;  2M6N A;  3F3F C;  1VQ7 Z;  4A3E I;  3S2D I;  1VQ7 1;  3NH5 A;  5IT9 b;  3JAM b;  1K73 2;  2OTJ Z;  2RT9 A;  3I56 1;  3H0G I;  4E32 A;  1N8R 1;  2Q4Z A;  1ML8 A;  3CPW Y;  3HOX I;  3GTL I;  2NVY I;  2HU9 A;  1VQP 1;  2K5R A;  2VPY A;  2QLV B;  3CC2 Z;  3P5J B;  3U50 C;  4E2Y A;  1SFO I;  2JIQ A;  3CME Z;  2I3C A;  1ZH1 A;  2JMO A;  2VF1 A;  3CCV Z;  3G6E Z;  3D9X A;  3CME 1;  2LFU A;  1K9M 2;  3CCV 1;  3S15 I;  1VQM 1;  3G6E 1;  4E2X A;  3CCJ Z;  2M48 A;  3IF8 A;  1Z01 A;  2VPX A;  3VMI A;  1M90 1;  3TDH B;  1NJI 2;  3KIH A;  4E30 A;  2PM9 A;  2O53 A;  3GTM I;  3HOU I;  1YUK A;  3I55 Z;  1VQN Z;  2JIO A;  2KI7 B;  3J7A 4;  3GTK I;  3CC4 1;  1NUI A;  5C3E I;  3I55 1;  2E2J I;  1VQN 1;  1W2B Y;  1YHQ 1;  4NH1 C;  1YUA A;  1S72 1;  4NBF A;  4EWC A;  3I07 A;  1Y1W I;  1YIJ Z;  4NBE A;  2R7Z I;  4RV9 A;  3M3Y I;  4X6A I;  3NH8 A;  2H85 A;  3J81 f;  5D1O B;  1N2F A;  3QWU A;  3NDJ A;  1KD1 1;  2NVQ I;  1VQK 1;  1WII A;  5A2Q f;  1Q81 1;  2OTL Z;  3IX0 A;  3GTO I;  2OTL 1;  3S14 I;  4NBA A;  2QR1 B;  3CCR 1;  3CCS Z;  1QVG Y;  1SIW A;  4A3D I;  1JWH C;  2BJO A;  1VQ9 Z;  5C4X I;  2V3V A;  4HH4 A;  3IFU A;  3EED A;  3S1M I;  1QVG Z;  3S17 I;  1VLA A;  3K7A I;  1Y8C A;  3EER A;  2JA5 I;  2E7Z A;  2NAP A;  1VQ5 Z;  3HOZ I;  3CC7 1;  3TE5 B;  2DE7 A;  1WCM I;  1KC8 2;  1VQ5 1;  4QTU A;  2JIR A;  2R92 I;  1YJN 1;  1YJW Z;  2B63 I;  3OW2 Y;  4MXU A;  4HGY A;  1Z02 A;  1TWF I;  2QRC B;  4A3C I;  3CCL Z;  3CQZ I;  3PO2 I;  5C4J I;  3CCL 1;  3M4O I;  1KQS Y;  3IR7 A;  4BY7 I;  3D6W A;  4A3K I;  4A3F I;  3CMA 1;  2O4H A;  3KIF A;  2VPZ A;  1WJ2 A;  3D2L A;  1Q16 A;  1K83 I;  4DQY B;  3LUS A;  1LQL A;  3RZO I;  4NB8 A;  3HOY I;  3I56 Z;  4RS4 A;  5D1P A;  2HF1 A;  2E2H I;  2V8I A;  1VQ4 Z;  5IP9 I;  3NDI A;  1QYP A;  1VQ4 1;  1VQP Z;  3G71 Z;  1QVF Y;  3G4S 1;  1S7M A;  2JA7 I;  2V45 A;  5FLX f;  3G71 1;  4A3G I;  3GTQ I;  3CPW Z;  1R9T I;  2JIP A;  3NFZ A;  3F3P C;  2F4O A;  5IT9 f;  3JAM f;  2OZK A;  1KRL A;  1VQM Z;  4MRI A;  3I4N I;  1P9N A;  1TFI A;  1WW9 A;  5CM2 M;  1ZB8 A;  2GTH A;  1K8A 2;  3HOW I;  1YI2 1;  3GTP I;  1USP B;  1Y1V S;  1RO4 A;  3HKZ A;  4RVH A;  2R93 I;  3CC4 Z;  4MD7 A;  4HGZ A;  1YHQ Z;  3I4M I;  1S72 Z;  1Q7Y 2;  2OOY B;  1M1K 2;  2GTI A;  2Q51 A;  1X3W A;  2VUG A;  4NOZ A;  4BBR I;  2G2K A;  1W2B Z;  4BXX I;  2WB1 A;  1PFT A;  2IV2 X;  1VQK Z;  3CCQ Z;  1TWC I;  3BG0 B;  1VQ6 Z;  1VQ8 1;  1Y1V I;  3CCQ 1;  3J80 b;  1VQL 1;  1VQ6 1;  4E2W A;  3CCR Z;  1N8R 2;  5D1O A;  3CD6 1;  1Q86 1;  1DL6 A;  4NBC A;  2YU9 I;  2JA6 I;  1RO0 A;  2P28 A;  4Y7N I;  2R6M A;  3S1R I;  4TNU A;  4NFR A;  1K73 1;  2QEX Z;  3S1Q I;  3CC7 Z;  4DGL A;  2K3R A;  2NVX I;  2QEX 1;  1ZB9 A;  2GU2 A;  1YJN Z;  2JS4 A;  4A3B I;  3CCM Z;  2Y0S A;  2W03 A;  4XX2 A;  4E31 A;  4Y52 I;  3CCM 1;  1AA6 A;  3S16 I;  3GTJ I;  3OW2 Z;  3ESW A;  1K9M 1;  2VUM I;  4RVD A;  3CMA Z;  4NBH A;  4CL1 A;  1RQF A;  1K8A 1;  4E33 A;  4RVF A;  3FKI I;  2RIQ A;  1KQS Z;  1NJI 1;  1KD1 2;  5C44 I;  4E2Z A;  1TWG I;  4NBB A;  1WZN A;  2F4M A;  4MON A;  4AYB A;  2YAD A;  1Q81 2;  2QRD B;  3T4N B;  2DE6 A;  3G4S Z;  2EGT A;  3CCE 1;  4MD9 A;  4DK1 A;  1FDI A;  1QVF Z;  3GCF A;  1JJ2 Y;  2OTJ 1;  1X0T A;  1FDO A;  1YI2 Z;  3VB9 A;  2WAQ A;  2E9H A;  1JJ2 Z;  3GTM S;  3HOV I;  2AYD A;  4NB9 A;  1I50 I;  2LEX A;  1Q82 2;  3RZD I;  1Z03 A;  2RBL A;  3CC2 1;  1QF8 A;  3PO3 S;  2PMZ A;  1USP A;  4A93 I;  2V8J A;  4A3J I;  2LIY A;  3S2H I;  4RVG A;  2E2I I;  5FLM I;  2JA8 I;  3CXC Y;  1KC8 1;  2P3Y A;  2JIM A;  2RHB A;  1RO2 A; 
#chains in the Genus database with same CATH homology
 2IZ3 A;  3CCJ 1;  2QA4 Z;  3CCU Z;  3CXC Z;  1VQ8 Z;  5LL6 f;  4NBG A;  3J81 b;  1YJ9 Z;  1VQL Z;  2QA4 1;  3CCU 1;  1YJ9 1;  1RLY A;  2ZAE B;  2J6A A;  5A2Q b;  1X3Z A;  3CD6 Z;  3PO3 I;  3MZL B;  1VQO Z;  1YIJ 1;  1VQO 1;  3VTN A;  4S1T A;  1TWH I;  2JUB A;  4NBD A;  3MZK B;  3J80 f;  2DE5 A;  1I6H I;  1YIT Z;  4BBS I;  3VMH A;  3FQQ A;  1YIT 1;  4MD8 A;  2AKL A;  3FQM A;  4A3I I;  2JR6 A;  3MON A;  5AN9 F;  1M90 2;  3CCS 1;  5IP7 I;  2W04 A;  1VQ9 1;  2KPI A;  5T64 A;  5T67 A;  4MH4 A;  3GKQ A;  1RNI A;  5T6B A;  4BY1 I;  2JNY A;  2NVT I;  1NP6 A;  1TWA I;  4A3M I;  2QKD A;  2RPR A;  2V8K A;  3GTG I;  2OOX B;  3VMG A;  1YJW 1;  1Q82 1;  1L1O C;  2QRE B;  3Q87 A;  2PK7 A;  3BG1 B;  1Q7Y 1;  3H3V J;  3NH4 A;  1M1K 1;  4QTT A;  1I3Q I;  3CCE Z;  4A3L I;  1Q86 2;  2IZ4 A;  5FLX b;  3S1N I;  2M6N A;  3F3F C;  1VQ7 Z;  4A3E I;  3S2D I;  1VQ7 1;  3NH5 A;  5IT9 b;  3JAM b;  1K73 2;  2OTJ Z;  2RT9 A;  3I56 1;  3H0G I;  4E32 A;  1N8R 1;  2Q4Z A;  1ML8 A;  3CPW Y;  3HOX I;  3GTL I;  2NVY I;  2HU9 A;  1VQP 1;  2K5R A;  2QLV B;  3CC2 Z;  3P5J B;  3U50 C;  4E2Y A;  1SFO I;  3CME Z;  2I3C A;  1ZH1 A;  2JMO A;  2VF1 A;  3CCV Z;  3G6E Z;  3D9X A;  3CME 1;  2LFU A;  1K9M 2;  3CCV 1;  3S15 I;  1VQM 1;  3G6E 1;  4E2X A;  3CCJ Z;  2M48 A;  3IF8 A;  1Z01 A;  1M90 1;  3VMI A;  3TDH B;  1NJI 2;  3KIH A;  4E30 A;  2PM9 A;  2O53 A;  3GTM I;  3HOU I;  1YUK A;  3I55 Z;  1VQN Z;  3J7A 4;  2KI7 B;  3GTK I;  3CC4 1;  1NUI A;  5C3E I;  3I55 1;  2E2J I;  1VQN 1;  1W2B Y;  1YHQ 1;  4NH1 C;  1YUA A;  1S72 1;  4NBF A;  4EWC A;  3I07 A;  1Y1W I;  1YIJ Z;  4NBE A;  2R7Z I;  4RV9 A;  3M3Y I;  4X6A I;  3NH8 A;  2H85 A;  3J81 f;  5D1O B;  1N2F A;  3QWU A;  3NDJ A;  1KD1 1;  2NVQ I;  1VQK 1;  1WII A;  5A2Q f;  1Q81 1;  2OTL Z;  3IX0 A;  3GTO I;  2OTL 1;  3S14 I;  4NBA A;  2QR1 B;  3CCR 1;  3CCS Z;  1QVG Y;  4A3D I;  1JWH C;  2BJO A;  1VQ9 Z;  5C4X I;  4HH4 A;  3IFU A;  3EED A;  3S1M I;  1QVG Z;  3S17 I;  1VLA A;  3K7A I;  3EER A;  2JA5 I;  1VQ5 Z;  3HOZ I;  3CC7 1;  3TE5 B;  2DE7 A;  1WCM I;  1KC8 2;  1VQ5 1;  4QTU A;  2R92 I;  1YJN 1;  1YJW Z;  2B63 I;  3OW2 Y;  4MXU A;  4HGY A;  1Z02 A;  1TWF I;  2QRC B;  4A3C I;  3CCL Z;  3CQZ I;  3PO2 I;  5C4J I;  3CCL 1;  3M4O I;  1KQS Y;  4BY7 I;  3D6W A;  4A3K I;  4A3F I;  3CMA 1;  2O4H A;  3KIF A;  1K83 I;  4DQY B;  3LUS A;  1LQL A;  3RZO I;  4NB8 A;  3HOY I;  3I56 Z;  4RS4 A;  5D1P A;  2HF1 A;  2E2H I;  2V8I A;  1VQ4 Z;  5IP9 I;  3NDI A;  1QYP A;  1VQ4 1;  1VQP Z;  3G71 Z;  1QVF Y;  3G4S 1;  1S7M A;  2JA7 I;  5FLX f;  3G71 1;  4A3G I;  3GTQ I;  3CPW Z;  1R9T I;  3NFZ A;  3F3P C;  2F4O A;  5IT9 f;  3JAM f;  2OZK A;  1KRL A;  1VQM Z;  4MRI A;  3I4N I;  1P9N A;  1TFI A;  1WW9 A;  5CM2 M;  1ZB8 A;  2GTH A;  1K8A 2;  3HOW I;  1YI2 1;  3GTP I;  1USP B;  1Y1V S;  1RO4 A;  3HKZ A;  4RVH A;  2R93 I;  3CC4 Z;  4MD7 A;  4HGZ A;  1YHQ Z;  3I4M I;  1S72 Z;  1Q7Y 2;  2OOY B;  1M1K 2;  2GTI A;  2Q51 A;  1X3W A;  2VUG A;  4NOZ A;  4BBR I;  2G2K A;  1W2B Z;  4BXX I;  2WB1 A;  1PFT A;  1VQK Z;  3CCQ Z;  1TWC I;  3BG0 B;  1VQ6 Z;  1VQ8 1;  1Y1V I;  3CCQ 1;  3J80 b;  1VQL 1;  1VQ6 1;  4E2W A;  3CCR Z;  1N8R 2;  5D1O A;  3CD6 1;  1Q86 1;  1DL6 A;  4NBC A;  2YU9 I;  2JA6 I;  1RO0 A;  2P28 A;  4Y7N I;  2R6M A;  3S1R I;  4TNU A;  4NFR A;  1K73 1;  2QEX Z;  3S1Q I;  3CC7 Z;  4DGL A;  2K3R A;  2NVX I;  2QEX 1;  1ZB9 A;  2GU2 A;  1YJN Z;  2JS4 A;  4A3B I;  3CCM Z;  2Y0S A;  2W03 A;  4XX2 A;  4E31 A;  4Y52 I;  3CCM 1;  3S16 I;  3GTJ I;  3OW2 Z;  3ESW A;  1K9M 1;  2VUM I;  4RVD A;  3CMA Z;  4NBH A;  4CL1 A;  1RQF A;  1K8A 1;  4E33 A;  4RVF A;  3FKI I;  2RIQ A;  1KQS Z;  1NJI 1;  1KD1 2;  5C44 I;  4E2Z A;  1TWG I;  4NBB A;  2F4M A;  4MON A;  4AYB A;  2YAD A;  1Q81 2;  2QRD B;  3T4N B;  2DE6 A;  3G4S Z;  2EGT A;  3CCE 1;  4MD9 A;  4DK1 A;  1QVF Z;  3GCF A;  1JJ2 Y;  2OTJ 1;  1X0T A;  1YI2 Z;  3VB9 A;  2WAQ A;  2E9H A;  1JJ2 Z;  3GTM S;  3HOV I;  4NB9 A;  1I50 I;  1Q82 2;  3RZD I;  1Z03 A;  2RBL A;  3CC2 1;  1QF8 A;  3PO3 S;  2PMZ A;  1USP A;  4A93 I;  2V8J A;  4A3J I;  2LIY A;  3S2H I;  4RVG A;  2E2I I;  5FLM I;  2JA8 I;  3CXC Y;  1KC8 1;  2P3Y A;  2RHB A;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...