4A3CI

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 15
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3cI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4a3cI02
4NBDA 3GTJI 1K83I 1LQLA 2DE5A 2P3YA 1Y1WI 1ZB9A 2AKLA 3S15I 2E2II 5C44I 2R7ZI 4A3LI 3EERA 1X3WA 3FKII 1R9TI 2K5RA 3H0GI 2R92I 3M4OI 3S1NI 3GTMI 5C4XI 4BBRI 4A3BI 1WW9A 3I07A 2JA7I 4A3FI 4NB8A 4XX2A 3GTKI 1RLYA 3HOYI 4BBSI 1I3QI 4A3MI 2R93I 2BJOA 2F4OA 3S14I 4BY1I 3S1MI 5CM2M 1N2FA 5C4JI 1X3ZA 3PO2I 5C3EI 3PO3I 4QTTA 2NVTI 4A3CI 1USPA 2PK7A 3GTLI 2JA8I 3GCFA 3VMHA 5IP9I 3Q87A 2JA5I 3S1RI 3VMGA 2NVXI 1Y1VS 2JR6A 1YUAA 3I4NI 1TWHI 2HF1A 2J6AA 3S2DI 1PFTA 3HOVI 3GTGI 2VUMI 3PO3S 2NVQI 1TWAI 1ZB8A 2DE6A 4NBCA 3HOWI 1VLAA 3S2HI 3K7AI 2E2HI 2JNYA 4NBEA 4A3II 4A3EI 3H3VJ 4A3GI 2E2JI 3M3YI 2JA6I 3GTMS 3D6WA 3RZDI 3U50C 4A93I 3HOUI 1I50I 3ESWA 1QYPA 2KPIA 1L1OC 1RO4A 2YU9I 1SFOI 4NBAA 2F4MA 4NBBA 3S16I 4A3KI 3I4MI 2B63I 4Y52I 3HOXI 4NB9A 3S1QI 4BXXI 3RZOI 2RBLA 3HOZI 1TWFI 4MH4A 4NBHA 3GTPI 1I6HI 4X6AI 2JS4A 3LUSA 2DE7A 3GKQA 4NBGA 2NVYI 3GTQI 3S17I 1ML8A 1NUIA 5IP7I 4NOZA 4A3DI 3VMIA 1TFIA 3CQZI 1TWGI 1USPB 1TWCI 4BY7I 3VB9A 4QTUA 3GTOI 4A3JI 4Y7NI 4NBFA 5FLMI 1Y1VI 1WCMI 1DL6A
chains in the Genus database with same CATH superfamily
1Q822 4NBDA 3I55Z 5T6BA 1Y1WI 3CMAZ 1ZB9A 2QEXZ 1M1K1 2VPWA 3CCS1 2R7ZI 1X0TA 4RS4A 4MRIA 3OW2Z 3H0GI 2GTHA 4NFRA 3GTMI 5C4XI 2QA4Z 3FQMA 1YJN1 4A3BI 1YIJ1 1VQL1 3CCJZ 4EWCA 1KD11 1Z03A 3CCVZ 1Q7Y1 4XX2A 3BG1B 4DK1A 1YUKA 1VQ8Z 4CL1A 1VQO1 5CM2M 1X3ZA 1YIT1 1SIWA 1QF8A 3CC2Z 4DQYB 1NJI1 3GCFA 1Y1VS 3JAMb 2JMOA 2RHBA 4HGZA 3TE5B 3JAMf 1VQ7Z 1PFTA 4MONA 3FQQA 1S7MA 3MZKB 2W04A 2OOXB 2JIRA 1RO0A 2RIQA 2JNYA 3G6EZ 4E2YA 3GTMS 3RZDI 2I3CA 2OTLZ 4RVDA 4A93I 3CCMZ 3ESWA 1Q812 3CD6Z 2JIQA 4NBAA 3S16I 1K9M2 2QRDB 3P5JB 2B63I 1QVGY 1KQSY 4MD8A 4Y52I 3RZOI 3VTNA 1TWFI 4MH4A 4NBHA 2HU9A 3LUSA 3J80b 1JWHC 3GKQA 3J80f 1YJWZ 2NVYI 3GTQI 3F3PC 1K8A2 4MD9A 2LFUA 2E7ZA 2JIPA 1TFIA 1VQP1 3CQZI 2V3VA 1TWCI 3F3FC 3CCE1 3NFZA 4AYBA 4A3JI 3CC4Z 2VPYA 1VQK1 2LEXA 2VPZA 5T67A 4DGLA 1YJ9Z 1YI21 3GTJI 3G4SZ 2QKDA 1KQSZ 2P3YA 2KI7B 3CCL1 1VQ41 5IT9b 3OW2Y 3CPWZ 1S72Z 2OTJZ 4A3LI 3EERA 3J81f 3FKII 4NH1C 1R9TI 3MONA 1Q16A 4MXUA 4BBRI 3G4S1 5A2Qb 1WZNA 2V8KA 3CCSZ 2JA7I 3GTKI 3S14I 4BY1I 5C4JI 2H85A 1YJNZ 1YIJZ 3PO2I 5C3EI 1VQLZ 4QTTA 2NVTI 2NAPA 5D1PA 1YHQ1 3Q87A 3S1RI 2PMZA 1VQOZ 1W2BY 1QVFY 1YUAA 3I4NI 2P28A 1YITZ 1M1K2 4S1TA 3HOVI 2VUMI 3IFUA 1K731 3IF8A 1TWAI 1ZB8A 3CCQ1 1KRLA 3HOWI 1VLAA 2M48A 3S2HI 4NBEA 3EEDA 3CME1 1KD12 3NDJA 2JA6I 1VQ91 1Z01A 1WIIA 5D1OA 1RO4A 4NBBA 3J7A4 1Z02A 3HOXI 1W2BZ 1NJI2 1QVFZ 4BXXI 2JS4A 2VPXA 2G2KA 3NH5A 1VQ51 2IV2X 2IZ3A 1VQ61 3KIHA 5IP7I 5AN9F 3VMIA 1M901 1AA6A 1FDOA 4E33A 3GTOI 4Y7NI 2Y0SA 2Q4ZA 3TDHB 1VQPZ 2IZ4A 2R6MA 2JIMA 2GU2A 3CCEZ 3CC7Z 2E9HA 3CPWY 1VQKZ 2O53A 2E2II 5C44I 1N8R1 1Q861 4RVHA 1YI2Z 2QREB 2R92I 3S1NI 4E32A 3CC71 3CCLZ 1VQ4Z 3I561 3I07A 4NB8A 3HOYI 1RLYA 4BBSI 5FLXb 3CCU1 2QRCB 2BJOA 2F4OA 3S1MI 1N2FA 1WJ2A 5LL6f 5IT9f 1USPA 2PK7A 2JA8I 3VMHA 2JA5I 3VMGA 2JR6A 2VF1A 2YADA 5A2Qf 3PO3S 2NVQI 3NH8A 1YHQZ 2DE6A 1KC81 2V45A 2WB1A 2K3RA 4E30A 3K7AI 4A3II 4MD7A 4A3EI 3IR7A 4A3GI 2E2JI 4RVGA 1JJ2Z 1P9NA 3HOUI 2Q51A 3G711 3CCQZ 3HKZA 1Q821 1QYPA 2KPIA 1FDIA 3CMEZ 2F4MA 3CXCZ 1VQ9Z 5T64A 2PM9A 3BG0B 3HOZI 3GTPI 1I6HI 4X6AI 2RT9A 2GTIA 4HGYA 4NBGA 1K732 3S17I 1NUIA 3NH4A 3QWUA 1Q7Y2 4NOZA 4A3DI 1VQNZ 3CCRZ 3D9XA 3I551 1VQ5Z 2WAQA 3CMA1 4NBFA 2QEX1 1VQ6Z 1DL6A 2VUGA 1VQN1 2JIOA 1K83I 3CCR1 1LQLA 2QR1B 2DE5A 2QA41 2OOYB 3NDIA 1RO2A 2AKLA 3S15I 3CCJ1 4E2WA 3CCV1 1X3WA 2K5RA 1Y8CA 5D1OB 1VQ81 3M4OI 1WW9A 3MZLB 4RVFA 4A3FI 1M902 3CC21 1I3QI 4E31A 4A3MI 2R93I 2O4HA 1Q811 3I56Z 3PO3I 1NP6A 4HH4A 1RNIA 1VQ71 4A3CI 1K9M1 4RV9A 3GTLI 5IP9I 3CCUZ 2LIYA 2NVXI 1TWHI 2HF1A 2J6AA 3S2DI 3G6E1 1N8R2 1Q862 3GTGI 1K8A1 2OTL1 1VQMZ 3CCM1 4NBCA 3CD61 1JJ2Y 5FLXf 2E2HI 3H3VJ 2W03A 3KIFA 3M3YI 3D6WA 3U50C 2V8IA 2JUBA 1I50I 1QXFA 1VQM1 3CXCY 2AYDA 3IX0A 1L1OC 2YU9I 1SFOI 4A3KI 4E2ZA 1YJW1 3I4MI 4NB9A 3S1QI 2OZKA 2RBLA 3G71Z 1ZH1A 2QLVB 4E2XA 1QVGZ 3T4NB 3CC41 2DE7A 4TNUA 2V8JA 3J81b 1ML8A 2M6NA 1KC82 1TWGI 1USPB 1YJ91 2RPRA 4BY7I 3VB9A 4QTUA 3D2LA 1RQFA 5FLMI 1Y1VI 2ZAEB 1S721 2OTJ1 2EGTA 1WCMI
chains in the Genus database with same CATH topology
1Q822 4NBDA 3I55Z 5T6BA 1Y1WI 3CMAZ 1ZB9A 2QEXZ 1M1K1 3CCS1 2R7ZI 1X0TA 4RS4A 4MRIA 3OW2Z 3H0GI 2GTHA 4NFRA 3GTMI 5C4XI 2QA4Z 3FQMA 1YJN1 4A3BI 1YIJ1 1VQL1 3CCJZ 4EWCA 1KD11 1Z03A 3CCVZ 1Q7Y1 4XX2A 3BG1B 4DK1A 1YUKA 1VQ8Z 4CL1A 1VQO1 5CM2M 1X3ZA 1YIT1 1QF8A 3CC2Z 4DQYB 1NJI1 3GCFA 1Y1VS 3JAMb 2JMOA 2RHBA 4HGZA 3TE5B 3JAMf 1VQ7Z 1PFTA 4MONA 3FQQA 1S7MA 3MZKB 2W04A 2OOXB 1RO0A 2RIQA 2JNYA 3G6EZ 4E2YA 3GTMS 3RZDI 2I3CA 2OTLZ 4RVDA 4A93I 3CCMZ 3ESWA 1Q812 3CD6Z 4NBAA 3S16I 1K9M2 2QRDB 3P5JB 2B63I 1QVGY 1KQSY 4MD8A 4Y52I 3RZOI 3VTNA 1TWFI 4MH4A 4NBHA 2HU9A 3LUSA 3J80b 1JWHC 3GKQA 3J80f 1YJWZ 2NVYI 3GTQI 3F3PC 1K8A2 4MD9A 2LFUA 1TFIA 1VQP1 3CQZI 1TWCI 3F3FC 3CCE1 3NFZA 4AYBA 4A3JI 3CC4Z 1VQK1 5T67A 4DGLA 1YJ9Z 1YI21 3GTJI 3G4SZ 2QKDA 1KQSZ 2P3YA 2KI7B 3CCL1 1VQ41 5IT9b 3OW2Y 3CPWZ 1S72Z 2OTJZ 4A3LI 3EERA 3J81f 3FKII 4NH1C 1R9TI 3MONA 4MXUA 4BBRI 3G4S1 5A2Qb 2V8KA 3CCSZ 2JA7I 3GTKI 3S14I 4BY1I 5C4JI 2H85A 1YJNZ 1YIJZ 3PO2I 5C3EI 1VQLZ 4QTTA 2NVTI 5D1PA 1YHQ1 3Q87A 3S1RI 2PMZA 1VQOZ 1W2BY 1QVFY 1YUAA 3I4NI 2P28A 1YITZ 1M1K2 4S1TA 3HOVI 2VUMI 3IFUA 1K731 3IF8A 1TWAI 1ZB8A 3CCQ1 1KRLA 3HOWI 1VLAA 2M48A 3S2HI 4NBEA 3EEDA 3CME1 1KD12 3NDJA 2JA6I 1VQ91 1Z01A 1WIIA 5D1OA 1RO4A 4NBBA 3J7A4 1Z02A 3HOXI 1W2BZ 1NJI2 1QVFZ 4BXXI 2JS4A 2G2KA 3NH5A 1VQ51 2IZ3A 1VQ61 3KIHA 5IP7I 5AN9F 3VMIA 1M901 4E33A 3GTOI 4Y7NI 2Y0SA 2Q4ZA 3TDHB 1VQPZ 2IZ4A 2R6MA 2GU2A 3CCEZ 3CC7Z 2E9HA 3CPWY 1VQKZ 2O53A 2E2II 5C44I 1N8R1 1Q861 4RVHA 1YI2Z 2QREB 2R92I 3S1NI 4E32A 3CC71 3CCLZ 1VQ4Z 3I561 3I07A 4NB8A 3HOYI 1RLYA 4BBSI 5FLXb 3CCU1 2QRCB 2BJOA 2F4OA 3S1MI 1N2FA 5LL6f 5IT9f 1USPA 2PK7A 2JA8I 3VMHA 2JA5I 3VMGA 2JR6A 2VF1A 2YADA 5A2Qf 3PO3S 2NVQI 3NH8A 1YHQZ 2DE6A 1KC81 2WB1A 2K3RA 4E30A 3K7AI 4A3II 4MD7A 4A3EI 4A3GI 2E2JI 4RVGA 1JJ2Z 1P9NA 3HOUI 2Q51A 3G711 3CCQZ 3HKZA 1Q821 1QYPA 2KPIA 3CMEZ 2F4MA 3CXCZ 1VQ9Z 5T64A 2PM9A 3BG0B 3HOZI 3GTPI 1I6HI 4X6AI 2RT9A 2GTIA 4HGYA 4NBGA 1K732 3S17I 1NUIA 3NH4A 3QWUA 1Q7Y2 4NOZA 4A3DI 1VQNZ 3CCRZ 3D9XA 3I551 1VQ5Z 2WAQA 3CMA1 4NBFA 2QEX1 1VQ6Z 1DL6A 2VUGA 1VQN1 1K83I 3CCR1 1LQLA 2QR1B 2DE5A 2QA41 2OOYB 3NDIA 1RO2A 2AKLA 3S15I 3CCJ1 4E2WA 3CCV1 1X3WA 2K5RA 1VQ81 5D1OB 3M4OI 1WW9A 3MZLB 4RVFA 4A3FI 1M902 3CC21 1I3QI 4E31A 4A3MI 2R93I 2O4HA 1Q811 3I56Z 3PO3I 1NP6A 4HH4A 1RNIA 1VQ71 4A3CI 1K9M1 4RV9A 3GTLI 5IP9I 3CCUZ 2LIYA 2NVXI 1TWHI 2HF1A 2J6AA 3S2DI 3G6E1 1N8R2 1Q862 3GTGI 1K8A1 2OTL1 1VQMZ 3CCM1 4NBCA 3CD61 1JJ2Y 5FLXf 2E2HI 3H3VJ 2W03A 3KIFA 3M3YI 3D6WA 3U50C 2V8IA 2JUBA 1I50I 1VQM1 3CXCY 3IX0A 1L1OC 2YU9I 1SFOI 4A3KI 4E2ZA 1YJW1 3I4MI 4NB9A 3S1QI 2OZKA 2RBLA 3G71Z 1ZH1A 2QLVB 4E2XA 1QVGZ 3T4NB 3CC41 2DE7A 4TNUA 2V8JA 3J81b 1ML8A 2M6NA 1KC82 1TWGI 1USPB 1YJ91 2RPRA 4BY7I 3VB9A 4QTUA 1RQFA 5FLMI 1Y1VI 2ZAEB 1S721 2OTJ1 2EGTA 1WCMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBD A;  3GTJ I;  1K83 I;  1LQL A;  2DE5 A;  2P3Y A;  1Y1W I;  1ZB9 A;  2AKL A;  3S15 I;  2E2I I;  5C44 I;  2R7Z I;  4A3L I;  3EER A;  1X3W A;  3FKI I;  1R9T I;  2K5R A;  3H0G I;  2R92 I;  3M4O I;  3S1N I;  3GTM I;  5C4X I;  4BBR I;  4A3B I;  1WW9 A;  3I07 A;  2JA7 I;  4A3F I;  4NB8 A;  4XX2 A;  3GTK I;  1RLY A;  3HOY I;  4BBS I;  1I3Q I;  4A3M I;  2R93 I;  2BJO A;  2F4O A;  3S14 I;  4BY1 I;  3S1M I;  5CM2 M;  1N2F A;  5C4J I;  1X3Z A;  3PO2 I;  5C3E I;  3PO3 I;  4QTT A;  2NVT I;  4A3C I;  1USP A;  2PK7 A;  3GTL I;  2JA8 I;  3GCF A;  3VMH A;  5IP9 I;  3Q87 A;  2JA5 I;  3S1R I;  3VMG A;  2NVX I;  1Y1V S;  2JR6 A;  1YUA A;  3I4N I;  1TWH I;  2HF1 A;  2J6A A;  3S2D I;  1PFT A;  3HOV I;  3GTG I;  2VUM I;  3PO3 S;  2NVQ I;  1TWA I;  1ZB8 A;  2DE6 A;  4NBC A;  3HOW I;  1VLA A;  3S2H I;  3K7A I;  2E2H I;  2JNY A;  4NBE A;  4A3I I;  4A3E I;  3H3V J;  4A3G I;  2E2J I;  3M3Y I;  2JA6 I;  3GTM S;  3D6W A;  3RZD I;  3U50 C;  4A93 I;  3HOU I;  1I50 I;  3ESW A;  1QYP A;  2KPI A;  1L1O C;  1RO4 A;  2YU9 I;  1SFO I;  4NBA A;  2F4M A;  4NBB A;  3S16 I;  4A3K I;  3I4M I;  2B63 I;  4Y52 I;  3HOX I;  4NB9 A;  3S1Q I;  4BXX I;  3RZO I;  2RBL A;  3HOZ I;  1TWF I;  4MH4 A;  4NBH A;  3GTP I;  1I6H I;  4X6A I;  2JS4 A;  3LUS A;  2DE7 A;  3GKQ A;  4NBG A;  2NVY I;  3GTQ I;  3S17 I;  1ML8 A;  1NUI A;  5IP7 I;  4NOZ A;  4A3D I;  3VMI A;  1TFI A;  3CQZ I;  1TWG I;  1USP B;  1TWC I;  4BY7 I;  3VB9 A;  4QTU A;  3GTO I;  4A3J I;  4Y7N I;  4NBF A;  5FLM I;  1Y1V I;  1WCM I;  1DL6 A; 
#chains in the Genus database with same CATH topology
 1Q82 2;  4NBD A;  3I55 Z;  5T6B A;  1Y1W I;  3CMA Z;  1ZB9 A;  2QEX Z;  1M1K 1;  2VPW A;  3CCS 1;  2R7Z I;  1X0T A;  4RS4 A;  4MRI A;  3OW2 Z;  3H0G I;  2GTH A;  4NFR A;  3GTM I;  5C4X I;  2QA4 Z;  3FQM A;  1YJN 1;  4A3B I;  1YIJ 1;  1VQL 1;  3CCJ Z;  4EWC A;  1KD1 1;  1Z03 A;  3CCV Z;  1Q7Y 1;  4XX2 A;  3BG1 B;  4DK1 A;  1YUK A;  1VQ8 Z;  4CL1 A;  1VQO 1;  5CM2 M;  1X3Z A;  1YIT 1;  1SIW A;  1QF8 A;  3CC2 Z;  4DQY B;  1NJI 1;  3GCF A;  1Y1V S;  3JAM b;  2JMO A;  2RHB A;  4HGZ A;  3TE5 B;  3JAM f;  1VQ7 Z;  1PFT A;  4MON A;  3FQQ A;  1S7M A;  3MZK B;  2W04 A;  2OOX B;  2JIR A;  1RO0 A;  2RIQ A;  2JNY A;  3G6E Z;  4E2Y A;  3GTM S;  3RZD I;  2I3C A;  2OTL Z;  4RVD A;  4A93 I;  3CCM Z;  3ESW A;  1Q81 2;  3CD6 Z;  2JIQ A;  4NBA A;  3S16 I;  1K9M 2;  2QRD B;  3P5J B;  2B63 I;  1QVG Y;  1KQS Y;  4MD8 A;  4Y52 I;  3RZO I;  3VTN A;  1TWF I;  4MH4 A;  4NBH A;  2HU9 A;  3LUS A;  3J80 b;  1JWH C;  3GKQ A;  3J80 f;  1YJW Z;  2NVY I;  3GTQ I;  3F3P C;  1K8A 2;  4MD9 A;  2LFU A;  2E7Z A;  2JIP A;  1TFI A;  1VQP 1;  3CQZ I;  2V3V A;  1TWC I;  3F3F C;  3CCE 1;  3NFZ A;  4AYB A;  4A3J I;  3CC4 Z;  2VPY A;  1VQK 1;  2LEX A;  2VPZ A;  5T67 A;  4DGL A;  1YJ9 Z;  1YI2 1;  3GTJ I;  3G4S Z;  2QKD A;  1KQS Z;  2P3Y A;  2KI7 B;  3CCL 1;  1VQ4 1;  5IT9 b;  3OW2 Y;  3CPW Z;  1S72 Z;  2OTJ Z;  4A3L I;  3EER A;  3J81 f;  3FKI I;  4NH1 C;  1R9T I;  3MON A;  1Q16 A;  4MXU A;  4BBR I;  3G4S 1;  5A2Q b;  1WZN A;  2V8K A;  3CCS Z;  2JA7 I;  3GTK I;  3S14 I;  4BY1 I;  5C4J I;  2H85 A;  1YJN Z;  1YIJ Z;  3PO2 I;  5C3E I;  1VQL Z;  4QTT A;  2NVT I;  2NAP A;  5D1P A;  1YHQ 1;  3Q87 A;  3S1R I;  2PMZ A;  1VQO Z;  1W2B Y;  1QVF Y;  1YUA A;  3I4N I;  2P28 A;  1YIT Z;  1M1K 2;  4S1T A;  3HOV I;  2VUM I;  3IFU A;  1K73 1;  3IF8 A;  1TWA I;  1ZB8 A;  3CCQ 1;  1KRL A;  3HOW I;  1VLA A;  2M48 A;  3S2H I;  4NBE A;  3EED A;  3CME 1;  1KD1 2;  3NDJ A;  2JA6 I;  1VQ9 1;  1Z01 A;  1WII A;  5D1O A;  1RO4 A;  4NBB A;  3J7A 4;  1Z02 A;  3HOX I;  1W2B Z;  1NJI 2;  1QVF Z;  4BXX I;  2JS4 A;  2VPX A;  2G2K A;  3NH5 A;  1VQ5 1;  2IV2 X;  2IZ3 A;  1VQ6 1;  3KIH A;  5IP7 I;  5AN9 F;  3VMI A;  1M90 1;  1AA6 A;  1FDO A;  4E33 A;  3GTO I;  4Y7N I;  2Y0S A;  2Q4Z A;  3TDH B;  1VQP Z;  2IZ4 A;  2R6M A;  2JIM A;  2GU2 A;  3CCE Z;  3CC7 Z;  2E9H A;  3CPW Y;  1VQK Z;  2O53 A;  2E2I I;  5C44 I;  1N8R 1;  1Q86 1;  4RVH A;  1YI2 Z;  2QRE B;  2R92 I;  3S1N I;  4E32 A;  3CC7 1;  3CCL Z;  1VQ4 Z;  3I56 1;  3I07 A;  4NB8 A;  3HOY I;  1RLY A;  4BBS I;  5FLX b;  3CCU 1;  2QRC B;  2BJO A;  2F4O A;  3S1M I;  1N2F A;  1WJ2 A;  5LL6 f;  5IT9 f;  1USP A;  2PK7 A;  2JA8 I;  3VMH A;  2JA5 I;  3VMG A;  2JR6 A;  2VF1 A;  2YAD A;  5A2Q f;  3PO3 S;  2NVQ I;  3NH8 A;  1YHQ Z;  2DE6 A;  1KC8 1;  2V45 A;  2WB1 A;  2K3R A;  4E30 A;  3K7A I;  4A3I I;  4MD7 A;  4A3E I;  3IR7 A;  4A3G I;  2E2J I;  4RVG A;  1JJ2 Z;  1P9N A;  3HOU I;  2Q51 A;  3G71 1;  3CCQ Z;  3HKZ A;  1Q82 1;  1QYP A;  2KPI A;  1FDI A;  3CME Z;  2F4M A;  3CXC Z;  1VQ9 Z;  5T64 A;  2PM9 A;  3BG0 B;  3HOZ I;  3GTP I;  1I6H I;  4X6A I;  2RT9 A;  2GTI A;  4HGY A;  4NBG A;  1K73 2;  3S17 I;  1NUI A;  3NH4 A;  3QWU A;  1Q7Y 2;  4NOZ A;  4A3D I;  1VQN Z;  3CCR Z;  3D9X A;  3I55 1;  1VQ5 Z;  2WAQ A;  3CMA 1;  4NBF A;  2QEX 1;  1VQ6 Z;  1DL6 A;  2VUG A;  1VQN 1;  2JIO A;  1K83 I;  3CCR 1;  1LQL A;  2QR1 B;  2DE5 A;  2QA4 1;  2OOY B;  3NDI A;  1RO2 A;  2AKL A;  3S15 I;  3CCJ 1;  4E2W A;  3CCV 1;  1X3W A;  2K5R A;  1Y8C A;  5D1O B;  1VQ8 1;  3M4O I;  1WW9 A;  3MZL B;  4RVF A;  4A3F I;  1M90 2;  3CC2 1;  1I3Q I;  4E31 A;  4A3M I;  2R93 I;  2O4H A;  1Q81 1;  3I56 Z;  3PO3 I;  1NP6 A;  4HH4 A;  1RNI A;  1VQ7 1;  4A3C I;  1K9M 1;  4RV9 A;  3GTL I;  5IP9 I;  3CCU Z;  2LIY A;  2NVX I;  1TWH I;  2HF1 A;  2J6A A;  3S2D I;  3G6E 1;  1N8R 2;  1Q86 2;  3GTG I;  1K8A 1;  2OTL 1;  1VQM Z;  3CCM 1;  4NBC A;  3CD6 1;  1JJ2 Y;  5FLX f;  2E2H I;  3H3V J;  2W03 A;  3KIF A;  3M3Y I;  3D6W A;  3U50 C;  2V8I A;  2JUB A;  1I50 I;  1QXF A;  1VQM 1;  3CXC Y;  2AYD A;  3IX0 A;  1L1O C;  2YU9 I;  1SFO I;  4A3K I;  4E2Z A;  1YJW 1;  3I4M I;  4NB9 A;  3S1Q I;  2OZK A;  2RBL A;  3G71 Z;  1ZH1 A;  2QLV B;  4E2X A;  1QVG Z;  3T4N B;  3CC4 1;  2DE7 A;  4TNU A;  2V8J A;  3J81 b;  1ML8 A;  2M6N A;  1KC8 2;  1TWG I;  1USP B;  1YJ9 1;  2RPR A;  4BY7 I;  3VB9 A;  4QTU A;  3D2L A;  1RQF A;  5FLM I;  1Y1V I;  2ZAE B;  1S72 1;  2OTJ 1;  2EGT A;  1WCM I; 
#chains in the Genus database with same CATH homology
 1Q82 2;  4NBD A;  3I55 Z;  5T6B A;  1Y1W I;  3CMA Z;  1ZB9 A;  2QEX Z;  1M1K 1;  3CCS 1;  2R7Z I;  1X0T A;  4RS4 A;  4MRI A;  3OW2 Z;  3H0G I;  2GTH A;  4NFR A;  3GTM I;  5C4X I;  2QA4 Z;  3FQM A;  1YJN 1;  4A3B I;  1YIJ 1;  1VQL 1;  3CCJ Z;  4EWC A;  1KD1 1;  1Z03 A;  3CCV Z;  1Q7Y 1;  4XX2 A;  3BG1 B;  4DK1 A;  1YUK A;  1VQ8 Z;  4CL1 A;  1VQO 1;  5CM2 M;  1X3Z A;  1YIT 1;  1QF8 A;  3CC2 Z;  4DQY B;  1NJI 1;  3GCF A;  1Y1V S;  3JAM b;  2JMO A;  2RHB A;  4HGZ A;  3TE5 B;  3JAM f;  1VQ7 Z;  1PFT A;  4MON A;  3FQQ A;  1S7M A;  3MZK B;  2W04 A;  2OOX B;  1RO0 A;  2RIQ A;  2JNY A;  3G6E Z;  4E2Y A;  3GTM S;  3RZD I;  2I3C A;  2OTL Z;  4RVD A;  4A93 I;  3CCM Z;  3ESW A;  1Q81 2;  3CD6 Z;  4NBA A;  3S16 I;  1K9M 2;  2QRD B;  3P5J B;  2B63 I;  1QVG Y;  1KQS Y;  4MD8 A;  4Y52 I;  3RZO I;  3VTN A;  1TWF I;  4MH4 A;  4NBH A;  2HU9 A;  3LUS A;  3J80 b;  1JWH C;  3GKQ A;  3J80 f;  1YJW Z;  2NVY I;  3GTQ I;  3F3P C;  1K8A 2;  4MD9 A;  2LFU A;  1TFI A;  1VQP 1;  3CQZ I;  1TWC I;  3F3F C;  3CCE 1;  3NFZ A;  4AYB A;  4A3J I;  3CC4 Z;  1VQK 1;  5T67 A;  4DGL A;  1YJ9 Z;  1YI2 1;  3GTJ I;  3G4S Z;  2QKD A;  1KQS Z;  2P3Y A;  2KI7 B;  3CCL 1;  1VQ4 1;  5IT9 b;  3OW2 Y;  3CPW Z;  1S72 Z;  2OTJ Z;  4A3L I;  3EER A;  3J81 f;  3FKI I;  4NH1 C;  1R9T I;  3MON A;  4MXU A;  4BBR I;  3G4S 1;  5A2Q b;  2V8K A;  3CCS Z;  2JA7 I;  3GTK I;  3S14 I;  4BY1 I;  5C4J I;  2H85 A;  1YJN Z;  1YIJ Z;  3PO2 I;  5C3E I;  1VQL Z;  4QTT A;  2NVT I;  5D1P A;  1YHQ 1;  3Q87 A;  3S1R I;  2PMZ A;  1VQO Z;  1W2B Y;  1QVF Y;  1YUA A;  3I4N I;  2P28 A;  1YIT Z;  1M1K 2;  4S1T A;  3HOV I;  2VUM I;  3IFU A;  1K73 1;  3IF8 A;  1TWA I;  1ZB8 A;  3CCQ 1;  1KRL A;  3HOW I;  1VLA A;  2M48 A;  3S2H I;  4NBE A;  3EED A;  3CME 1;  1KD1 2;  3NDJ A;  2JA6 I;  1VQ9 1;  1Z01 A;  1WII A;  5D1O A;  1RO4 A;  4NBB A;  3J7A 4;  1Z02 A;  3HOX I;  1W2B Z;  1NJI 2;  1QVF Z;  4BXX I;  2JS4 A;  2G2K A;  3NH5 A;  1VQ5 1;  2IZ3 A;  1VQ6 1;  3KIH A;  5IP7 I;  5AN9 F;  3VMI A;  1M90 1;  4E33 A;  3GTO I;  4Y7N I;  2Y0S A;  2Q4Z A;  3TDH B;  1VQP Z;  2IZ4 A;  2R6M A;  2GU2 A;  3CCE Z;  3CC7 Z;  2E9H A;  3CPW Y;  1VQK Z;  2O53 A;  2E2I I;  5C44 I;  1N8R 1;  1Q86 1;  4RVH A;  1YI2 Z;  2QRE B;  2R92 I;  3S1N I;  4E32 A;  3CC7 1;  3CCL Z;  1VQ4 Z;  3I56 1;  3I07 A;  4NB8 A;  3HOY I;  1RLY A;  4BBS I;  5FLX b;  3CCU 1;  2QRC B;  2BJO A;  2F4O A;  3S1M I;  1N2F A;  5LL6 f;  5IT9 f;  1USP A;  2PK7 A;  2JA8 I;  3VMH A;  2JA5 I;  3VMG A;  2JR6 A;  2VF1 A;  2YAD A;  5A2Q f;  3PO3 S;  2NVQ I;  3NH8 A;  1YHQ Z;  2DE6 A;  1KC8 1;  2WB1 A;  2K3R A;  4E30 A;  3K7A I;  4A3I I;  4MD7 A;  4A3E I;  4A3G I;  2E2J I;  4RVG A;  1JJ2 Z;  1P9N A;  3HOU I;  2Q51 A;  3G71 1;  3CCQ Z;  3HKZ A;  1Q82 1;  1QYP A;  2KPI A;  3CME Z;  2F4M A;  3CXC Z;  1VQ9 Z;  5T64 A;  2PM9 A;  3BG0 B;  3HOZ I;  3GTP I;  1I6H I;  4X6A I;  2RT9 A;  2GTI A;  4HGY A;  4NBG A;  1K73 2;  3S17 I;  1NUI A;  3NH4 A;  3QWU A;  1Q7Y 2;  4NOZ A;  4A3D I;  1VQN Z;  3CCR Z;  3D9X A;  3I55 1;  1VQ5 Z;  2WAQ A;  3CMA 1;  4NBF A;  2QEX 1;  1VQ6 Z;  1DL6 A;  2VUG A;  1VQN 1;  1K83 I;  3CCR 1;  1LQL A;  2QR1 B;  2DE5 A;  2QA4 1;  2OOY B;  3NDI A;  1RO2 A;  2AKL A;  3S15 I;  3CCJ 1;  4E2W A;  3CCV 1;  1X3W A;  2K5R A;  1VQ8 1;  5D1O B;  3M4O I;  1WW9 A;  3MZL B;  4RVF A;  4A3F I;  1M90 2;  3CC2 1;  1I3Q I;  4E31 A;  4A3M I;  2R93 I;  2O4H A;  1Q81 1;  3I56 Z;  3PO3 I;  1NP6 A;  4HH4 A;  1RNI A;  1VQ7 1;  4A3C I;  1K9M 1;  4RV9 A;  3GTL I;  5IP9 I;  3CCU Z;  2LIY A;  2NVX I;  1TWH I;  2HF1 A;  2J6A A;  3S2D I;  3G6E 1;  1N8R 2;  1Q86 2;  3GTG I;  1K8A 1;  2OTL 1;  1VQM Z;  3CCM 1;  4NBC A;  3CD6 1;  1JJ2 Y;  5FLX f;  2E2H I;  3H3V J;  2W03 A;  3KIF A;  3M3Y I;  3D6W A;  3U50 C;  2V8I A;  2JUB A;  1I50 I;  1VQM 1;  3CXC Y;  3IX0 A;  1L1O C;  2YU9 I;  1SFO I;  4A3K I;  4E2Z A;  1YJW 1;  3I4M I;  4NB9 A;  3S1Q I;  2OZK A;  2RBL A;  3G71 Z;  1ZH1 A;  2QLV B;  4E2X A;  1QVG Z;  3T4N B;  3CC4 1;  2DE7 A;  4TNU A;  2V8J A;  3J81 b;  1ML8 A;  2M6N A;  1KC8 2;  1TWG I;  1USP B;  1YJ9 1;  2RPR A;  4BY7 I;  3VB9 A;  4QTU A;  1RQF A;  5FLM I;  1Y1V I;  2ZAE B;  1S72 1;  2OTJ 1;  2EGT A;  1WCM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...