3EEDA

Crystal structure of human protein kinase ck2 regulatory subunit (ck2beta; mutant 1-193)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
183
Chain Sequence
EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit beta
publication title The interaction of CK2{alpha} and CK2{beta}, the subunits of protein kinase CK2, requires CK2{beta} in a preformed conformation and is enthalpically driven
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 54
structure length 183
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01214 CK_II_beta Casein kinase II regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1820.10 Mainly Alpha Orthogonal Bundle protein kinase ck2 holoenzyme, chain C, domain 1 protein kinase ck2 holoenzyme, chain C, domain 1 3eedA01
2.20.25.20 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3eedA02
4NH1C 2R6MA 2M48A 2RT9A 2JMOA 4DGLA 1JWHC 1RQFA 1QF8A 3EEDA 4MD7A 4MD8A 2M6NA 4MD9A
chains in the Genus database with same CATH superfamily
3F3FC 1YHQZ 2R92I 3CXCY 1VQL1 1Q821 2H85A 1N8R1 1I3QI 1N2FA 2M6NA 1K9M1 2E2JI 4NBGA 3CC21 4HH4A 2QR1B 3VMIA 1VQMZ 1Z01A 1X0TA 2JS4A 1TWAI 3CQZI 3FKII 4BY7I 2JA6I 3RZDI 3CPWY 2OOXB 4E2ZA 3HKZA 3GTQI 1K83I 2JMOA 4E2XA 3PO2I 1KQSZ 4NB8A 2GTIA 1RO2A 3GTJI 3J81b 2QREB 4RVFA 4TNUA 3VB9A 2E2HI 2R7ZI 4NBFA 2OTLZ 1W2BZ 3CME1 1VQ9Z 3TE5B 2JA8I 2OOYB 5T67A 2O53A 2G2KA 3J81f 1VQPZ 1Q811 3T4NB 5FLMI 2Q51A 4A3JI 3G71Z 1SIWA 3FQMA 1S7MA 2VUMI 3D6WA 5D1OA 1Q862 2V8KA 3VMGA 1K732 1NP6A 2V8JA 3FQQA 4NFRA 3NH5A 4MD9A 3CC71 1YUAA 1VQ7Z 1R9TI 3PO3S 1TWCI 1VQ8Z 2QEX1 2LIYA 2E2II 3I56Z 1SFOI 3CCJZ 4A3GI 2DE7A 1LQLA 3CCR1 1VQOZ 2RBLA 2PMZA 2PK7A 4RVHA 2JA7I 4A3EI 4E31A 3CD6Z 2J6AA 1WIIA 2NVTI 3CCJ1 3OW2Z 5IT9b 3TDHB 3CCU1 2JIPA 1VQO1 2F4MA 4A3LI 1KD11 2LFUA 3MONA 3VMHA 3IFUA 2ZAEB 2W03A 1Y1WI 4E2WA 2JIOA 4DQYB 3EEDA 3I4NI 2IZ4A 3GTMI 2O4HA 3CCL1 5IT9f 3NDIA 2QLVB 4Y7NI 1VQLZ 2JIQA 4MONA 3ESWA 1VQ51 3I551 3NH4A 2V8IA 3KIFA 1YJ91 3KIHA 3CCVZ 3S1RI 3CC2Z 2VPZA 1I50I 3GTGI 1ZH1A 1QYPA 2OTJ1 1Y1VS 1WW9A 4NBEA 1ZB9A 2B63I 4A93I 1QVFZ 3CCV1 1YIT1 1RO0A 3EERA 1S721 3GTLI 2BJOA 1X3ZA 1P9NA 1Z02A 3CCM1 3U50C 1KC82 2JR6A 4XX2A 3H3VJ 1RLYA 3IR7A 3CXCZ 2DE6A 2RT9A 2V3VA 1Q7Y2 1RQFA 3CMEZ 1TFIA 2E7ZA 3S14I 1Z03A 3HOVI 4DGLA 4E33A 2Y0SA 1QVGY 1K8A2 3QWUA 2NVXI 3G4S1 2QA41 2F4OA 1YIJ1 1VQ41 3NFZA 1USPA 4E32A 3CPWZ 2VUGA 3G6E1 2QRCB 3CC7Z 1JJ2Y 3RZOI 2E9HA 1YI21 5A2Qb 2W04A 4NBAA 5T6BA 2QEXZ 3CCQ1 5IP7I 3CCRZ 3CCE1 2PM9A 1Q16A 5AN9F 4NBBA 4A3FI 5A2Qf 3S2HI 1VQN1 2DE5A 3CCUZ 3I4MI 1QXFA 2HF1A 3HOXI 4NBHA 2I3CA 3H0GI 1M1K1 2LEXA 2KPIA 1KRLA 3CCLZ 2VPWA 3D2LA 1NJI1 3PO3I 3GKQA 3NH8A 3Q87A 1PFTA 1Q822 1VQ5Z 3I55Z 1VQK1 1TWFI 1N8R2 4A3CI 1K9M2 4A3KI 1YJ9Z 1FDIA 2VF1A 3GTMS 1M901 2K3RA 3CMA1 2OTJZ 4HGYA 2R93I 3CCS1 1K731 2EGTA 1RO4A 1YJN1 4BY1I 4HGZA 1YITZ 1ZB8A 2JIRA 3HOUI 5C3EI 1S72Z 1NUIA 4RVGA 3CCMZ 5C44I 4BXXI 2JIMA 4AYBA 3CC41 1WZNA 2VPYA 3LUSA 4NOZA 2P3YA 5IP9I 3J80f 2QRDB 1L1OC 3S1NI 1TWGI 5FLXf 2OZKA 4E2YA 4MH4A 2NVYI 2AYDA 2R6MA 1DL6A 4QTTA 5D1OB 4MXUA 1Y1VI 1ML8A 1WJ2A 5CM2M 1KQSY 3NDJA 1Q812 1YHQ1 2GTHA 3G4SZ 3IX0A 2QA4Z 3HOYI 4QTUA 1YIJZ 1VQ4Z 3D9XA 3HOZI 1W2BY 4NBDA 2K5RA 4BBRI 3G6EZ 2YADA 1VQM1 4A3BI 1YI2Z 4NH1C 2VPXA 3S15I 4NBCA 3JAMb 4EWCA 3MZKB 2QKDA 4A3II 3CCQZ 1WCMI 2IZ3A 3CCEZ 1YUKA 1AA6A 2JUBA 2M48A 3S17I 2V45A 4NB9A 4MD7A 5LL6f 1VQNZ 1VLAA 1M1K2 1KC81 3M3YI 3JAMf 1RNIA 5D1PA 1QVGZ 1NJI2 3GTOI 4CL1A 2NVQI 3IF8A 1KD12 3VTNA 5T64A 4DK1A 1Q7Y1 1JWHC 4RVDA 1M902 2OTL1 3MZLB 1VQ91 2RPRA 4A3MI 3S1MI 1JJ2Z 2WB1A 3OW2Y 1FDOA 4X6AI 2HU9A 1K8A1 1VQKZ 1VQ6Z 1VQP1 2RHBA 3S2DI 2NAPA 2KI7B 3G711 2JA5I 3CMAZ 5C4XI 2IV2X 1QF8A 3CCSZ 3BG0B 3GCFA 1VQ61 3HOWI 4RS4A 1YJNZ 4E30A 3M4OI 5C4JI 1I6HI 1Y8CA 1VQ71 1VQ81 3I07A 1Q861 2Q4ZA 1YJWZ 3I561 2YU9I 2RIQA 3K7AI 2WAQA 4S1TA 2JNYA 3J7A4 3CC4Z 4Y52I 2GU2A 3GTPI 1X3WA 3S16I 4MD8A 3J80b 3F3PC 4BBSI 3S1QI 3CD61 3BG1B 1QVFY 5FLXb 2AKLA 1YJW1 4A3DI 4RV9A 1TWHI 3P5JB 2P28A 3GTKI 4MRIA 1USPB
chains in the Genus database with same CATH topology
3F3FC 1YHQZ 2R92I 3CXCY 1VQL1 1Q821 2H85A 1N8R1 1I3QI 1N2FA 2M6NA 1K9M1 2E2JI 4NBGA 3CC21 4HH4A 2QR1B 3VMIA 1VQMZ 1Z01A 1X0TA 2JS4A 1TWAI 3CQZI 3FKII 4BY7I 2JA6I 3RZDI 3CPWY 2OOXB 4E2ZA 3HKZA 3GTQI 1K83I 2JMOA 4E2XA 3PO2I 1KQSZ 4NB8A 2GTIA 1RO2A 3GTJI 3J81b 2QREB 4RVFA 4TNUA 3VB9A 2E2HI 2R7ZI 4NBFA 2OTLZ 1W2BZ 3CME1 1VQ9Z 3TE5B 2JA8I 2OOYB 5T67A 2O53A 2G2KA 3J81f 1VQPZ 1Q811 3T4NB 5FLMI 2Q51A 4A3JI 3G71Z 3FQMA 1S7MA 2VUMI 3D6WA 5D1OA 1Q862 2V8KA 3VMGA 1K732 1NP6A 2V8JA 3FQQA 4NFRA 3NH5A 4MD9A 3CC71 1YUAA 1VQ7Z 1R9TI 3PO3S 1TWCI 1VQ8Z 2QEX1 2LIYA 2E2II 3I56Z 1SFOI 3CCJZ 4A3GI 2DE7A 1LQLA 3CCR1 1VQOZ 2RBLA 2PMZA 2PK7A 4RVHA 2JA7I 4A3EI 4E31A 3CD6Z 2J6AA 1WIIA 2NVTI 3CCJ1 3OW2Z 5IT9b 3TDHB 3CCU1 1VQO1 2F4MA 4A3LI 1KD11 2LFUA 3MONA 3VMHA 3IFUA 2ZAEB 2W03A 1Y1WI 4E2WA 4DQYB 3EEDA 3I4NI 2IZ4A 3GTMI 2O4HA 3CCL1 5IT9f 3NDIA 2QLVB 4Y7NI 1VQLZ 4MONA 3ESWA 1VQ51 3I551 3NH4A 2V8IA 3KIFA 1YJ91 3KIHA 3CCVZ 3S1RI 3CC2Z 1I50I 3GTGI 1ZH1A 1QYPA 2OTJ1 1Y1VS 1WW9A 4NBEA 1ZB9A 2B63I 4A93I 1QVFZ 3CCV1 1YIT1 1RO0A 3EERA 1S721 3GTLI 2BJOA 1X3ZA 1P9NA 1Z02A 3CCM1 3U50C 1KC82 2JR6A 4XX2A 3H3VJ 1RLYA 3CXCZ 2DE6A 2RT9A 1Q7Y2 1RQFA 3CMEZ 1TFIA 3S14I 1Z03A 3HOVI 4DGLA 4E33A 2Y0SA 1QVGY 1K8A2 3QWUA 2NVXI 3G4S1 2QA41 2F4OA 1YIJ1 1VQ41 3NFZA 1USPA 4E32A 3CPWZ 2VUGA 3G6E1 2QRCB 3CC7Z 1JJ2Y 3RZOI 2E9HA 1YI21 5A2Qb 2W04A 4NBAA 5T6BA 2QEXZ 3CCQ1 5IP7I 3CCRZ 3CCE1 2PM9A 5AN9F 4NBBA 4A3FI 5A2Qf 3S2HI 1VQN1 2DE5A 3CCUZ 3I4MI 2HF1A 3HOXI 4NBHA 2I3CA 3H0GI 1M1K1 2KPIA 1KRLA 3CCLZ 1NJI1 3PO3I 3GKQA 3NH8A 3Q87A 1PFTA 1Q822 1VQ5Z 3I55Z 1VQK1 1TWFI 1N8R2 4A3CI 1K9M2 4A3KI 1YJ9Z 2VF1A 3GTMS 1M901 2K3RA 3CMA1 2OTJZ 4HGYA 2R93I 3CCS1 1K731 2EGTA 1RO4A 1YJN1 4BY1I 4HGZA 1YITZ 1ZB8A 3HOUI 5C3EI 1S72Z 1NUIA 4RVGA 3CCMZ 5C44I 4BXXI 4AYBA 3CC41 3LUSA 4NOZA 2P3YA 5IP9I 3J80f 2QRDB 1L1OC 3S1NI 1TWGI 5FLXf 2OZKA 4E2YA 4MH4A 2NVYI 2R6MA 1DL6A 4QTTA 5D1OB 4MXUA 1Y1VI 1ML8A 5CM2M 1KQSY 3NDJA 1Q812 1YHQ1 2GTHA 3G4SZ 3IX0A 2QA4Z 3HOYI 4QTUA 1YIJZ 1VQ4Z 3D9XA 3HOZI 1W2BY 4NBDA 2K5RA 4BBRI 3G6EZ 2YADA 1VQM1 4A3BI 1YI2Z 4NH1C 3S15I 4NBCA 3JAMb 4EWCA 3MZKB 2QKDA 4A3II 3CCQZ 1WCMI 2IZ3A 3CCEZ 1YUKA 2JUBA 2M48A 3S17I 4NB9A 4MD7A 5LL6f 1VQNZ 1VLAA 1M1K2 1KC81 3M3YI 3JAMf 1RNIA 5D1PA 1QVGZ 1NJI2 3GTOI 4CL1A 2NVQI 3IF8A 1KD12 3VTNA 5T64A 4DK1A 1Q7Y1 1JWHC 4RVDA 1M902 2OTL1 3MZLB 1VQ91 2RPRA 4A3MI 3S1MI 1JJ2Z 2WB1A 3OW2Y 4X6AI 2HU9A 1K8A1 1VQKZ 1VQ6Z 1VQP1 2RHBA 3S2DI 2KI7B 3G711 2JA5I 3CMAZ 5C4XI 1QF8A 3CCSZ 3BG0B 3GCFA 1VQ61 3HOWI 4RS4A 1YJNZ 4E30A 3M4OI 5C4JI 1I6HI 1VQ71 1VQ81 3I07A 1Q861 2Q4ZA 1YJWZ 3I561 2YU9I 2RIQA 3K7AI 2WAQA 4S1TA 2JNYA 3J7A4 3CC4Z 4Y52I 2GU2A 3GTPI 1X3WA 3S16I 4MD8A 3J80b 3F3PC 4BBSI 3S1QI 3CD61 3BG1B 1QVFY 5FLXb 2AKLA 1YJW1 4A3DI 4RV9A 1TWHI 3P5JB 2P28A 3GTKI 4MRIA 1USPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NH1 C;  2R6M A;  2M48 A;  2RT9 A;  2JMO A;  4DGL A;  1JWH C;  1RQF A;  1QF8 A;  3EED A;  4MD7 A;  4MD8 A;  2M6N A;  4MD9 A; 
#chains in the Genus database with same CATH topology
 3F3F C;  1YHQ Z;  2R92 I;  3CXC Y;  1VQL 1;  1Q82 1;  2H85 A;  1N8R 1;  1I3Q I;  1N2F A;  2M6N A;  1K9M 1;  2E2J I;  4NBG A;  3CC2 1;  4HH4 A;  2QR1 B;  3VMI A;  1VQM Z;  1Z01 A;  1X0T A;  2JS4 A;  1TWA I;  3CQZ I;  3FKI I;  4BY7 I;  2JA6 I;  3RZD I;  3CPW Y;  2OOX B;  4E2Z A;  3HKZ A;  3GTQ I;  1K83 I;  2JMO A;  4E2X A;  3PO2 I;  1KQS Z;  4NB8 A;  2GTI A;  1RO2 A;  3GTJ I;  3J81 b;  2QRE B;  4RVF A;  4TNU A;  3VB9 A;  2E2H I;  2R7Z I;  4NBF A;  2OTL Z;  1W2B Z;  3CME 1;  1VQ9 Z;  3TE5 B;  2JA8 I;  2OOY B;  5T67 A;  2O53 A;  2G2K A;  3J81 f;  1VQP Z;  1Q81 1;  3T4N B;  5FLM I;  2Q51 A;  4A3J I;  3G71 Z;  1SIW A;  3FQM A;  1S7M A;  2VUM I;  3D6W A;  5D1O A;  1Q86 2;  2V8K A;  3VMG A;  1K73 2;  1NP6 A;  2V8J A;  3FQQ A;  4NFR A;  3NH5 A;  4MD9 A;  3CC7 1;  1YUA A;  1VQ7 Z;  1R9T I;  3PO3 S;  1TWC I;  1VQ8 Z;  2QEX 1;  2LIY A;  2E2I I;  3I56 Z;  1SFO I;  3CCJ Z;  4A3G I;  2DE7 A;  1LQL A;  3CCR 1;  1VQO Z;  2RBL A;  2PMZ A;  2PK7 A;  4RVH A;  2JA7 I;  4A3E I;  4E31 A;  3CD6 Z;  2J6A A;  1WII A;  2NVT I;  3CCJ 1;  3OW2 Z;  5IT9 b;  3TDH B;  3CCU 1;  2JIP A;  1VQO 1;  2F4M A;  4A3L I;  1KD1 1;  2LFU A;  3MON A;  3VMH A;  3IFU A;  2ZAE B;  2W03 A;  1Y1W I;  4E2W A;  2JIO A;  4DQY B;  3EED A;  3I4N I;  2IZ4 A;  3GTM I;  2O4H A;  3CCL 1;  5IT9 f;  3NDI A;  2QLV B;  4Y7N I;  1VQL Z;  2JIQ A;  4MON A;  3ESW A;  1VQ5 1;  3I55 1;  3NH4 A;  2V8I A;  3KIF A;  1YJ9 1;  3KIH A;  3CCV Z;  3S1R I;  3CC2 Z;  2VPZ A;  1I50 I;  3GTG I;  1ZH1 A;  1QYP A;  2OTJ 1;  1Y1V S;  1WW9 A;  4NBE A;  1ZB9 A;  2B63 I;  4A93 I;  1QVF Z;  3CCV 1;  1YIT 1;  1RO0 A;  3EER A;  1S72 1;  3GTL I;  2BJO A;  1X3Z A;  1P9N A;  1Z02 A;  3CCM 1;  3U50 C;  1KC8 2;  2JR6 A;  4XX2 A;  3H3V J;  1RLY A;  3IR7 A;  3CXC Z;  2DE6 A;  2RT9 A;  2V3V A;  1Q7Y 2;  1RQF A;  3CME Z;  1TFI A;  2E7Z A;  3S14 I;  1Z03 A;  3HOV I;  4DGL A;  4E33 A;  2Y0S A;  1QVG Y;  1K8A 2;  3QWU A;  2NVX I;  3G4S 1;  2QA4 1;  2F4O A;  1YIJ 1;  1VQ4 1;  3NFZ A;  1USP A;  4E32 A;  3CPW Z;  2VUG A;  3G6E 1;  2QRC B;  3CC7 Z;  1JJ2 Y;  3RZO I;  2E9H A;  1YI2 1;  5A2Q b;  2W04 A;  4NBA A;  5T6B A;  2QEX Z;  3CCQ 1;  5IP7 I;  3CCR Z;  3CCE 1;  2PM9 A;  1Q16 A;  5AN9 F;  4NBB A;  4A3F I;  5A2Q f;  3S2H I;  1VQN 1;  2DE5 A;  3CCU Z;  3I4M I;  1QXF A;  2HF1 A;  3HOX I;  4NBH A;  2I3C A;  3H0G I;  1M1K 1;  2LEX A;  2KPI A;  1KRL A;  3CCL Z;  2VPW A;  3D2L A;  1NJI 1;  3PO3 I;  3GKQ A;  3NH8 A;  3Q87 A;  1PFT A;  1Q82 2;  1VQ5 Z;  3I55 Z;  1VQK 1;  1TWF I;  1N8R 2;  4A3C I;  1K9M 2;  4A3K I;  1YJ9 Z;  1FDI A;  2VF1 A;  3GTM S;  1M90 1;  2K3R A;  3CMA 1;  2OTJ Z;  4HGY A;  2R93 I;  3CCS 1;  1K73 1;  2EGT A;  1RO4 A;  1YJN 1;  4BY1 I;  4HGZ A;  1YIT Z;  1ZB8 A;  2JIR A;  3HOU I;  5C3E I;  1S72 Z;  1NUI A;  4RVG A;  3CCM Z;  5C44 I;  4BXX I;  2JIM A;  4AYB A;  3CC4 1;  1WZN A;  2VPY A;  3LUS A;  4NOZ A;  2P3Y A;  5IP9 I;  3J80 f;  2QRD B;  1L1O C;  3S1N I;  1TWG I;  5FLX f;  2OZK A;  4E2Y A;  4MH4 A;  2NVY I;  2AYD A;  2R6M A;  1DL6 A;  4QTT A;  5D1O B;  4MXU A;  1Y1V I;  1ML8 A;  1WJ2 A;  5CM2 M;  1KQS Y;  3NDJ A;  1Q81 2;  1YHQ 1;  2GTH A;  3G4S Z;  3IX0 A;  2QA4 Z;  3HOY I;  4QTU A;  1YIJ Z;  1VQ4 Z;  3D9X A;  3HOZ I;  1W2B Y;  4NBD A;  2K5R A;  4BBR I;  3G6E Z;  2YAD A;  1VQM 1;  4A3B I;  1YI2 Z;  4NH1 C;  2VPX A;  3S15 I;  4NBC A;  3JAM b;  4EWC A;  3MZK B;  2QKD A;  4A3I I;  3CCQ Z;  1WCM I;  2IZ3 A;  3CCE Z;  1YUK A;  1AA6 A;  2JUB A;  2M48 A;  3S17 I;  2V45 A;  4NB9 A;  4MD7 A;  5LL6 f;  1VQN Z;  1VLA A;  1M1K 2;  1KC8 1;  3M3Y I;  3JAM f;  1RNI A;  5D1P A;  1QVG Z;  1NJI 2;  3GTO I;  4CL1 A;  2NVQ I;  3IF8 A;  1KD1 2;  3VTN A;  5T64 A;  4DK1 A;  1Q7Y 1;  1JWH C;  4RVD A;  1M90 2;  2OTL 1;  3MZL B;  1VQ9 1;  2RPR A;  4A3M I;  3S1M I;  1JJ2 Z;  2WB1 A;  3OW2 Y;  1FDO A;  4X6A I;  2HU9 A;  1K8A 1;  1VQK Z;  1VQ6 Z;  1VQP 1;  2RHB A;  3S2D I;  2NAP A;  2KI7 B;  3G71 1;  2JA5 I;  3CMA Z;  5C4X I;  2IV2 X;  1QF8 A;  3CCS Z;  3BG0 B;  3GCF A;  1VQ6 1;  3HOW I;  4RS4 A;  1YJN Z;  4E30 A;  3M4O I;  5C4J I;  1I6H I;  1Y8C A;  1VQ7 1;  1VQ8 1;  3I07 A;  1Q86 1;  2Q4Z A;  1YJW Z;  3I56 1;  2YU9 I;  2RIQ A;  3K7A I;  2WAQ A;  4S1T A;  2JNY A;  3J7A 4;  3CC4 Z;  4Y52 I;  2GU2 A;  3GTP I;  1X3W A;  3S16 I;  4MD8 A;  3J80 b;  3F3P C;  4BBS I;  3S1Q I;  3CD6 1;  3BG1 B;  1QVF Y;  5FLX b;  2AKL A;  1YJW 1;  4A3D I;  4RV9 A;  1TWH I;  3P5J B;  2P28 A;  3GTK I;  4MRI A;  1USP B; 
#chains in the Genus database with same CATH homology
 3F3F C;  1YHQ Z;  2R92 I;  3CXC Y;  1VQL 1;  1Q82 1;  2H85 A;  1N8R 1;  1I3Q I;  1N2F A;  2M6N A;  1K9M 1;  2E2J I;  4NBG A;  3CC2 1;  4HH4 A;  2QR1 B;  3VMI A;  1VQM Z;  1Z01 A;  1X0T A;  2JS4 A;  1TWA I;  3CQZ I;  3FKI I;  4BY7 I;  2JA6 I;  3RZD I;  3CPW Y;  2OOX B;  4E2Z A;  3HKZ A;  3GTQ I;  1K83 I;  2JMO A;  4E2X A;  3PO2 I;  1KQS Z;  4NB8 A;  2GTI A;  1RO2 A;  3GTJ I;  3J81 b;  2QRE B;  4RVF A;  4TNU A;  3VB9 A;  2E2H I;  2R7Z I;  4NBF A;  2OTL Z;  1W2B Z;  3CME 1;  1VQ9 Z;  3TE5 B;  2JA8 I;  2OOY B;  5T67 A;  2O53 A;  2G2K A;  3J81 f;  1VQP Z;  1Q81 1;  3T4N B;  5FLM I;  2Q51 A;  4A3J I;  3G71 Z;  3FQM A;  1S7M A;  2VUM I;  3D6W A;  5D1O A;  1Q86 2;  2V8K A;  3VMG A;  1K73 2;  1NP6 A;  2V8J A;  3FQQ A;  4NFR A;  3NH5 A;  4MD9 A;  3CC7 1;  1YUA A;  1VQ7 Z;  1R9T I;  3PO3 S;  1TWC I;  1VQ8 Z;  2QEX 1;  2LIY A;  2E2I I;  3I56 Z;  1SFO I;  3CCJ Z;  4A3G I;  2DE7 A;  1LQL A;  3CCR 1;  1VQO Z;  2RBL A;  2PMZ A;  2PK7 A;  4RVH A;  2JA7 I;  4A3E I;  4E31 A;  3CD6 Z;  2J6A A;  1WII A;  2NVT I;  3CCJ 1;  3OW2 Z;  5IT9 b;  3TDH B;  3CCU 1;  1VQO 1;  2F4M A;  4A3L I;  1KD1 1;  2LFU A;  3MON A;  3VMH A;  3IFU A;  2ZAE B;  2W03 A;  1Y1W I;  4E2W A;  4DQY B;  3EED A;  3I4N I;  2IZ4 A;  3GTM I;  2O4H A;  3CCL 1;  5IT9 f;  3NDI A;  2QLV B;  4Y7N I;  1VQL Z;  4MON A;  3ESW A;  1VQ5 1;  3I55 1;  3NH4 A;  2V8I A;  3KIF A;  1YJ9 1;  3KIH A;  3CCV Z;  3S1R I;  3CC2 Z;  1I50 I;  3GTG I;  1ZH1 A;  1QYP A;  2OTJ 1;  1Y1V S;  1WW9 A;  4NBE A;  1ZB9 A;  2B63 I;  4A93 I;  1QVF Z;  3CCV 1;  1YIT 1;  1RO0 A;  3EER A;  1S72 1;  3GTL I;  2BJO A;  1X3Z A;  1P9N A;  1Z02 A;  3CCM 1;  3U50 C;  1KC8 2;  2JR6 A;  4XX2 A;  3H3V J;  1RLY A;  3CXC Z;  2DE6 A;  2RT9 A;  1Q7Y 2;  1RQF A;  3CME Z;  1TFI A;  3S14 I;  1Z03 A;  3HOV I;  4DGL A;  4E33 A;  2Y0S A;  1QVG Y;  1K8A 2;  3QWU A;  2NVX I;  3G4S 1;  2QA4 1;  2F4O A;  1YIJ 1;  1VQ4 1;  3NFZ A;  1USP A;  4E32 A;  3CPW Z;  2VUG A;  3G6E 1;  2QRC B;  3CC7 Z;  1JJ2 Y;  3RZO I;  2E9H A;  1YI2 1;  5A2Q b;  2W04 A;  4NBA A;  5T6B A;  2QEX Z;  3CCQ 1;  5IP7 I;  3CCR Z;  3CCE 1;  2PM9 A;  5AN9 F;  4NBB A;  4A3F I;  5A2Q f;  3S2H I;  1VQN 1;  2DE5 A;  3CCU Z;  3I4M I;  2HF1 A;  3HOX I;  4NBH A;  2I3C A;  3H0G I;  1M1K 1;  2KPI A;  1KRL A;  3CCL Z;  1NJI 1;  3PO3 I;  3GKQ A;  3NH8 A;  3Q87 A;  1PFT A;  1Q82 2;  1VQ5 Z;  3I55 Z;  1VQK 1;  1TWF I;  1N8R 2;  4A3C I;  1K9M 2;  4A3K I;  1YJ9 Z;  2VF1 A;  3GTM S;  1M90 1;  2K3R A;  3CMA 1;  2OTJ Z;  4HGY A;  2R93 I;  3CCS 1;  1K73 1;  2EGT A;  1RO4 A;  1YJN 1;  4BY1 I;  4HGZ A;  1YIT Z;  1ZB8 A;  3HOU I;  5C3E I;  1S72 Z;  1NUI A;  4RVG A;  3CCM Z;  5C44 I;  4BXX I;  4AYB A;  3CC4 1;  3LUS A;  4NOZ A;  2P3Y A;  5IP9 I;  3J80 f;  2QRD B;  1L1O C;  3S1N I;  1TWG I;  5FLX f;  2OZK A;  4E2Y A;  4MH4 A;  2NVY I;  2R6M A;  1DL6 A;  4QTT A;  5D1O B;  4MXU A;  1Y1V I;  1ML8 A;  5CM2 M;  1KQS Y;  3NDJ A;  1Q81 2;  1YHQ 1;  2GTH A;  3G4S Z;  3IX0 A;  2QA4 Z;  3HOY I;  4QTU A;  1YIJ Z;  1VQ4 Z;  3D9X A;  3HOZ I;  1W2B Y;  4NBD A;  2K5R A;  4BBR I;  3G6E Z;  2YAD A;  1VQM 1;  4A3B I;  1YI2 Z;  4NH1 C;  3S15 I;  4NBC A;  3JAM b;  4EWC A;  3MZK B;  2QKD A;  4A3I I;  3CCQ Z;  1WCM I;  2IZ3 A;  3CCE Z;  1YUK A;  2JUB A;  2M48 A;  3S17 I;  4NB9 A;  4MD7 A;  5LL6 f;  1VQN Z;  1VLA A;  1M1K 2;  1KC8 1;  3M3Y I;  3JAM f;  1RNI A;  5D1P A;  1QVG Z;  1NJI 2;  3GTO I;  4CL1 A;  2NVQ I;  3IF8 A;  1KD1 2;  3VTN A;  5T64 A;  4DK1 A;  1Q7Y 1;  1JWH C;  4RVD A;  1M90 2;  2OTL 1;  3MZL B;  1VQ9 1;  2RPR A;  4A3M I;  3S1M I;  1JJ2 Z;  2WB1 A;  3OW2 Y;  4X6A I;  2HU9 A;  1K8A 1;  1VQK Z;  1VQ6 Z;  1VQP 1;  2RHB A;  3S2D I;  2KI7 B;  3G71 1;  2JA5 I;  3CMA Z;  5C4X I;  1QF8 A;  3CCS Z;  3BG0 B;  3GCF A;  1VQ6 1;  3HOW I;  4RS4 A;  1YJN Z;  4E30 A;  3M4O I;  5C4J I;  1I6H I;  1VQ7 1;  1VQ8 1;  3I07 A;  1Q86 1;  2Q4Z A;  1YJW Z;  3I56 1;  2YU9 I;  2RIQ A;  3K7A I;  2WAQ A;  4S1T A;  2JNY A;  3J7A 4;  3CC4 Z;  4Y52 I;  2GU2 A;  3GTP I;  1X3W A;  3S16 I;  4MD8 A;  3J80 b;  3F3P C;  4BBS I;  3S1Q I;  3CD6 1;  3BG1 B;  1QVF Y;  5FLX b;  2AKL A;  1YJW 1;  4A3D I;  4RV9 A;  1TWH I;  3P5J B;  2P28 A;  3GTK I;  4MRI A;  1USP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...