4A3CI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3cI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3cI02
2PK7A 1Y1VI 4A3JI 1WW9A 4A3MI 3S2HI 1NUIA 3VMIA 4X6AI 1TWFI 4BY1I 2JA8I 4XX2A 3GTQI 2VUMI 3K7AI 3U50C 3GTMS 1PFTA 2E2II 2HF1A 2B63I 1L1OC 5IP7I 3I4MI 1TWCI 4BXXI 2R92I 1N2FA 4NBAA 4A3CI 3GTJI 2K5RA 1ZB9A 3RZDI 4NBEA 3S1NI 2J6AA 4Y7NI 4BY7I 2DE6A 3LUSA 2DE7A 3M4OI 2P3YA 3PO2I 3PO3I 2YU9I 1LQLA 4BBRI 1VLAA 3D6WA 3EERA 5C3EI 1Y1VS 2E2HI 1SFOI 2JA6I 4QTUA 2NVQI 5C4XI 3VMHA 1I50I 3H3VJ 3S16I 3S17I 1YUAA 3HOVI 3S2DI 1ML8A 3VB9A 2JNYA 3GCFA 2AKLA 3S15I 4MH4A 4NBCA 2JA5I 2JS4A 1USPA 1QYPA 2NVYI 2R93I 1TWAI 4BBSI 4A3GI 2BJOA 4NBBA 2F4OA 3HOXI 2NVTI 1TFIA 2F4MA 3RZOI 1Y1WI 4A93I 3Q87A 1DL6A 2JA7I 3ESWA 3GTLI 3HOYI 3PO3S 3HOUI 4A3DI 3GKQA 3I4NI 5C44I 2E2JI 1I6HI 3CQZI 3HOWI 3H0GI 4NB8A 1TWHI 1ZB8A 2KPIA 1I3QI 1RLYA 4NOZA 4A3FI 3GTPI 3S1QI 4QTTA 2RBLA 3GTMI 3I07A 5C4JI 2NVXI 4NBDA 4A3LI 1WCMI 5FLMI 4Y52I 4A3EI 1X3WA 4NBHA 2JR6A 4A3KI 3M3YI 3GTKI 1R9TI 1RO4A 1USPB 5CM2M 1TWGI 3GTOI 2DE5A 2R7ZI 4NB9A 3S1RI 3GTGI 3VMGA 5IP9I 1X3ZA 3S1MI 4NBGA 4NBFA 3HOZI 1K83I 3FKII 3S14I 4A3BI 4A3II
chains in the Genus database with same CATH superfamily
3D9XA 1NP6A 1YIJ1 2JA8I 3NFZA 2VUMI 2RT9A 3CC2Z 3F3PC 2OTLZ 2E2II 1VQOZ 3D2LA 5IP7I 1VQNZ 1Q7Y2 3FQQA 2M48A 3GTJI 4RV9A 4E32A 1RO0A 2K5RA 1YJN1 4EWCA 3CCQZ 4NBEA 1QXFA 3CCS1 1VQKZ 3CCE1 3T4NB 1FDOA 2K3RA 1K731 3BG0B 3PO2I 2YU9I 1LQLA 4BBRI 1VLAA 4RVGA 1Y1VS 2H85A 3G71Z 3J81f 1SFOI 3NDJA 2OTJZ 2RPRA 1K9M1 2NVQI 4E30A 3NH4A 2V8JA 4HGYA 5T6BA 4MD9A 4NH1C 4NFRA 1ML8A 1VQ6Z 4DGLA 2AKLA 4NBCA 2JS4A 4E2WA 2OTL1 1QYPA 1VQ81 4BBSI 1VQN1 2LFUA 3CPWY 2F4MA 2QEX1 3Q87A 2QA41 5A2Qb 3CCQ1 3ESWA 1AA6A 1ZH1A 3CMA1 1VQM1 2JIOA 1Y8CA 1S7MA 1X0TA 3G6EZ 1K732 2E2JI 1W2BZ 3CC7Z 3CCM1 1VQL1 2RIQA 3OW2Z 3GTPI 1NJI1 4QTTA 2G2KA 1K9M2 3I07A 3TE5B 5C4JI 4NBDA 5AN9F 3OW2Y 4Y52I 4CL1A 3IF8A 2R6MA 2V8KA 3S1RI 2EGTA 1JJ2Y 3GTGI 4DQYB 2O4HA 5IP9I 1VQ9Z 1X3ZA 2VPZA 3HOZI 2OZKA 3CCLZ 3FKII 1YITZ 4A3II 2W04A 2OOYB 5T64A 3G4SZ 1NUIA 3VMIA 2GTIA 3J7A4 1TWFI 2LIYA 2IZ3A 3U50C 3GTMS 1WZNA 1KC81 2B63I 3TDHB 1L1OC 2VF1A 4MD7A 1K8A1 1TWCI 4E2YA 1VQ5Z 5A2Qf 1ZB9A 3RZDI 2V45A 4BY7I 5T67A 1VQ4Z 3I56Z 2GTHA 2P3YA 1Z02A 3EERA 5C3EI 1VQ91 2E2HI 2JA6I 3H3VJ 1WIIA 1YUAA 3KIHA 3S2DI 1Q812 2JNYA 5LL6f 5D1OA 1USPA 3I55Z 2V8IA 4NBBA 1Y1WI 3MONA 1KC82 3CC41 1K8A2 2RHBA 3HOYI 3CCUZ 3PO3S 3CD61 1Z01A 2VPYA 1Z03A 3MZKB 3CCR1 2JIRA 4MD8A 3GKQA 2W03A 3I4NI 1YI2Z 3CC21 3CQZI 2Y0SA 3HOWI 2KPIA 1VQO1 1JWHC 2RBLA 2JUBA 4RVHA 5IT9b 1Q821 5FLMI 2WAQA 4E2ZA 4E33A 2ZAEB 3FQMA 4A3KI 3GTKI 1VQK1 1TWGI 4RS4A 2V3VA 1RO2A 4HGZA 3IX0A 1SIWA 3S1MI 4NBGA 2OOXB 3G711 3S14I 2OTJ1 2PK7A 3MZLB 1W2BY 1Y1VI 3EEDA 4A3MI 3CMEZ 4XX2A 2QR1B 2VPWA 1VQ61 3P5JB 2HF1A 1YHQZ 2LEXA 4A3CI 3NH5A 3S1NI 4DK1A 4Y7NI 1Q822 2DE6A 2QRDB 1VQPZ 1YUKA 3CCJZ 1Q811 1S72Z 1KQSZ 2JIMA 3G6E1 1N8R2 3CC71 3QWUA 5C4XI 1KQSY 3VMHA 3NDIA 1I50I 3KIFA 3JAMb 5IT9f 3HOVI 3GCFA 4MH4A 2JA5I 3J80b 1YJWZ 2QRCB 2NVYI 2NAPA 1TWAI 2BJOA 4E2XA 1TFIA 4A93I 2WB1A 1M1K1 4E31A 1YJNZ 3CCSZ 2AYDA 3CCEZ 2E9HA 2Q4ZA 3CCL1 3HOUI 4A3DI 1YIT1 3G4S1 1Q862 1I6HI 1WJ2A 3H0GI 4NB8A 1ZB8A 2E7ZA 1RLYA 4A3FI 3S1QI 3GTMI 1VQ51 4A3LI 3VTNA 4A3EI 4S1TA 4NBHA 1YJW1 3M3YI 1VQ8Z 4MRIA 1RO4A 3HKZA 2JMOA 5CM2M 1VQ41 2QEXZ 3I561 2QA4Z 4NB9A 2PM9A 4RVFA 3IFUA 4NBFA 1M1K2 3CMAZ 1VQMZ 3JAMf 1KD11 1FDIA 1YJ9Z 4A3JI 1WW9A 3S2HI 4X6AI 3BG1B 4BY1I 3GTQI 3J80f 3CCMZ 1VQLZ 3K7AI 1PFTA 3I551 3NH8A 3I4MI 4BXXI 2R92I 1N2FA 1N8R1 4NBAA 1M901 2P28A 1QVFZ 2PMZA 2YADA 2O53A 4RVDA 5FLXf 3CPWZ 2J6AA 1QVFY 3CCU1 3CCVZ 3LUSA 2DE7A 2VUGA 3M4OI 3PO3I 3D6WA 4AYBA 4HH4A 1YI21 1VQ7Z 2M6NA 5D1PA 4QTUA 2VPXA 2QLVB 3S16I 1YJ91 3S17I 2QREB 2I3CA 3IR7A 3VB9A 1KD12 3S15I 1QVGZ 1Q16A 2R93I 3F3FC 1Q861 4A3GI 2F4OA 3HOXI 2IZ4A 1QVGY 2NVTI 3RZOI 2JIPA 1DL6A 2JA7I 3GTLI 1M902 1JJ2Z 4MXUA 3CCV1 2IV2X 2KI7B 2JIQA 2QKDA 1YIJZ 5C44I 2HU9A 3CME1 4TNUA 1VQ71 1Q7Y1 1TWHI 3J81b 1I3QI 1YHQ1 4NOZA 2NVXI 1WCMI 1X3WA 1P9NA 2JR6A 2GU2A 5D1OB 1R9TI 1USPB 5FLXb 3GTOI 1VQP1 2DE5A 3CCJ1 1KRLA 3CC4Z 2R7ZI 1S721 1RQFA 2Q51A 3VMGA 1NJI2 3CXCZ 1RNIA 1K83I 1QF8A 3CD6Z 4MONA 3CXCY 3CCRZ 4A3BI
chains in the Genus database with same CATH topology
3D9XA 1NP6A 1YIJ1 2JA8I 3NFZA 2VUMI 2RT9A 3CC2Z 3F3PC 2OTLZ 2E2II 1VQOZ 5IP7I 1VQNZ 1Q7Y2 3FQQA 2M48A 3GTJI 4RV9A 4E32A 1RO0A 2K5RA 1YJN1 4EWCA 3CCQZ 4NBEA 3CCS1 1VQKZ 3CCE1 3T4NB 2K3RA 1K731 3BG0B 3PO2I 2YU9I 1LQLA 4BBRI 1VLAA 4RVGA 1Y1VS 2H85A 3G71Z 3J81f 1SFOI 3NDJA 2OTJZ 2RPRA 1K9M1 2NVQI 4E30A 3NH4A 2V8JA 4HGYA 5T6BA 4MD9A 4NH1C 4NFRA 1ML8A 1VQ6Z 4DGLA 2AKLA 4NBCA 2JS4A 4E2WA 2OTL1 1QYPA 1VQ81 4BBSI 1VQN1 2LFUA 3CPWY 2F4MA 2QEX1 3Q87A 2QA41 5A2Qb 3CCQ1 3ESWA 1ZH1A 3CMA1 1VQM1 1S7MA 1X0TA 3G6EZ 1K732 2E2JI 1W2BZ 3CC7Z 3CCM1 1VQL1 2RIQA 3OW2Z 3GTPI 1NJI1 4QTTA 2G2KA 1K9M2 3I07A 3TE5B 5C4JI 4NBDA 5AN9F 3OW2Y 4Y52I 4CL1A 3IF8A 2R6MA 2V8KA 3S1RI 2EGTA 1JJ2Y 3GTGI 4DQYB 2O4HA 5IP9I 1VQ9Z 1X3ZA 3HOZI 2OZKA 3CCLZ 3FKII 1YITZ 4A3II 2W04A 2OOYB 5T64A 3G4SZ 1NUIA 3VMIA 2GTIA 3J7A4 1TWFI 2LIYA 2IZ3A 3U50C 3GTMS 1KC81 2B63I 3TDHB 1L1OC 2VF1A 4MD7A 1K8A1 1TWCI 4E2YA 1VQ5Z 5A2Qf 1ZB9A 3RZDI 4BY7I 5T67A 1VQ4Z 3I56Z 2GTHA 2P3YA 1Z02A 3EERA 5C3EI 1VQ91 2E2HI 2JA6I 3H3VJ 1WIIA 1YUAA 3KIHA 3S2DI 1Q812 2JNYA 5LL6f 5D1OA 1USPA 3I55Z 2V8IA 4NBBA 1Y1WI 3MONA 1KC82 3CC41 1K8A2 2RHBA 3HOYI 3CCUZ 3PO3S 3CD61 1Z01A 1Z03A 3MZKB 3CCR1 4MD8A 3GKQA 2W03A 3I4NI 1YI2Z 3CC21 3CQZI 2Y0SA 3HOWI 2KPIA 1VQO1 1JWHC 2RBLA 2JUBA 4RVHA 5IT9b 1Q821 5FLMI 2WAQA 4E2ZA 4E33A 2ZAEB 3FQMA 4A3KI 3GTKI 1VQK1 1TWGI 4RS4A 1RO2A 4HGZA 3IX0A 3S1MI 4NBGA 2OOXB 3G711 3S14I 2OTJ1 2PK7A 3MZLB 1W2BY 1Y1VI 3EEDA 4A3MI 3CMEZ 4XX2A 2QR1B 1VQ61 3P5JB 2HF1A 1YHQZ 4A3CI 3NH5A 3S1NI 4DK1A 4Y7NI 1Q822 2DE6A 2QRDB 1VQPZ 1YUKA 3CCJZ 1Q811 1S72Z 1KQSZ 3G6E1 1N8R2 3CC71 3QWUA 5C4XI 1KQSY 3VMHA 3NDIA 1I50I 3KIFA 3JAMb 5IT9f 3HOVI 3GCFA 4MH4A 2JA5I 3J80b 1YJWZ 2QRCB 2NVYI 1TWAI 2BJOA 4E2XA 1TFIA 4A93I 2WB1A 1M1K1 4E31A 1YJNZ 3CCSZ 3CCEZ 2E9HA 2Q4ZA 3CCL1 3HOUI 4A3DI 1YIT1 3G4S1 1Q862 1I6HI 3H0GI 4NB8A 1ZB8A 1RLYA 4A3FI 3S1QI 3GTMI 1VQ51 4A3LI 3VTNA 4A3EI 4S1TA 4NBHA 1YJW1 3M3YI 1VQ8Z 4MRIA 1RO4A 3HKZA 2JMOA 5CM2M 1VQ41 2QEXZ 3I561 2QA4Z 4NB9A 2PM9A 4RVFA 3IFUA 4NBFA 1M1K2 3CMAZ 1VQMZ 3JAMf 1KD11 1YJ9Z 4A3JI 1WW9A 3S2HI 4X6AI 3BG1B 4BY1I 3GTQI 3J80f 3CCMZ 1VQLZ 3K7AI 1PFTA 3I551 3NH8A 3I4MI 4BXXI 2R92I 1N2FA 1N8R1 4NBAA 1M901 2P28A 1QVFZ 2PMZA 2YADA 2O53A 4RVDA 5FLXf 3CPWZ 2J6AA 1QVFY 3CCU1 3CCVZ 3LUSA 2DE7A 2VUGA 3M4OI 3PO3I 3D6WA 4AYBA 4HH4A 1YI21 1VQ7Z 2M6NA 5D1PA 4QTUA 2QLVB 3S16I 1YJ91 3S17I 2QREB 2I3CA 3VB9A 1KD12 3S15I 1QVGZ 2R93I 3F3FC 1Q861 4A3GI 2F4OA 3HOXI 2IZ4A 1QVGY 2NVTI 3RZOI 1DL6A 2JA7I 3GTLI 1M902 1JJ2Z 4MXUA 3CCV1 2KI7B 2QKDA 1YIJZ 5C44I 2HU9A 3CME1 4TNUA 1VQ71 1Q7Y1 1TWHI 3J81b 1I3QI 1YHQ1 4NOZA 2NVXI 1WCMI 1X3WA 1P9NA 2JR6A 2GU2A 5D1OB 1R9TI 1USPB 5FLXb 3GTOI 1VQP1 2DE5A 3CCJ1 1KRLA 3CC4Z 2R7ZI 1S721 1RQFA 2Q51A 3VMGA 1NJI2 3CXCZ 1RNIA 1K83I 1QF8A 3CD6Z 4MONA 3CXCY 3CCRZ 4A3BI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PK7 A;  1Y1V I;  4A3J I;  1WW9 A;  4A3M I;  3S2H I;  1NUI A;  3VMI A;  4X6A I;  1TWF I;  4BY1 I;  2JA8 I;  4XX2 A;  3GTQ I;  2VUM I;  3K7A I;  3U50 C;  3GTM S;  1PFT A;  2E2I I;  2HF1 A;  2B63 I;  1L1O C;  5IP7 I;  3I4M I;  1TWC I;  4BXX I;  2R92 I;  1N2F A;  4NBA A;  4A3C I;  3GTJ I;  2K5R A;  1ZB9 A;  3RZD I;  4NBE A;  3S1N I;  2J6A A;  4Y7N I;  4BY7 I;  2DE6 A;  3LUS A;  2DE7 A;  3M4O I;  2P3Y A;  3PO2 I;  3PO3 I;  2YU9 I;  1LQL A;  4BBR I;  1VLA A;  3D6W A;  3EER A;  5C3E I;  1Y1V S;  2E2H I;  1SFO I;  2JA6 I;  4QTU A;  2NVQ I;  5C4X I;  3VMH A;  1I50 I;  3H3V J;  3S16 I;  3S17 I;  1YUA A;  3HOV I;  3S2D I;  1ML8 A;  3VB9 A;  2JNY A;  3GCF A;  2AKL A;  3S15 I;  4MH4 A;  4NBC A;  2JA5 I;  2JS4 A;  1USP A;  1QYP A;  2NVY I;  2R93 I;  1TWA I;  4BBS I;  4A3G I;  2BJO A;  4NBB A;  2F4O A;  3HOX I;  2NVT I;  1TFI A;  2F4M A;  3RZO I;  1Y1W I;  4A93 I;  3Q87 A;  1DL6 A;  2JA7 I;  3ESW A;  3GTL I;  3HOY I;  3PO3 S;  3HOU I;  4A3D I;  3GKQ A;  3I4N I;  5C44 I;  2E2J I;  1I6H I;  3CQZ I;  3HOW I;  3H0G I;  4NB8 A;  1TWH I;  1ZB8 A;  2KPI A;  1I3Q I;  1RLY A;  4NOZ A;  4A3F I;  3GTP I;  3S1Q I;  4QTT A;  2RBL A;  3GTM I;  3I07 A;  5C4J I;  2NVX I;  4NBD A;  4A3L I;  1WCM I;  5FLM I;  4Y52 I;  4A3E I;  1X3W A;  4NBH A;  2JR6 A;  4A3K I;  3M3Y I;  3GTK I;  1R9T I;  1RO4 A;  1USP B;  5CM2 M;  1TWG I;  3GTO I;  2DE5 A;  2R7Z I;  4NB9 A;  3S1R I;  3GTG I;  3VMG A;  5IP9 I;  1X3Z A;  3S1M I;  4NBG A;  4NBF A;  3HOZ I;  1K83 I;  3FKI I;  3S14 I;  4A3B I;  4A3I I; 
#chains in the Genus database with same CATH topology
 3D9X A;  1NP6 A;  1YIJ 1;  2JA8 I;  3NFZ A;  2VUM I;  2RT9 A;  3CC2 Z;  3F3P C;  2OTL Z;  2E2I I;  1VQO Z;  3D2L A;  5IP7 I;  1VQN Z;  1Q7Y 2;  3FQQ A;  2M48 A;  3GTJ I;  4RV9 A;  4E32 A;  1RO0 A;  2K5R A;  1YJN 1;  4EWC A;  3CCQ Z;  4NBE A;  1QXF A;  3CCS 1;  1VQK Z;  3CCE 1;  3T4N B;  1FDO A;  2K3R A;  1K73 1;  3BG0 B;  3PO2 I;  2YU9 I;  1LQL A;  4BBR I;  1VLA A;  4RVG A;  1Y1V S;  2H85 A;  3G71 Z;  3J81 f;  1SFO I;  3NDJ A;  2OTJ Z;  2RPR A;  1K9M 1;  2NVQ I;  4E30 A;  3NH4 A;  2V8J A;  4HGY A;  5T6B A;  4MD9 A;  4NH1 C;  4NFR A;  1ML8 A;  1VQ6 Z;  4DGL A;  2AKL A;  4NBC A;  2JS4 A;  4E2W A;  2OTL 1;  1QYP A;  1VQ8 1;  4BBS I;  1VQN 1;  2LFU A;  3CPW Y;  2F4M A;  2QEX 1;  3Q87 A;  2QA4 1;  5A2Q b;  3CCQ 1;  3ESW A;  1AA6 A;  1ZH1 A;  3CMA 1;  1VQM 1;  2JIO A;  1Y8C A;  1S7M A;  1X0T A;  3G6E Z;  1K73 2;  2E2J I;  1W2B Z;  3CC7 Z;  3CCM 1;  1VQL 1;  2RIQ A;  3OW2 Z;  3GTP I;  1NJI 1;  4QTT A;  2G2K A;  1K9M 2;  3I07 A;  3TE5 B;  5C4J I;  4NBD A;  5AN9 F;  3OW2 Y;  4Y52 I;  4CL1 A;  3IF8 A;  2R6M A;  2V8K A;  3S1R I;  2EGT A;  1JJ2 Y;  3GTG I;  4DQY B;  2O4H A;  5IP9 I;  1VQ9 Z;  1X3Z A;  2VPZ A;  3HOZ I;  2OZK A;  3CCL Z;  3FKI I;  1YIT Z;  4A3I I;  2W04 A;  2OOY B;  5T64 A;  3G4S Z;  1NUI A;  3VMI A;  2GTI A;  3J7A 4;  1TWF I;  2LIY A;  2IZ3 A;  3U50 C;  3GTM S;  1WZN A;  1KC8 1;  2B63 I;  3TDH B;  1L1O C;  2VF1 A;  4MD7 A;  1K8A 1;  1TWC I;  4E2Y A;  1VQ5 Z;  5A2Q f;  1ZB9 A;  3RZD I;  2V45 A;  4BY7 I;  5T67 A;  1VQ4 Z;  3I56 Z;  2GTH A;  2P3Y A;  1Z02 A;  3EER A;  5C3E I;  1VQ9 1;  2E2H I;  2JA6 I;  3H3V J;  1WII A;  1YUA A;  3KIH A;  3S2D I;  1Q81 2;  2JNY A;  5LL6 f;  5D1O A;  1USP A;  3I55 Z;  2V8I A;  4NBB A;  1Y1W I;  3MON A;  1KC8 2;  3CC4 1;  1K8A 2;  2RHB A;  3HOY I;  3CCU Z;  3PO3 S;  3CD6 1;  1Z01 A;  2VPY A;  1Z03 A;  3MZK B;  3CCR 1;  2JIR A;  4MD8 A;  3GKQ A;  2W03 A;  3I4N I;  1YI2 Z;  3CC2 1;  3CQZ I;  2Y0S A;  3HOW I;  2KPI A;  1VQO 1;  1JWH C;  2RBL A;  2JUB A;  4RVH A;  5IT9 b;  1Q82 1;  5FLM I;  2WAQ A;  4E2Z A;  4E33 A;  2ZAE B;  3FQM A;  4A3K I;  3GTK I;  1VQK 1;  1TWG I;  4RS4 A;  2V3V A;  1RO2 A;  4HGZ A;  3IX0 A;  1SIW A;  3S1M I;  4NBG A;  2OOX B;  3G71 1;  3S14 I;  2OTJ 1;  2PK7 A;  3MZL B;  1W2B Y;  1Y1V I;  3EED A;  4A3M I;  3CME Z;  4XX2 A;  2QR1 B;  2VPW A;  1VQ6 1;  3P5J B;  2HF1 A;  1YHQ Z;  2LEX A;  4A3C I;  3NH5 A;  3S1N I;  4DK1 A;  4Y7N I;  1Q82 2;  2DE6 A;  2QRD B;  1VQP Z;  1YUK A;  3CCJ Z;  1Q81 1;  1S72 Z;  1KQS Z;  2JIM A;  3G6E 1;  1N8R 2;  3CC7 1;  3QWU A;  5C4X I;  1KQS Y;  3VMH A;  3NDI A;  1I50 I;  3KIF A;  3JAM b;  5IT9 f;  3HOV I;  3GCF A;  4MH4 A;  2JA5 I;  3J80 b;  1YJW Z;  2QRC B;  2NVY I;  2NAP A;  1TWA I;  2BJO A;  4E2X A;  1TFI A;  4A93 I;  2WB1 A;  1M1K 1;  4E31 A;  1YJN Z;  3CCS Z;  2AYD A;  3CCE Z;  2E9H A;  2Q4Z A;  3CCL 1;  3HOU I;  4A3D I;  1YIT 1;  3G4S 1;  1Q86 2;  1I6H I;  1WJ2 A;  3H0G I;  4NB8 A;  1ZB8 A;  2E7Z A;  1RLY A;  4A3F I;  3S1Q I;  3GTM I;  1VQ5 1;  4A3L I;  3VTN A;  4A3E I;  4S1T A;  4NBH A;  1YJW 1;  3M3Y I;  1VQ8 Z;  4MRI A;  1RO4 A;  3HKZ A;  2JMO A;  5CM2 M;  1VQ4 1;  2QEX Z;  3I56 1;  2QA4 Z;  4NB9 A;  2PM9 A;  4RVF A;  3IFU A;  4NBF A;  1M1K 2;  3CMA Z;  1VQM Z;  3JAM f;  1KD1 1;  1FDI A;  1YJ9 Z;  4A3J I;  1WW9 A;  3S2H I;  4X6A I;  3BG1 B;  4BY1 I;  3GTQ I;  3J80 f;  3CCM Z;  1VQL Z;  3K7A I;  1PFT A;  3I55 1;  3NH8 A;  3I4M I;  4BXX I;  2R92 I;  1N2F A;  1N8R 1;  4NBA A;  1M90 1;  2P28 A;  1QVF Z;  2PMZ A;  2YAD A;  2O53 A;  4RVD A;  5FLX f;  3CPW Z;  2J6A A;  1QVF Y;  3CCU 1;  3CCV Z;  3LUS A;  2DE7 A;  2VUG A;  3M4O I;  3PO3 I;  3D6W A;  4AYB A;  4HH4 A;  1YI2 1;  1VQ7 Z;  2M6N A;  5D1P A;  4QTU A;  2VPX A;  2QLV B;  3S16 I;  1YJ9 1;  3S17 I;  2QRE B;  2I3C A;  3IR7 A;  3VB9 A;  1KD1 2;  3S15 I;  1QVG Z;  1Q16 A;  2R93 I;  3F3F C;  1Q86 1;  4A3G I;  2F4O A;  3HOX I;  2IZ4 A;  1QVG Y;  2NVT I;  3RZO I;  2JIP A;  1DL6 A;  2JA7 I;  3GTL I;  1M90 2;  1JJ2 Z;  4MXU A;  3CCV 1;  2IV2 X;  2KI7 B;  2JIQ A;  2QKD A;  1YIJ Z;  5C44 I;  2HU9 A;  3CME 1;  4TNU A;  1VQ7 1;  1Q7Y 1;  1TWH I;  3J81 b;  1I3Q I;  1YHQ 1;  4NOZ A;  2NVX I;  1WCM I;  1X3W A;  1P9N A;  2JR6 A;  2GU2 A;  5D1O B;  1R9T I;  1USP B;  5FLX b;  3GTO I;  1VQP 1;  2DE5 A;  3CCJ 1;  1KRL A;  3CC4 Z;  2R7Z I;  1S72 1;  1RQF A;  2Q51 A;  3VMG A;  1NJI 2;  3CXC Z;  1RNI A;  1K83 I;  1QF8 A;  3CD6 Z;  4MON A;  3CXC Y;  3CCR Z;  4A3B I; 
#chains in the Genus database with same CATH homology
 3D9X A;  1NP6 A;  1YIJ 1;  2JA8 I;  3NFZ A;  2VUM I;  2RT9 A;  3CC2 Z;  3F3P C;  2OTL Z;  2E2I I;  1VQO Z;  5IP7 I;  1VQN Z;  1Q7Y 2;  3FQQ A;  2M48 A;  3GTJ I;  4RV9 A;  4E32 A;  1RO0 A;  2K5R A;  1YJN 1;  4EWC A;  3CCQ Z;  4NBE A;  3CCS 1;  1VQK Z;  3CCE 1;  3T4N B;  2K3R A;  1K73 1;  3BG0 B;  3PO2 I;  2YU9 I;  1LQL A;  4BBR I;  1VLA A;  4RVG A;  1Y1V S;  2H85 A;  3G71 Z;  3J81 f;  1SFO I;  3NDJ A;  2OTJ Z;  2RPR A;  1K9M 1;  2NVQ I;  4E30 A;  3NH4 A;  2V8J A;  4HGY A;  5T6B A;  4MD9 A;  4NH1 C;  4NFR A;  1ML8 A;  1VQ6 Z;  4DGL A;  2AKL A;  4NBC A;  2JS4 A;  4E2W A;  2OTL 1;  1QYP A;  1VQ8 1;  4BBS I;  1VQN 1;  2LFU A;  3CPW Y;  2F4M A;  2QEX 1;  3Q87 A;  2QA4 1;  5A2Q b;  3CCQ 1;  3ESW A;  1ZH1 A;  3CMA 1;  1VQM 1;  1S7M A;  1X0T A;  3G6E Z;  1K73 2;  2E2J I;  1W2B Z;  3CC7 Z;  3CCM 1;  1VQL 1;  2RIQ A;  3OW2 Z;  3GTP I;  1NJI 1;  4QTT A;  2G2K A;  1K9M 2;  3I07 A;  3TE5 B;  5C4J I;  4NBD A;  5AN9 F;  3OW2 Y;  4Y52 I;  4CL1 A;  3IF8 A;  2R6M A;  2V8K A;  3S1R I;  2EGT A;  1JJ2 Y;  3GTG I;  4DQY B;  2O4H A;  5IP9 I;  1VQ9 Z;  1X3Z A;  3HOZ I;  2OZK A;  3CCL Z;  3FKI I;  1YIT Z;  4A3I I;  2W04 A;  2OOY B;  5T64 A;  3G4S Z;  1NUI A;  3VMI A;  2GTI A;  3J7A 4;  1TWF I;  2LIY A;  2IZ3 A;  3U50 C;  3GTM S;  1KC8 1;  2B63 I;  3TDH B;  1L1O C;  2VF1 A;  4MD7 A;  1K8A 1;  1TWC I;  4E2Y A;  1VQ5 Z;  5A2Q f;  1ZB9 A;  3RZD I;  4BY7 I;  5T67 A;  1VQ4 Z;  3I56 Z;  2GTH A;  2P3Y A;  1Z02 A;  3EER A;  5C3E I;  1VQ9 1;  2E2H I;  2JA6 I;  3H3V J;  1WII A;  1YUA A;  3KIH A;  3S2D I;  1Q81 2;  2JNY A;  5LL6 f;  5D1O A;  1USP A;  3I55 Z;  2V8I A;  4NBB A;  1Y1W I;  3MON A;  1KC8 2;  3CC4 1;  1K8A 2;  2RHB A;  3HOY I;  3CCU Z;  3PO3 S;  3CD6 1;  1Z01 A;  1Z03 A;  3MZK B;  3CCR 1;  4MD8 A;  3GKQ A;  2W03 A;  3I4N I;  1YI2 Z;  3CC2 1;  3CQZ I;  2Y0S A;  3HOW I;  2KPI A;  1VQO 1;  1JWH C;  2RBL A;  2JUB A;  4RVH A;  5IT9 b;  1Q82 1;  5FLM I;  2WAQ A;  4E2Z A;  4E33 A;  2ZAE B;  3FQM A;  4A3K I;  3GTK I;  1VQK 1;  1TWG I;  4RS4 A;  1RO2 A;  4HGZ A;  3IX0 A;  3S1M I;  4NBG A;  2OOX B;  3G71 1;  3S14 I;  2OTJ 1;  2PK7 A;  3MZL B;  1W2B Y;  1Y1V I;  3EED A;  4A3M I;  3CME Z;  4XX2 A;  2QR1 B;  1VQ6 1;  3P5J B;  2HF1 A;  1YHQ Z;  4A3C I;  3NH5 A;  3S1N I;  4DK1 A;  4Y7N I;  1Q82 2;  2DE6 A;  2QRD B;  1VQP Z;  1YUK A;  3CCJ Z;  1Q81 1;  1S72 Z;  1KQS Z;  3G6E 1;  1N8R 2;  3CC7 1;  3QWU A;  5C4X I;  1KQS Y;  3VMH A;  3NDI A;  1I50 I;  3KIF A;  3JAM b;  5IT9 f;  3HOV I;  3GCF A;  4MH4 A;  2JA5 I;  3J80 b;  1YJW Z;  2QRC B;  2NVY I;  1TWA I;  2BJO A;  4E2X A;  1TFI A;  4A93 I;  2WB1 A;  1M1K 1;  4E31 A;  1YJN Z;  3CCS Z;  3CCE Z;  2E9H A;  2Q4Z A;  3CCL 1;  3HOU I;  4A3D I;  1YIT 1;  3G4S 1;  1Q86 2;  1I6H I;  3H0G I;  4NB8 A;  1ZB8 A;  1RLY A;  4A3F I;  3S1Q I;  3GTM I;  1VQ5 1;  4A3L I;  3VTN A;  4A3E I;  4S1T A;  4NBH A;  1YJW 1;  3M3Y I;  1VQ8 Z;  4MRI A;  1RO4 A;  3HKZ A;  2JMO A;  5CM2 M;  1VQ4 1;  2QEX Z;  3I56 1;  2QA4 Z;  4NB9 A;  2PM9 A;  4RVF A;  3IFU A;  4NBF A;  1M1K 2;  3CMA Z;  1VQM Z;  3JAM f;  1KD1 1;  1YJ9 Z;  4A3J I;  1WW9 A;  3S2H I;  4X6A I;  3BG1 B;  4BY1 I;  3GTQ I;  3J80 f;  3CCM Z;  1VQL Z;  3K7A I;  1PFT A;  3I55 1;  3NH8 A;  3I4M I;  4BXX I;  2R92 I;  1N2F A;  1N8R 1;  4NBA A;  1M90 1;  2P28 A;  1QVF Z;  2PMZ A;  2YAD A;  2O53 A;  4RVD A;  5FLX f;  3CPW Z;  2J6A A;  1QVF Y;  3CCU 1;  3CCV Z;  3LUS A;  2DE7 A;  2VUG A;  3M4O I;  3PO3 I;  3D6W A;  4AYB A;  4HH4 A;  1YI2 1;  1VQ7 Z;  2M6N A;  5D1P A;  4QTU A;  2QLV B;  3S16 I;  1YJ9 1;  3S17 I;  2QRE B;  2I3C A;  3VB9 A;  1KD1 2;  3S15 I;  1QVG Z;  2R93 I;  3F3F C;  1Q86 1;  4A3G I;  2F4O A;  3HOX I;  2IZ4 A;  1QVG Y;  2NVT I;  3RZO I;  1DL6 A;  2JA7 I;  3GTL I;  1M90 2;  1JJ2 Z;  4MXU A;  3CCV 1;  2KI7 B;  2QKD A;  1YIJ Z;  5C44 I;  2HU9 A;  3CME 1;  4TNU A;  1VQ7 1;  1Q7Y 1;  1TWH I;  3J81 b;  1I3Q I;  1YHQ 1;  4NOZ A;  2NVX I;  1WCM I;  1X3W A;  1P9N A;  2JR6 A;  2GU2 A;  5D1O B;  1R9T I;  1USP B;  5FLX b;  3GTO I;  1VQP 1;  2DE5 A;  3CCJ 1;  1KRL A;  3CC4 Z;  2R7Z I;  1S72 1;  1RQF A;  2Q51 A;  3VMG A;  1NJI 2;  3CXC Z;  1RNI A;  1K83 I;  1QF8 A;  3CD6 Z;  4MON A;  3CXC Y;  3CCR Z;  4A3B I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...