4A3CI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3cI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3cI02
2JR6A 5C44I 4A3DI 1I50I 4NBDA 3GCFA 1WCMI 2R93I 3HOYI 1QYPA 2DE6A 3U50C 2R7ZI 3RZOI 3VMIA 4A3LI 4NB9A 3ESWA 4A3FI 3GTQI 2B63I 1RLYA 3RZDI 1TWHI 1RO4A 3S16I 1L1OC 5C3EI 3PO3S 3HOZI 3GTMI 1TWAI 2NVTI 3GTKI 3VMGA 3I4MI 3PO2I 3GTGI 1DL6A 4A3JI 2NVXI 2J6AA 3Q87A 3GTJI 2JA8I 3VB9A 3S1NI 2E2HI 2PK7A 4X6AI 3I07A 3VMHA 2JA5I 2VUMI 3M4OI 3GKQA 1R9TI 5C4JI 1USPB 3S14I 4NBCA 3S2HI 4A3II 1Y1WI 2JA7I 3S17I 1TWGI 1LQLA 2AKLA 2NVYI 2NVQI 4NBFA 4BY1I 4A3CI 3EERA 3S15I 3HOWI 4Y7NI 3GTLI 4NBAA 4A3MI 5CM2M 1PFTA 3S1RI 2K5RA 1X3ZA 4Y52I 1X3WA 2P3YA 1Y1VI 2KPIA 4A3KI 3GTMS 1N2FA 1ZB8A 4BBSI 2DE5A 5IP7I 1VLAA 1TFIA 4NBBA 4XX2A 5FLMI 3H0GI 4QTTA 2R92I 4A3GI 2E2II 2YU9I 3M3YI 4BY7I 2JNYA 1ZB9A 2F4MA 1YUAA 5C4XI 3FKII 4MH4A 1ML8A 3S1MI 3K7AI 1I6HI 2JA6I 3GTOI 3GTPI 2F4OA 3I4NI 2E2JI 3PO3I 3HOUI 2DE7A 2JS4A 4A3EI 1TWCI 2HF1A 1K83I 4A3BI 3S2DI 4NBHA 1TWFI 4NBEA 4NOZA 4QTUA 4BXXI 3CQZI 4NBGA 3HOXI 3S1QI 5IP9I 2BJOA 4NB8A 1NUIA 1SFOI 4BBRI 1I3QI 3HOVI 1Y1VS 1USPA 2RBLA 3LUSA 4A93I 3H3VJ 3D6WA 1WW9A
chains in the Genus database with same CATH superfamily
1Q7Y2 1YHQZ 4A3DI 2PMZA 3CC71 4NBDA 2R93I 1WCMI 5IT9f 2M48A 3G71Z 4MD8A 3ESWA 4E2XA 4A3FI 2QLVB 4HGZA 2B63I 1RLYA 3CCRZ 1N8R2 3RZDI 2OTLZ 1L1OC 5C3EI 1K731 2JIQA 4RVHA 3GTMI 3GTKI 3I4MI 2NAPA 1DL6A 4RVFA 3CXCZ 1VQ7Z 1YUKA 3CMAZ 2RIQA 2E2HI 2OTJZ 5D1PA 1Q822 3G6EZ 3CCVZ 3GKQA 3CXCY 1YJ9Z 1Y1WI 3JAMf 3I56Z 1M1K1 1Y8CA 4BY1I 2VUGA 1K9M1 1VQKZ 1KD12 3G4S1 4NFRA 3CPWZ 2OTL1 3F3PC 2VPWA 2RPRA 3MONA 2KPIA 1Q811 1NJI2 1ZH1A 5D1OA 3CC41 3CPWY 1M901 1VQ71 4NBBA 3CMA1 2RT9A 3H0GI 2R92I 2OTJ1 2QA4Z 3G6E1 3CCV1 2F4MA 4RVDA 4MH4A 1ML8A 1YJ91 3GTPI 3CC2Z 2WAQA 3CCEZ 1YJNZ 2DE7A 1TWCI 4E2WA 2LEXA 4A3BI 3S2DI 1VQK1 2G2KA 4QTUA 4NOZA 4DK1A 4NBGA 3HOXI 5IT9b 3CCMZ 1YITZ 1SFOI 1I3QI 2JIMA 5AN9F 3J80b 2O53A 1USPA 2GU2A 1QVFZ 3IX0A 2M6NA 4AYBA 1Z03A 2JR6A 2OZKA 2OOYB 1W2BZ 3BG1B 5D1OB 3GCFA 1QYPA 2QA41 2R7ZI 1QVFY 4A3LI 1RNIA 1QXFA 1TWHI 1W2BY 3CCQZ 3S16I 3CC21 1YJN1 3FQMA 3NH8A 3CCM1 1YIT1 1KRLA 1VQLZ 2V8JA 1KC82 1USPB 4E33A 4A3II 3G4SZ 2JA7I 1TWGI 1LQLA 2O4HA 4DGLA 1RQFA 2I3CA 2QREB 3EERA 1FDIA 3S15I 2E7ZA 3NDJA 4NH1C 1VQ4Z 3CCJ1 4NBAA 4A3MI 5CM2M 1VQ9Z 3CC4Z 3CCQ1 2JUBA 1VQOZ 3J7A4 3NH4A 2W03A 2WB1A 1VQPZ 4BBSI 3TE5B 5IP7I 3J81f 1VQL1 4RV9A 4XX2A 4QTTA 2YU9I 2VPXA 2JNYA 1ZB9A 1YUAA 3F3FC 1SIWA 1Q861 5FLXf 2QEXZ 3HOUI 3T4NB 5A2Qf 2AYDA 3OW2Z 1VQ41 4BXXI 3CQZI 1VQ91 2BJOA 1Q7Y1 2ZAEB 3HKZA 2OOXB 2R6MA 2YADA 3CCLZ 2V8IA 1VQO1 2RBLA 4A93I 1VQP1 3OW2Y 3D6WA 1N8R1 4MD7A 1I50I 1JJ2Z 3HOYI 3U50C 3VMIA 1VQ5Z 3CMEZ 2P28A 3GTQI 1JJ2Y 1RO4A 2EGTA 2QEX1 2GTIA 3PO3S 3HOZI 4MD9A 1TWAI 3PO2I 3VMGA 4RVGA 3GTGI 2J6AA 3GTJI 1Z02A 2KI7B 3VB9A 1K732 1KQSZ 3S1NI 2PK7A 1VQ8Z 2VPZA 3CCL1 1S72Z 4X6AI 1Q16A 2JIOA 4RS4A 2JA5I 1R9TI 5C4JI 3S14I 1QF8A 1AA6A 3S2HI 3CCJZ 3FQQA 2V3VA 1KD11 1KQSY 2NVQI 4A3CI 1K8A1 1NJI1 1VQ51 3CME1 3D2LA 3HOWI 4HGYA 2IV2X 1P9NA 2HU9A 3JAMb 1RO2A 3IR7A 1PFTA 1M1K2 2Q51A 1X3WA 3QWUA 2P3YA 1K9M2 2VPYA 2DE5A 2GTHA 1VQMZ 4MXUA 2JIRA 4TNUA 5FLXb 5FLMI 1Q812 2JIPA 2E2II 1VQ81 1X0TA 3M3YI 1S721 1WZNA 4BY7I 3CD6Z 1RO0A 2W04A 5C4XI 1M902 3S1MI 3K7AI 1I6HI 3MZLB 2F4OA 3D9XA 2E2JI 3PO3I 2JS4A 3J80f 2HF1A 1K83I 4NBEA 2V8KA 3CCUZ 1Z01A 3IFUA 2VF1A 1NUIA 4BBRI 3P5JB 4E32A 4MRIA 1Y1VS 3LUSA 3NDIA 3IF8A 3S1QI 1VQM1 5C44I 4E30A 1VQNZ 1WJ2A 2DE6A 1QVGZ 3RZOI 1VQ6Z 1WIIA 4NB9A 3CD61 4E2ZA 5T64A 1YHQ1 3NH5A 5LL6f 1QVGY 3G711 1KC81 2Y0SA 2NVTI 3CCSZ 3CCR1 1JWHC 3CCU1 4A3JI 2NVXI 2H85A 3Q87A 2JA8I 4HH4A 1YI2Z 1K8A2 3I07A 1YIJZ 2IZ4A 3VMHA 2VUMI 3M4OI 3NFZA 4NBCA 5T6BA 2RHBA 4E31A 4EWCA 3S17I 1YJWZ 2AKLA 2NVYI 3TDHB 1VQN1 3BG0B 4NBFA 3I55Z 1VQ61 4Y7NI 1Q821 3GTLI 3S1RI 3I561 4CL1A 2K5RA 1X3ZA 3MZKB 4Y52I 1Y1VI 4A3KI 4DQYB 3KIFA 1FDOA 4S1TA 3GTMS 2LFUA 2QRCB 1N2FA 1ZB8A 2IZ3A 3CCS1 4E2YA 1VLAA 2JMOA 1TFIA 3CC7Z 1YI21 4A3GI 2LIYA 1YIJ1 2QRDB 3KIHA 3FKII 3J81b 2JA6I 3GTOI 3VTNA 1YJW1 3I4NI 2QR1B 2V45A 5T67A 2K3RA 3I551 4A3EI 4NBHA 1TWFI 1S7MA 2QKDA 5IP9I 1Q862 4NB8A 3CCE1 2Q4ZA 3HOVI 2E9HA 5A2Qb 2PM9A 3EEDA 4MONA 3H3VJ 1WW9A 1NP6A
chains in the Genus database with same CATH topology
1Q7Y2 1YHQZ 4A3DI 2PMZA 3CC71 4NBDA 2R93I 1WCMI 5IT9f 2M48A 3G71Z 4MD8A 3ESWA 4E2XA 4A3FI 2QLVB 4HGZA 2B63I 1RLYA 3CCRZ 1N8R2 3RZDI 2OTLZ 1L1OC 5C3EI 1K731 4RVHA 3GTMI 3GTKI 3I4MI 1DL6A 4RVFA 3CXCZ 1VQ7Z 1YUKA 3CMAZ 2RIQA 2E2HI 2OTJZ 5D1PA 1Q822 3G6EZ 3CCVZ 3GKQA 3CXCY 1YJ9Z 1Y1WI 3JAMf 3I56Z 1M1K1 4BY1I 2VUGA 1K9M1 1VQKZ 1KD12 3G4S1 4NFRA 3CPWZ 2OTL1 3F3PC 2RPRA 3MONA 2KPIA 1Q811 1NJI2 1ZH1A 5D1OA 3CC41 3CPWY 1M901 1VQ71 4NBBA 3CMA1 2RT9A 3H0GI 2R92I 2OTJ1 2QA4Z 3G6E1 3CCV1 2F4MA 4RVDA 4MH4A 1ML8A 1YJ91 3GTPI 3CC2Z 2WAQA 3CCEZ 1YJNZ 2DE7A 1TWCI 4E2WA 4A3BI 3S2DI 1VQK1 2G2KA 4QTUA 4NOZA 4DK1A 4NBGA 3HOXI 5IT9b 3CCMZ 1YITZ 1SFOI 1I3QI 5AN9F 3J80b 2O53A 1USPA 2GU2A 1QVFZ 3IX0A 2M6NA 4AYBA 1Z03A 2JR6A 2OZKA 2OOYB 1W2BZ 3BG1B 5D1OB 3GCFA 1QYPA 2QA41 2R7ZI 1QVFY 4A3LI 1RNIA 1TWHI 1W2BY 3CCQZ 3S16I 3CC21 1YJN1 3FQMA 3NH8A 3CCM1 1YIT1 1KRLA 1VQLZ 2V8JA 1KC82 1USPB 4E33A 4A3II 3G4SZ 2JA7I 1TWGI 1LQLA 2O4HA 4DGLA 1RQFA 2I3CA 2QREB 3EERA 3S15I 3NDJA 4NH1C 1VQ4Z 3CCJ1 4NBAA 4A3MI 5CM2M 1VQ9Z 3CC4Z 3CCQ1 2JUBA 1VQOZ 3J7A4 3NH4A 2W03A 2WB1A 1VQPZ 4BBSI 3TE5B 5IP7I 3J81f 1VQL1 4RV9A 4XX2A 4QTTA 2YU9I 2JNYA 1ZB9A 1YUAA 3F3FC 1Q861 5FLXf 2QEXZ 3HOUI 3T4NB 5A2Qf 3OW2Z 1VQ41 4BXXI 3CQZI 1VQ91 2BJOA 1Q7Y1 2ZAEB 3HKZA 2OOXB 2R6MA 2YADA 3CCLZ 2V8IA 1VQO1 2RBLA 4A93I 1VQP1 3OW2Y 3D6WA 1N8R1 4MD7A 1I50I 1JJ2Z 3HOYI 3U50C 3VMIA 1VQ5Z 3CMEZ 2P28A 3GTQI 1JJ2Y 1RO4A 2EGTA 2QEX1 2GTIA 3PO3S 3HOZI 4MD9A 1TWAI 3PO2I 3VMGA 4RVGA 3GTGI 2J6AA 3GTJI 1Z02A 2KI7B 3VB9A 1K732 1KQSZ 3S1NI 2PK7A 1VQ8Z 3CCL1 1S72Z 4X6AI 2JA5I 4RS4A 1R9TI 5C4JI 3S14I 1QF8A 3S2HI 3CCJZ 3FQQA 1KD11 1KQSY 2NVQI 4A3CI 1K8A1 1NJI1 1VQ51 3CME1 3HOWI 4HGYA 1P9NA 2HU9A 3JAMb 1RO2A 1PFTA 1M1K2 2Q51A 1X3WA 3QWUA 2P3YA 1K9M2 2DE5A 2GTHA 1VQMZ 4MXUA 4TNUA 5FLXb 5FLMI 1Q812 2E2II 1VQ81 1X0TA 3M3YI 1S721 4BY7I 3CD6Z 1RO0A 2W04A 5C4XI 1M902 3S1MI 3K7AI 1I6HI 3MZLB 2F4OA 3D9XA 2E2JI 3PO3I 2JS4A 3J80f 2HF1A 1K83I 4NBEA 2V8KA 3CCUZ 1Z01A 3IFUA 2VF1A 1NUIA 4BBRI 3P5JB 4E32A 4MRIA 1Y1VS 3LUSA 3NDIA 3IF8A 3S1QI 1VQM1 5C44I 4E30A 1VQNZ 2DE6A 1QVGZ 3RZOI 1VQ6Z 1WIIA 4NB9A 3CD61 4E2ZA 5T64A 1YHQ1 3NH5A 5LL6f 1QVGY 3G711 1KC81 2Y0SA 2NVTI 3CCSZ 3CCR1 1JWHC 3CCU1 4A3JI 2NVXI 2H85A 3Q87A 2JA8I 4HH4A 1YI2Z 1K8A2 3I07A 1YIJZ 2IZ4A 3VMHA 2VUMI 3M4OI 3NFZA 4NBCA 5T6BA 2RHBA 4E31A 4EWCA 3S17I 1YJWZ 2AKLA 2NVYI 3TDHB 1VQN1 3BG0B 4NBFA 3I55Z 1VQ61 4Y7NI 1Q821 3GTLI 3S1RI 3I561 4CL1A 2K5RA 1X3ZA 3MZKB 4Y52I 1Y1VI 4A3KI 4DQYB 3KIFA 4S1TA 3GTMS 2LFUA 2QRCB 1N2FA 1ZB8A 2IZ3A 3CCS1 4E2YA 1VLAA 2JMOA 1TFIA 3CC7Z 1YI21 4A3GI 2LIYA 1YIJ1 2QRDB 3KIHA 3FKII 3J81b 2JA6I 3GTOI 3VTNA 1YJW1 3I4NI 2QR1B 5T67A 2K3RA 3I551 4A3EI 4NBHA 1TWFI 1S7MA 2QKDA 5IP9I 1Q862 4NB8A 3CCE1 2Q4ZA 3HOVI 2E9HA 5A2Qb 2PM9A 3EEDA 4MONA 3H3VJ 1WW9A 1NP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR6 A;  5C44 I;  4A3D I;  1I50 I;  4NBD A;  3GCF A;  1WCM I;  2R93 I;  3HOY I;  1QYP A;  2DE6 A;  3U50 C;  2R7Z I;  3RZO I;  3VMI A;  4A3L I;  4NB9 A;  3ESW A;  4A3F I;  3GTQ I;  2B63 I;  1RLY A;  3RZD I;  1TWH I;  1RO4 A;  3S16 I;  1L1O C;  5C3E I;  3PO3 S;  3HOZ I;  3GTM I;  1TWA I;  2NVT I;  3GTK I;  3VMG A;  3I4M I;  3PO2 I;  3GTG I;  1DL6 A;  4A3J I;  2NVX I;  2J6A A;  3Q87 A;  3GTJ I;  2JA8 I;  3VB9 A;  3S1N I;  2E2H I;  2PK7 A;  4X6A I;  3I07 A;  3VMH A;  2JA5 I;  2VUM I;  3M4O I;  3GKQ A;  1R9T I;  5C4J I;  1USP B;  3S14 I;  4NBC A;  3S2H I;  4A3I I;  1Y1W I;  2JA7 I;  3S17 I;  1TWG I;  1LQL A;  2AKL A;  2NVY I;  2NVQ I;  4NBF A;  4BY1 I;  4A3C I;  3EER A;  3S15 I;  3HOW I;  4Y7N I;  3GTL I;  4NBA A;  4A3M I;  5CM2 M;  1PFT A;  3S1R I;  2K5R A;  1X3Z A;  4Y52 I;  1X3W A;  2P3Y A;  1Y1V I;  2KPI A;  4A3K I;  3GTM S;  1N2F A;  1ZB8 A;  4BBS I;  2DE5 A;  5IP7 I;  1VLA A;  1TFI A;  4NBB A;  4XX2 A;  5FLM I;  3H0G I;  4QTT A;  2R92 I;  4A3G I;  2E2I I;  2YU9 I;  3M3Y I;  4BY7 I;  2JNY A;  1ZB9 A;  2F4M A;  1YUA A;  5C4X I;  3FKI I;  4MH4 A;  1ML8 A;  3S1M I;  3K7A I;  1I6H I;  2JA6 I;  3GTO I;  3GTP I;  2F4O A;  3I4N I;  2E2J I;  3PO3 I;  3HOU I;  2DE7 A;  2JS4 A;  4A3E I;  1TWC I;  2HF1 A;  1K83 I;  4A3B I;  3S2D I;  4NBH A;  1TWF I;  4NBE A;  4NOZ A;  4QTU A;  4BXX I;  3CQZ I;  4NBG A;  3HOX I;  3S1Q I;  5IP9 I;  2BJO A;  4NB8 A;  1NUI A;  1SFO I;  4BBR I;  1I3Q I;  3HOV I;  1Y1V S;  1USP A;  2RBL A;  3LUS A;  4A93 I;  3H3V J;  3D6W A;  1WW9 A; 
#chains in the Genus database with same CATH topology
 1Q7Y 2;  1YHQ Z;  4A3D I;  2PMZ A;  3CC7 1;  4NBD A;  2R93 I;  1WCM I;  5IT9 f;  2M48 A;  3G71 Z;  4MD8 A;  3ESW A;  4E2X A;  4A3F I;  2QLV B;  4HGZ A;  2B63 I;  1RLY A;  3CCR Z;  1N8R 2;  3RZD I;  2OTL Z;  1L1O C;  5C3E I;  1K73 1;  2JIQ A;  4RVH A;  3GTM I;  3GTK I;  3I4M I;  2NAP A;  1DL6 A;  4RVF A;  3CXC Z;  1VQ7 Z;  1YUK A;  3CMA Z;  2RIQ A;  2E2H I;  2OTJ Z;  5D1P A;  1Q82 2;  3G6E Z;  3CCV Z;  3GKQ A;  3CXC Y;  1YJ9 Z;  1Y1W I;  3JAM f;  3I56 Z;  1M1K 1;  1Y8C A;  4BY1 I;  2VUG A;  1K9M 1;  1VQK Z;  1KD1 2;  3G4S 1;  4NFR A;  3CPW Z;  2OTL 1;  3F3P C;  2VPW A;  2RPR A;  3MON A;  2KPI A;  1Q81 1;  1NJI 2;  1ZH1 A;  5D1O A;  3CC4 1;  3CPW Y;  1M90 1;  1VQ7 1;  4NBB A;  3CMA 1;  2RT9 A;  3H0G I;  2R92 I;  2OTJ 1;  2QA4 Z;  3G6E 1;  3CCV 1;  2F4M A;  4RVD A;  4MH4 A;  1ML8 A;  1YJ9 1;  3GTP I;  3CC2 Z;  2WAQ A;  3CCE Z;  1YJN Z;  2DE7 A;  1TWC I;  4E2W A;  2LEX A;  4A3B I;  3S2D I;  1VQK 1;  2G2K A;  4QTU A;  4NOZ A;  4DK1 A;  4NBG A;  3HOX I;  5IT9 b;  3CCM Z;  1YIT Z;  1SFO I;  1I3Q I;  2JIM A;  5AN9 F;  3J80 b;  2O53 A;  1USP A;  2GU2 A;  1QVF Z;  3IX0 A;  2M6N A;  4AYB A;  1Z03 A;  2JR6 A;  2OZK A;  2OOY B;  1W2B Z;  3BG1 B;  5D1O B;  3GCF A;  1QYP A;  2QA4 1;  2R7Z I;  1QVF Y;  4A3L I;  1RNI A;  1QXF A;  1TWH I;  1W2B Y;  3CCQ Z;  3S16 I;  3CC2 1;  1YJN 1;  3FQM A;  3NH8 A;  3CCM 1;  1YIT 1;  1KRL A;  1VQL Z;  2V8J A;  1KC8 2;  1USP B;  4E33 A;  4A3I I;  3G4S Z;  2JA7 I;  1TWG I;  1LQL A;  2O4H A;  4DGL A;  1RQF A;  2I3C A;  2QRE B;  3EER A;  1FDI A;  3S15 I;  2E7Z A;  3NDJ A;  4NH1 C;  1VQ4 Z;  3CCJ 1;  4NBA A;  4A3M I;  5CM2 M;  1VQ9 Z;  3CC4 Z;  3CCQ 1;  2JUB A;  1VQO Z;  3J7A 4;  3NH4 A;  2W03 A;  2WB1 A;  1VQP Z;  4BBS I;  3TE5 B;  5IP7 I;  3J81 f;  1VQL 1;  4RV9 A;  4XX2 A;  4QTT A;  2YU9 I;  2VPX A;  2JNY A;  1ZB9 A;  1YUA A;  3F3F C;  1SIW A;  1Q86 1;  5FLX f;  2QEX Z;  3HOU I;  3T4N B;  5A2Q f;  2AYD A;  3OW2 Z;  1VQ4 1;  4BXX I;  3CQZ I;  1VQ9 1;  2BJO A;  1Q7Y 1;  2ZAE B;  3HKZ A;  2OOX B;  2R6M A;  2YAD A;  3CCL Z;  2V8I A;  1VQO 1;  2RBL A;  4A93 I;  1VQP 1;  3OW2 Y;  3D6W A;  1N8R 1;  4MD7 A;  1I50 I;  1JJ2 Z;  3HOY I;  3U50 C;  3VMI A;  1VQ5 Z;  3CME Z;  2P28 A;  3GTQ I;  1JJ2 Y;  1RO4 A;  2EGT A;  2QEX 1;  2GTI A;  3PO3 S;  3HOZ I;  4MD9 A;  1TWA I;  3PO2 I;  3VMG A;  4RVG A;  3GTG I;  2J6A A;  3GTJ I;  1Z02 A;  2KI7 B;  3VB9 A;  1K73 2;  1KQS Z;  3S1N I;  2PK7 A;  1VQ8 Z;  2VPZ A;  3CCL 1;  1S72 Z;  4X6A I;  1Q16 A;  2JIO A;  4RS4 A;  2JA5 I;  1R9T I;  5C4J I;  3S14 I;  1QF8 A;  1AA6 A;  3S2H I;  3CCJ Z;  3FQQ A;  2V3V A;  1KD1 1;  1KQS Y;  2NVQ I;  4A3C I;  1K8A 1;  1NJI 1;  1VQ5 1;  3CME 1;  3D2L A;  3HOW I;  4HGY A;  2IV2 X;  1P9N A;  2HU9 A;  3JAM b;  1RO2 A;  3IR7 A;  1PFT A;  1M1K 2;  2Q51 A;  1X3W A;  3QWU A;  2P3Y A;  1K9M 2;  2VPY A;  2DE5 A;  2GTH A;  1VQM Z;  4MXU A;  2JIR A;  4TNU A;  5FLX b;  5FLM I;  1Q81 2;  2JIP A;  2E2I I;  1VQ8 1;  1X0T A;  3M3Y I;  1S72 1;  1WZN A;  4BY7 I;  3CD6 Z;  1RO0 A;  2W04 A;  5C4X I;  1M90 2;  3S1M I;  3K7A I;  1I6H I;  3MZL B;  2F4O A;  3D9X A;  2E2J I;  3PO3 I;  2JS4 A;  3J80 f;  2HF1 A;  1K83 I;  4NBE A;  2V8K A;  3CCU Z;  1Z01 A;  3IFU A;  2VF1 A;  1NUI A;  4BBR I;  3P5J B;  4E32 A;  4MRI A;  1Y1V S;  3LUS A;  3NDI A;  3IF8 A;  3S1Q I;  1VQM 1;  5C44 I;  4E30 A;  1VQN Z;  1WJ2 A;  2DE6 A;  1QVG Z;  3RZO I;  1VQ6 Z;  1WII A;  4NB9 A;  3CD6 1;  4E2Z A;  5T64 A;  1YHQ 1;  3NH5 A;  5LL6 f;  1QVG Y;  3G71 1;  1KC8 1;  2Y0S A;  2NVT I;  3CCS Z;  3CCR 1;  1JWH C;  3CCU 1;  4A3J I;  2NVX I;  2H85 A;  3Q87 A;  2JA8 I;  4HH4 A;  1YI2 Z;  1K8A 2;  3I07 A;  1YIJ Z;  2IZ4 A;  3VMH A;  2VUM I;  3M4O I;  3NFZ A;  4NBC A;  5T6B A;  2RHB A;  4E31 A;  4EWC A;  3S17 I;  1YJW Z;  2AKL A;  2NVY I;  3TDH B;  1VQN 1;  3BG0 B;  4NBF A;  3I55 Z;  1VQ6 1;  4Y7N I;  1Q82 1;  3GTL I;  3S1R I;  3I56 1;  4CL1 A;  2K5R A;  1X3Z A;  3MZK B;  4Y52 I;  1Y1V I;  4A3K I;  4DQY B;  3KIF A;  1FDO A;  4S1T A;  3GTM S;  2LFU A;  2QRC B;  1N2F A;  1ZB8 A;  2IZ3 A;  3CCS 1;  4E2Y A;  1VLA A;  2JMO A;  1TFI A;  3CC7 Z;  1YI2 1;  4A3G I;  2LIY A;  1YIJ 1;  2QRD B;  3KIH A;  3FKI I;  3J81 b;  2JA6 I;  3GTO I;  3VTN A;  1YJW 1;  3I4N I;  2QR1 B;  2V45 A;  5T67 A;  2K3R A;  3I55 1;  4A3E I;  4NBH A;  1TWF I;  1S7M A;  2QKD A;  5IP9 I;  1Q86 2;  4NB8 A;  3CCE 1;  2Q4Z A;  3HOV I;  2E9H A;  5A2Q b;  2PM9 A;  3EED A;  4MON A;  3H3V J;  1WW9 A;  1NP6 A; 
#chains in the Genus database with same CATH homology
 1Q7Y 2;  1YHQ Z;  4A3D I;  2PMZ A;  3CC7 1;  4NBD A;  2R93 I;  1WCM I;  5IT9 f;  2M48 A;  3G71 Z;  4MD8 A;  3ESW A;  4E2X A;  4A3F I;  2QLV B;  4HGZ A;  2B63 I;  1RLY A;  3CCR Z;  1N8R 2;  3RZD I;  2OTL Z;  1L1O C;  5C3E I;  1K73 1;  4RVH A;  3GTM I;  3GTK I;  3I4M I;  1DL6 A;  4RVF A;  3CXC Z;  1VQ7 Z;  1YUK A;  3CMA Z;  2RIQ A;  2E2H I;  2OTJ Z;  5D1P A;  1Q82 2;  3G6E Z;  3CCV Z;  3GKQ A;  3CXC Y;  1YJ9 Z;  1Y1W I;  3JAM f;  3I56 Z;  1M1K 1;  4BY1 I;  2VUG A;  1K9M 1;  1VQK Z;  1KD1 2;  3G4S 1;  4NFR A;  3CPW Z;  2OTL 1;  3F3P C;  2RPR A;  3MON A;  2KPI A;  1Q81 1;  1NJI 2;  1ZH1 A;  5D1O A;  3CC4 1;  3CPW Y;  1M90 1;  1VQ7 1;  4NBB A;  3CMA 1;  2RT9 A;  3H0G I;  2R92 I;  2OTJ 1;  2QA4 Z;  3G6E 1;  3CCV 1;  2F4M A;  4RVD A;  4MH4 A;  1ML8 A;  1YJ9 1;  3GTP I;  3CC2 Z;  2WAQ A;  3CCE Z;  1YJN Z;  2DE7 A;  1TWC I;  4E2W A;  4A3B I;  3S2D I;  1VQK 1;  2G2K A;  4QTU A;  4NOZ A;  4DK1 A;  4NBG A;  3HOX I;  5IT9 b;  3CCM Z;  1YIT Z;  1SFO I;  1I3Q I;  5AN9 F;  3J80 b;  2O53 A;  1USP A;  2GU2 A;  1QVF Z;  3IX0 A;  2M6N A;  4AYB A;  1Z03 A;  2JR6 A;  2OZK A;  2OOY B;  1W2B Z;  3BG1 B;  5D1O B;  3GCF A;  1QYP A;  2QA4 1;  2R7Z I;  1QVF Y;  4A3L I;  1RNI A;  1TWH I;  1W2B Y;  3CCQ Z;  3S16 I;  3CC2 1;  1YJN 1;  3FQM A;  3NH8 A;  3CCM 1;  1YIT 1;  1KRL A;  1VQL Z;  2V8J A;  1KC8 2;  1USP B;  4E33 A;  4A3I I;  3G4S Z;  2JA7 I;  1TWG I;  1LQL A;  2O4H A;  4DGL A;  1RQF A;  2I3C A;  2QRE B;  3EER A;  3S15 I;  3NDJ A;  4NH1 C;  1VQ4 Z;  3CCJ 1;  4NBA A;  4A3M I;  5CM2 M;  1VQ9 Z;  3CC4 Z;  3CCQ 1;  2JUB A;  1VQO Z;  3J7A 4;  3NH4 A;  2W03 A;  2WB1 A;  1VQP Z;  4BBS I;  3TE5 B;  5IP7 I;  3J81 f;  1VQL 1;  4RV9 A;  4XX2 A;  4QTT A;  2YU9 I;  2JNY A;  1ZB9 A;  1YUA A;  3F3F C;  1Q86 1;  5FLX f;  2QEX Z;  3HOU I;  3T4N B;  5A2Q f;  3OW2 Z;  1VQ4 1;  4BXX I;  3CQZ I;  1VQ9 1;  2BJO A;  1Q7Y 1;  2ZAE B;  3HKZ A;  2OOX B;  2R6M A;  2YAD A;  3CCL Z;  2V8I A;  1VQO 1;  2RBL A;  4A93 I;  1VQP 1;  3OW2 Y;  3D6W A;  1N8R 1;  4MD7 A;  1I50 I;  1JJ2 Z;  3HOY I;  3U50 C;  3VMI A;  1VQ5 Z;  3CME Z;  2P28 A;  3GTQ I;  1JJ2 Y;  1RO4 A;  2EGT A;  2QEX 1;  2GTI A;  3PO3 S;  3HOZ I;  4MD9 A;  1TWA I;  3PO2 I;  3VMG A;  4RVG A;  3GTG I;  2J6A A;  3GTJ I;  1Z02 A;  2KI7 B;  3VB9 A;  1K73 2;  1KQS Z;  3S1N I;  2PK7 A;  1VQ8 Z;  3CCL 1;  1S72 Z;  4X6A I;  2JA5 I;  4RS4 A;  1R9T I;  5C4J I;  3S14 I;  1QF8 A;  3S2H I;  3CCJ Z;  3FQQ A;  1KD1 1;  1KQS Y;  2NVQ I;  4A3C I;  1K8A 1;  1NJI 1;  1VQ5 1;  3CME 1;  3HOW I;  4HGY A;  1P9N A;  2HU9 A;  3JAM b;  1RO2 A;  1PFT A;  1M1K 2;  2Q51 A;  1X3W A;  3QWU A;  2P3Y A;  1K9M 2;  2DE5 A;  2GTH A;  1VQM Z;  4MXU A;  4TNU A;  5FLX b;  5FLM I;  1Q81 2;  2E2I I;  1VQ8 1;  1X0T A;  3M3Y I;  1S72 1;  4BY7 I;  3CD6 Z;  1RO0 A;  2W04 A;  5C4X I;  1M90 2;  3S1M I;  3K7A I;  1I6H I;  3MZL B;  2F4O A;  3D9X A;  2E2J I;  3PO3 I;  2JS4 A;  3J80 f;  2HF1 A;  1K83 I;  4NBE A;  2V8K A;  3CCU Z;  1Z01 A;  3IFU A;  2VF1 A;  1NUI A;  4BBR I;  3P5J B;  4E32 A;  4MRI A;  1Y1V S;  3LUS A;  3NDI A;  3IF8 A;  3S1Q I;  1VQM 1;  5C44 I;  4E30 A;  1VQN Z;  2DE6 A;  1QVG Z;  3RZO I;  1VQ6 Z;  1WII A;  4NB9 A;  3CD6 1;  4E2Z A;  5T64 A;  1YHQ 1;  3NH5 A;  5LL6 f;  1QVG Y;  3G71 1;  1KC8 1;  2Y0S A;  2NVT I;  3CCS Z;  3CCR 1;  1JWH C;  3CCU 1;  4A3J I;  2NVX I;  2H85 A;  3Q87 A;  2JA8 I;  4HH4 A;  1YI2 Z;  1K8A 2;  3I07 A;  1YIJ Z;  2IZ4 A;  3VMH A;  2VUM I;  3M4O I;  3NFZ A;  4NBC A;  5T6B A;  2RHB A;  4E31 A;  4EWC A;  3S17 I;  1YJW Z;  2AKL A;  2NVY I;  3TDH B;  1VQN 1;  3BG0 B;  4NBF A;  3I55 Z;  1VQ6 1;  4Y7N I;  1Q82 1;  3GTL I;  3S1R I;  3I56 1;  4CL1 A;  2K5R A;  1X3Z A;  3MZK B;  4Y52 I;  1Y1V I;  4A3K I;  4DQY B;  3KIF A;  4S1T A;  3GTM S;  2LFU A;  2QRC B;  1N2F A;  1ZB8 A;  2IZ3 A;  3CCS 1;  4E2Y A;  1VLA A;  2JMO A;  1TFI A;  3CC7 Z;  1YI2 1;  4A3G I;  2LIY A;  1YIJ 1;  2QRD B;  3KIH A;  3FKI I;  3J81 b;  2JA6 I;  3GTO I;  3VTN A;  1YJW 1;  3I4N I;  2QR1 B;  5T67 A;  2K3R A;  3I55 1;  4A3E I;  4NBH A;  1TWF I;  1S7M A;  2QKD A;  5IP9 I;  1Q86 2;  4NB8 A;  3CCE 1;  2Q4Z A;  3HOV I;  2E9H A;  5A2Q b;  2PM9 A;  3EED A;  4MON A;  3H3V J;  1WW9 A;  1NP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...