1I3QI

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI01
3CQZI 3GTJI 4A3EI 2YU9I 3K7AI 1Y1WI 4BBRI 1ZB9A 3VMGA 3S14I 3S1QI 3LUSA 1Y1VS 3RZDI 2JS4A 4NBHA 3GTOI 3S1RI 4A3KI 2BJOA 4NBEA 1DL6A 3EERA 3GTLI 1I3QI 2E2II 1WW9A 3GTKI 1N2FA 1WCMI 3HOXI 1LQLA 3PO3S 3GKQA 3PO2I 4NB8A 4NBFA 4QTUA 4A3CI 1RLYA 3GTGI 4A3GI 3GTMI 4NBCA 4Y52I 2R93I 3S1MI 2VUMI 2F4OA 2J6AA 2NVYI 3H0GI 3FKII 3S2HI 4A3II 1X3WA 3S17I 3RZOI 1TWCI 5FLMI 3I07A 2JNYA 5C44I 1L1OC 4A93I 4NB9A 2DE7A 3I4MI 1RO4A 1USPA 3U50C 3S15I 4A3LI 4A3MI 2AKLA 2HF1A 4NBAA 2KPIA 2PK7A 2DE5A 3S2DI 3HOWI 3VB9A 5C4XI 2JA6I 1K83I 1TWGI 4A3FI 3S16I 4BY7I 2RBLA 2E2JI 3HOVI 4X6AI 1VLAA 5IP9I 5C4JI 3GTMS 2NVTI 3I4NI 2JA7I 5IP7I 4NBDA 4NBBA 1X3ZA 1ZB8A 3GTPI 2JR6A 3D6WA 4XX2A 1I6HI 2JA8I 3VMIA 1USPB 2JA5I 2P3YA 1YUAA 3GTQI 4BY1I 1R9TI 3H3VJ 2F4MA 3HOUI 1TWHI 1Y1VI 1QYPA 1NUIA 5C3EI 4NBGA 5CM2M 3Q87A 3HOZI 3GCFA 3HOYI 2NVQI 2R7ZI 4Y7NI 4A3BI 4BBSI 3VMHA 3M3YI 2E2HI 4A3DI 1I50I 1SFOI 1PFTA 1TWFI 2R92I 4A3JI 3PO3I 2B63I 4QTTA 3ESWA 4MH4A 4BXXI 2DE6A 1ML8A 1TWAI 1TFIA 2K5RA 3S1NI 3M4OI 2NVXI 4NOZA
chains in the Genus database with same CATH superfamily
2YU9I 1K8A2 4BBRI 3VMGA 2AYDA 1N8R1 1KRLA 3CCJ1 1W2BY 3I561 3F3PC 4NFRA 1K8A1 3CCQ1 3GTOI 3S1RI 2LIYA 4RVHA 4A3KI 2BJOA 3BG1B 4MXUA 2IZ3A 3EEDA 3EERA 1JWHC 3GTLI 3GTKI 2OTJ1 1VQ71 4NH1C 2ZAEB 3PO2I 4NBFA 4A3CI 1RLYA 4A3GI 3JAMf 2VPWA 4Y52I 3CXCY 3S1MI 2VUMI 2J6AA 3CC71 2O4HA 1X3WA 1Q861 1WIIA 5FLMI 3I07A 2QA4Z 3BG0B 1VQNZ 1L1OC 4A93I 1KD12 4NB9A 2GU2A 1RO4A 3U50C 5AN9F 1RO0A 3NDJA 1VQP1 4NBAA 1Z01A 1KQSY 2DE5A 2QLVB 1NJI1 3VB9A 4MONA 4A3FI 3CMA1 2QRDB 1ZH1A 2E2JI 1Q822 1VQ6Z 1FDIA 1VQKZ 1Q821 3CCM1 2JR6A 1SIWA 2LFUA 1I6HI 2JIOA 3G6EZ 2RIQA 2V8KA 2JA5I 2P3YA 4BY1I 1X0TA 4HH4A 2JIMA 2V3VA 4DQYB 3HOUI 4RVFA 2K3RA 2NVQI 1YITZ 1FDOA 1NP6A 4Y7NI 5D1OB 3M3YI 4A3DI 2QEXZ 3MONA 2Q51A 4HGYA 2R92I 2HU9A 1VQ4Z 2B63I 3ESWA 2DE6A 1TWAI 2K5RA 3M4OI 4NOZA 2RHBA 3TE5B 4DGLA 5IT9b 1Q811 1Q16A 1QVGY 3S14I 3LUSA 5FLXf 3CCL1 3RZDI 2H85A 3CC4Z 2JIPA 1K9M2 1JJ2Y 3CCU1 1QVFY 1DL6A 1YIJ1 1K9M1 2JIQA 1I3QI 1N2FA 1VQ81 3HOXI 3GKQA 3NFZA 3CCJZ 3GTGI 1YI21 1N8R2 4NBCA 2F4OA 3S17I 2R6MA 3OW2Y 1WJ2A 1S7MA 1VQ7Z 3MZKB 5C44I 3I551 2DE7A 5A2Qb 1VQOZ 4A3LI 3TDHB 4E33A 1YHQ1 2HF1A 2KPIA 1W2BZ 2WAQA 3J80b 3S2DI 3CC7Z 1TWGI 3S16I 4BY7I 2RBLA 4S1TA 3CCS1 1Q862 1VQLZ 1VLAA 2EGTA 2NVTI 5D1OA 1VQ9Z 3CPWY 4NBBA 3D6WA 1YJ9Z 1VQPZ 3CMEZ 2JA8I 3VMIA 2QRCB 1USPB 1WZNA 1NJI2 3CCRZ 3CXCZ 3CCV1 3CD61 3NDIA 2F4MA 3H3VJ 3CCEZ 5C3EI 4NBGA 3Q87A 3HOZI 3GCFA 2R7ZI 3G71Z 3G4SZ 4A3BI 4BBSI 2JMOA 2E2HI 4E2WA 3F3FC 1SFOI 1KQSZ 3IFUA 1RQFA 2OOXB 4CL1A 2QA41 2Y0SA 4BXXI 3HKZA 1M902 3MZLB 3KIHA 1S721 1AA6A 1VQ5Z 1YUKA 2G2KA 1M901 3J7A4 3CQZI 3GTJI 2OZKA 1Y1WI 2PM9A 2VPZA 2VPYA 3S1QI 3KIFA 4RV9A 4EWCA 2IZ4A 2JS4A 5D1PA 3D9XA 1YJWZ 5A2Qf 1VQK1 2E2II 1WW9A 3VTNA 1LQLA 3G6E1 3CC2Z 3J80f 2YADA 2QR1B 3D2LA 4NB8A 4QTUA 1Q812 2VF1A 3JAMb 3GTMI 4MD9A 4RVGA 4E32A 2GTHA 3NH8A 4A3II 2W04A 3RZOI 1QXFA 1TWCI 1Q7Y1 2JNYA 2OTL1 1USPA 2QEX1 3S15I 1VQMZ 1YI2Z 2AKLA 1QVGZ 2PK7A 1VQ41 3HOWI 5C4XI 4MRIA 4RS4A 1YJN1 3FQQA 2LEXA 3I56Z 2JIRA 1JJ2Z 3CCQZ 4E2ZA 5IP9I 3GTMS 1KC81 2JA7I 4NBDA 2QREB 1X3ZA 1P9NA 2OOYB 2OTJZ 3CC41 3QWUA 3J81b 1YUAA 3GTQI 4E30A 2PMZA 1RNIA 1R9TI 2VUGA 3IF8A 1Y1VI 1QYPA 3OW2Z 1NUIA 5CM2M 2I3CA 3HOYI 2RPRA 4DK1A 3VMHA 2Q4ZA 3CCVZ 4E31A 2IV2X 5T6BA 3PO3I 3CD6Z 4QTTA 1Y8CA 1VQO1 3CMAZ 3S1NI 2NVXI 3CPWZ 2E9HA 5IT9f 4A3EI 3K7AI 1ZB9A 3T4NB 1Y1VS 5FLXb 3CCMZ 4TNUA 1VQL1 4MD8A 4NBHA 2O53A 2GTIA 5T64A 4NBEA 1VQ91 1S72Z 1YJ91 1WCMI 1KD11 3CME1 1VQN1 3PO3S 3IR7A 3FQMA 2V8JA 2RT9A 3CCR1 1RO2A 3IX0A 2R93I 2V45A 3NH5A 2M48A 2NVYI 3H0GI 3FKII 3CCE1 3S2HI 3G711 3G4S1 2M6NA 1VQ61 2JUBA 4E2YA 3J81f 3I4MI 4E2XA 2V8IA 5T67A 4A3MI 2VPXA 1QF8A 2JA6I 1K83I 3CCLZ 1VQ51 2KI7B 3HOVI 4X6AI 5C4JI 1Q7Y2 3I4NI 3CCUZ 2OTLZ 5IP7I 1YIJZ 1YIT1 1ZB8A 2WB1A 3GTPI 4XX2A 4AYBA 1VQ8Z 1YJW1 1M1K2 1YJNZ 1Z02A 4HGZA 4MD7A 1M1K1 3CC21 1TWHI 2E7ZA 1KC82 4RVDA 1QVFZ 1Z03A 5LL6f 3I55Z 1I50I 3P5JB 2QKDA 1PFTA 1YHQZ 1TWFI 2W03A 4A3JI 4MH4A 1ML8A 1K732 2P28A 1VQM1 3CCSZ 1TFIA 2NAPA 3NH4A 1K731
chains in the Genus database with same CATH topology
2YU9I 1K8A2 4BBRI 3VMGA 1N8R1 1KRLA 3CCJ1 1W2BY 3I561 3F3PC 4NFRA 1K8A1 3CCQ1 3GTOI 3S1RI 2LIYA 4RVHA 4A3KI 2BJOA 3BG1B 4MXUA 2IZ3A 3EEDA 3EERA 1JWHC 3GTLI 3GTKI 2OTJ1 1VQ71 4NH1C 2ZAEB 3PO2I 4NBFA 4A3CI 1RLYA 4A3GI 3JAMf 4Y52I 3CXCY 3S1MI 2VUMI 2J6AA 3CC71 2O4HA 1X3WA 1Q861 1WIIA 5FLMI 3I07A 2QA4Z 3BG0B 1VQNZ 1L1OC 4A93I 1KD12 4NB9A 2GU2A 1RO4A 3U50C 5AN9F 1RO0A 3NDJA 1VQP1 4NBAA 1Z01A 1KQSY 2DE5A 2QLVB 1NJI1 3VB9A 4MONA 4A3FI 3CMA1 2QRDB 1ZH1A 2E2JI 1Q822 1VQ6Z 1VQKZ 1Q821 3CCM1 2JR6A 2LFUA 1I6HI 3G6EZ 2RIQA 2V8KA 2JA5I 2P3YA 4BY1I 1X0TA 4HH4A 4DQYB 3HOUI 4RVFA 2K3RA 2NVQI 1YITZ 1NP6A 4Y7NI 5D1OB 3M3YI 4A3DI 2QEXZ 3MONA 2Q51A 4HGYA 2R92I 2HU9A 1VQ4Z 2B63I 3ESWA 2DE6A 1TWAI 2K5RA 3M4OI 4NOZA 2RHBA 3TE5B 4DGLA 5IT9b 1Q811 1QVGY 3S14I 3LUSA 5FLXf 3CCL1 3RZDI 2H85A 3CC4Z 1K9M2 1JJ2Y 3CCU1 1QVFY 1DL6A 1YIJ1 1K9M1 1I3QI 1N2FA 1VQ81 3HOXI 3GKQA 3NFZA 3CCJZ 3GTGI 1YI21 1N8R2 4NBCA 2F4OA 3S17I 2R6MA 3OW2Y 1S7MA 1VQ7Z 3MZKB 5C44I 3I551 2DE7A 5A2Qb 1VQOZ 4A3LI 3TDHB 4E33A 1YHQ1 2HF1A 2KPIA 1W2BZ 2WAQA 3J80b 3S2DI 3CC7Z 1TWGI 3S16I 4BY7I 2RBLA 4S1TA 3CCS1 1Q862 1VQLZ 1VLAA 2EGTA 2NVTI 5D1OA 1VQ9Z 3CPWY 4NBBA 3D6WA 1YJ9Z 1VQPZ 3CMEZ 2JA8I 3VMIA 2QRCB 1USPB 1NJI2 3CCRZ 3CXCZ 3CCV1 3CD61 3NDIA 2F4MA 3H3VJ 3CCEZ 5C3EI 4NBGA 3Q87A 3HOZI 3GCFA 2R7ZI 3G71Z 3G4SZ 4A3BI 4BBSI 2JMOA 2E2HI 4E2WA 3F3FC 1SFOI 1KQSZ 3IFUA 1RQFA 2OOXB 4CL1A 2QA41 2Y0SA 4BXXI 3HKZA 1M902 3MZLB 3KIHA 1S721 1VQ5Z 1YUKA 2G2KA 1M901 3J7A4 3CQZI 3GTJI 2OZKA 1Y1WI 2PM9A 3S1QI 3KIFA 4RV9A 4EWCA 2IZ4A 2JS4A 5D1PA 3D9XA 1YJWZ 5A2Qf 1VQK1 2E2II 1WW9A 3VTNA 1LQLA 3G6E1 3CC2Z 3J80f 2YADA 2QR1B 4NB8A 4QTUA 1Q812 2VF1A 3JAMb 3GTMI 4MD9A 4RVGA 4E32A 2GTHA 3NH8A 4A3II 2W04A 3RZOI 1TWCI 1Q7Y1 2JNYA 2OTL1 1USPA 2QEX1 3S15I 1VQMZ 1YI2Z 2AKLA 1QVGZ 2PK7A 1VQ41 3HOWI 5C4XI 4MRIA 4RS4A 1YJN1 3FQQA 3I56Z 1JJ2Z 3CCQZ 4E2ZA 5IP9I 3GTMS 1KC81 2JA7I 4NBDA 2QREB 1X3ZA 1P9NA 2OOYB 2OTJZ 3CC41 3QWUA 3J81b 1YUAA 3GTQI 4E30A 2PMZA 1RNIA 1R9TI 2VUGA 3IF8A 3OW2Z 1Y1VI 1QYPA 1NUIA 5CM2M 2I3CA 3HOYI 2RPRA 4DK1A 3VMHA 2Q4ZA 3CCVZ 4E31A 5T6BA 3PO3I 3CD6Z 4QTTA 1VQO1 3CMAZ 3S1NI 2NVXI 3CPWZ 2E9HA 5IT9f 4A3EI 3K7AI 1ZB9A 3T4NB 1Y1VS 5FLXb 3CCMZ 4TNUA 1VQL1 4MD8A 4NBHA 2O53A 2GTIA 5T64A 4NBEA 1VQ91 1S72Z 1YJ91 1WCMI 1KD11 3CME1 1VQN1 3PO3S 3FQMA 2V8JA 2RT9A 3CCR1 1RO2A 3IX0A 2R93I 3NH5A 2M48A 2NVYI 3H0GI 3FKII 3CCE1 3S2HI 3G711 3G4S1 2M6NA 1VQ61 2JUBA 4E2YA 3J81f 3I4MI 4E2XA 2V8IA 5T67A 4A3MI 1QF8A 2JA6I 1K83I 3CCLZ 1VQ51 2KI7B 3HOVI 4X6AI 5C4JI 1Q7Y2 3I4NI 3CCUZ 2OTLZ 5IP7I 1YIJZ 1YIT1 1ZB8A 2WB1A 3GTPI 4XX2A 4AYBA 1VQ8Z 1YJW1 1M1K2 1YJNZ 1Z02A 4HGZA 4MD7A 1M1K1 3CC21 1TWHI 1KC82 4RVDA 1QVFZ 1Z03A 5LL6f 3I55Z 1I50I 3P5JB 2QKDA 1PFTA 1YHQZ 1TWFI 2W03A 4A3JI 4MH4A 1ML8A 1K732 2P28A 1VQM1 3CCSZ 1TFIA 3NH4A 1K731
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ I;  3GTJ I;  4A3E I;  2YU9 I;  3K7A I;  1Y1W I;  4BBR I;  1ZB9 A;  3VMG A;  3S14 I;  3S1Q I;  3LUS A;  1Y1V S;  3RZD I;  2JS4 A;  4NBH A;  3GTO I;  3S1R I;  4A3K I;  2BJO A;  4NBE A;  1DL6 A;  3EER A;  3GTL I;  1I3Q I;  2E2I I;  1WW9 A;  3GTK I;  1N2F A;  1WCM I;  3HOX I;  1LQL A;  3PO3 S;  3GKQ A;  3PO2 I;  4NB8 A;  4NBF A;  4QTU A;  4A3C I;  1RLY A;  3GTG I;  4A3G I;  3GTM I;  4NBC A;  4Y52 I;  2R93 I;  3S1M I;  2VUM I;  2F4O A;  2J6A A;  2NVY I;  3H0G I;  3FKI I;  3S2H I;  4A3I I;  1X3W A;  3S17 I;  3RZO I;  1TWC I;  5FLM I;  3I07 A;  2JNY A;  5C44 I;  1L1O C;  4A93 I;  4NB9 A;  2DE7 A;  3I4M I;  1RO4 A;  1USP A;  3U50 C;  3S15 I;  4A3L I;  4A3M I;  2AKL A;  2HF1 A;  4NBA A;  2KPI A;  2PK7 A;  2DE5 A;  3S2D I;  3HOW I;  3VB9 A;  5C4X I;  2JA6 I;  1K83 I;  1TWG I;  4A3F I;  3S16 I;  4BY7 I;  2RBL A;  2E2J I;  3HOV I;  4X6A I;  1VLA A;  5IP9 I;  5C4J I;  3GTM S;  2NVT I;  3I4N I;  2JA7 I;  5IP7 I;  4NBD A;  4NBB A;  1X3Z A;  1ZB8 A;  3GTP I;  2JR6 A;  3D6W A;  4XX2 A;  1I6H I;  2JA8 I;  3VMI A;  1USP B;  2JA5 I;  2P3Y A;  1YUA A;  3GTQ I;  4BY1 I;  1R9T I;  3H3V J;  2F4M A;  3HOU I;  1TWH I;  1Y1V I;  1QYP A;  1NUI A;  5C3E I;  4NBG A;  5CM2 M;  3Q87 A;  3HOZ I;  3GCF A;  3HOY I;  2NVQ I;  2R7Z I;  4Y7N I;  4A3B I;  4BBS I;  3VMH A;  3M3Y I;  2E2H I;  4A3D I;  1I50 I;  1SFO I;  1PFT A;  1TWF I;  2R92 I;  4A3J I;  3PO3 I;  2B63 I;  4QTT A;  3ESW A;  4MH4 A;  4BXX I;  2DE6 A;  1ML8 A;  1TWA I;  1TFI A;  2K5R A;  3S1N I;  3M4O I;  2NVX I;  4NOZ A; 
#chains in the Genus database with same CATH topology
 2YU9 I;  1K8A 2;  4BBR I;  3VMG A;  2AYD A;  1N8R 1;  1KRL A;  3CCJ 1;  1W2B Y;  3I56 1;  3F3P C;  4NFR A;  1K8A 1;  3CCQ 1;  3GTO I;  3S1R I;  2LIY A;  4RVH A;  4A3K I;  2BJO A;  3BG1 B;  4MXU A;  2IZ3 A;  3EED A;  3EER A;  1JWH C;  3GTL I;  3GTK I;  2OTJ 1;  1VQ7 1;  4NH1 C;  2ZAE B;  3PO2 I;  4NBF A;  4A3C I;  1RLY A;  4A3G I;  3JAM f;  2VPW A;  4Y52 I;  3CXC Y;  3S1M I;  2VUM I;  2J6A A;  3CC7 1;  2O4H A;  1X3W A;  1Q86 1;  1WII A;  5FLM I;  3I07 A;  2QA4 Z;  3BG0 B;  1VQN Z;  1L1O C;  4A93 I;  1KD1 2;  4NB9 A;  2GU2 A;  1RO4 A;  3U50 C;  5AN9 F;  1RO0 A;  3NDJ A;  1VQP 1;  4NBA A;  1Z01 A;  1KQS Y;  2DE5 A;  2QLV B;  1NJI 1;  3VB9 A;  4MON A;  4A3F I;  3CMA 1;  2QRD B;  1ZH1 A;  2E2J I;  1Q82 2;  1VQ6 Z;  1FDI A;  1VQK Z;  1Q82 1;  3CCM 1;  2JR6 A;  1SIW A;  2LFU A;  1I6H I;  2JIO A;  3G6E Z;  2RIQ A;  2V8K A;  2JA5 I;  2P3Y A;  4BY1 I;  1X0T A;  4HH4 A;  2JIM A;  2V3V A;  4DQY B;  3HOU I;  4RVF A;  2K3R A;  2NVQ I;  1YIT Z;  1FDO A;  1NP6 A;  4Y7N I;  5D1O B;  3M3Y I;  4A3D I;  2QEX Z;  3MON A;  2Q51 A;  4HGY A;  2R92 I;  2HU9 A;  1VQ4 Z;  2B63 I;  3ESW A;  2DE6 A;  1TWA I;  2K5R A;  3M4O I;  4NOZ A;  2RHB A;  3TE5 B;  4DGL A;  5IT9 b;  1Q81 1;  1Q16 A;  1QVG Y;  3S14 I;  3LUS A;  5FLX f;  3CCL 1;  3RZD I;  2H85 A;  3CC4 Z;  2JIP A;  1K9M 2;  1JJ2 Y;  3CCU 1;  1QVF Y;  1DL6 A;  1YIJ 1;  1K9M 1;  2JIQ A;  1I3Q I;  1N2F A;  1VQ8 1;  3HOX I;  3GKQ A;  3NFZ A;  3CCJ Z;  3GTG I;  1YI2 1;  1N8R 2;  4NBC A;  2F4O A;  3S17 I;  2R6M A;  3OW2 Y;  1WJ2 A;  1S7M A;  1VQ7 Z;  3MZK B;  5C44 I;  3I55 1;  2DE7 A;  5A2Q b;  1VQO Z;  4A3L I;  3TDH B;  4E33 A;  1YHQ 1;  2HF1 A;  2KPI A;  1W2B Z;  2WAQ A;  3J80 b;  3S2D I;  3CC7 Z;  1TWG I;  3S16 I;  4BY7 I;  2RBL A;  4S1T A;  3CCS 1;  1Q86 2;  1VQL Z;  1VLA A;  2EGT A;  2NVT I;  5D1O A;  1VQ9 Z;  3CPW Y;  4NBB A;  3D6W A;  1YJ9 Z;  1VQP Z;  3CME Z;  2JA8 I;  3VMI A;  2QRC B;  1USP B;  1WZN A;  1NJI 2;  3CCR Z;  3CXC Z;  3CCV 1;  3CD6 1;  3NDI A;  2F4M A;  3H3V J;  3CCE Z;  5C3E I;  4NBG A;  3Q87 A;  3HOZ I;  3GCF A;  2R7Z I;  3G71 Z;  3G4S Z;  4A3B I;  4BBS I;  2JMO A;  2E2H I;  4E2W A;  3F3F C;  1SFO I;  1KQS Z;  3IFU A;  1RQF A;  2OOX B;  4CL1 A;  2QA4 1;  2Y0S A;  4BXX I;  3HKZ A;  1M90 2;  3MZL B;  3KIH A;  1S72 1;  1AA6 A;  1VQ5 Z;  1YUK A;  2G2K A;  1M90 1;  3J7A 4;  3CQZ I;  3GTJ I;  2OZK A;  1Y1W I;  2PM9 A;  2VPZ A;  2VPY A;  3S1Q I;  3KIF A;  4RV9 A;  4EWC A;  2IZ4 A;  2JS4 A;  5D1P A;  3D9X A;  1YJW Z;  5A2Q f;  1VQK 1;  2E2I I;  1WW9 A;  3VTN A;  1LQL A;  3G6E 1;  3CC2 Z;  3J80 f;  2YAD A;  2QR1 B;  3D2L A;  4NB8 A;  4QTU A;  1Q81 2;  2VF1 A;  3JAM b;  3GTM I;  4MD9 A;  4RVG A;  4E32 A;  2GTH A;  3NH8 A;  4A3I I;  2W04 A;  3RZO I;  1QXF A;  1TWC I;  1Q7Y 1;  2JNY A;  2OTL 1;  1USP A;  2QEX 1;  3S15 I;  1VQM Z;  1YI2 Z;  2AKL A;  1QVG Z;  2PK7 A;  1VQ4 1;  3HOW I;  5C4X I;  4MRI A;  4RS4 A;  1YJN 1;  3FQQ A;  2LEX A;  3I56 Z;  2JIR A;  1JJ2 Z;  3CCQ Z;  4E2Z A;  5IP9 I;  3GTM S;  1KC8 1;  2JA7 I;  4NBD A;  2QRE B;  1X3Z A;  1P9N A;  2OOY B;  2OTJ Z;  3CC4 1;  3QWU A;  3J81 b;  1YUA A;  3GTQ I;  4E30 A;  2PMZ A;  1RNI A;  1R9T I;  2VUG A;  3IF8 A;  1Y1V I;  1QYP A;  3OW2 Z;  1NUI A;  5CM2 M;  2I3C A;  3HOY I;  2RPR A;  4DK1 A;  3VMH A;  2Q4Z A;  3CCV Z;  4E31 A;  2IV2 X;  5T6B A;  3PO3 I;  3CD6 Z;  4QTT A;  1Y8C A;  1VQO 1;  3CMA Z;  3S1N I;  2NVX I;  3CPW Z;  2E9H A;  5IT9 f;  4A3E I;  3K7A I;  1ZB9 A;  3T4N B;  1Y1V S;  5FLX b;  3CCM Z;  4TNU A;  1VQL 1;  4MD8 A;  4NBH A;  2O53 A;  2GTI A;  5T64 A;  4NBE A;  1VQ9 1;  1S72 Z;  1YJ9 1;  1WCM I;  1KD1 1;  3CME 1;  1VQN 1;  3PO3 S;  3IR7 A;  3FQM A;  2V8J A;  2RT9 A;  3CCR 1;  1RO2 A;  3IX0 A;  2R93 I;  2V45 A;  3NH5 A;  2M48 A;  2NVY I;  3H0G I;  3FKI I;  3CCE 1;  3S2H I;  3G71 1;  3G4S 1;  2M6N A;  1VQ6 1;  2JUB A;  4E2Y A;  3J81 f;  3I4M I;  4E2X A;  2V8I A;  5T67 A;  4A3M I;  2VPX A;  1QF8 A;  2JA6 I;  1K83 I;  3CCL Z;  1VQ5 1;  2KI7 B;  3HOV I;  4X6A I;  5C4J I;  1Q7Y 2;  3I4N I;  3CCU Z;  2OTL Z;  5IP7 I;  1YIJ Z;  1YIT 1;  1ZB8 A;  2WB1 A;  3GTP I;  4XX2 A;  4AYB A;  1VQ8 Z;  1YJW 1;  1M1K 2;  1YJN Z;  1Z02 A;  4HGZ A;  4MD7 A;  1M1K 1;  3CC2 1;  1TWH I;  2E7Z A;  1KC8 2;  4RVD A;  1QVF Z;  1Z03 A;  5LL6 f;  3I55 Z;  1I50 I;  3P5J B;  2QKD A;  1PFT A;  1YHQ Z;  1TWF I;  2W03 A;  4A3J I;  4MH4 A;  1ML8 A;  1K73 2;  2P28 A;  1VQM 1;  3CCS Z;  1TFI A;  2NAP A;  3NH4 A;  1K73 1; 
#chains in the Genus database with same CATH homology
 2YU9 I;  1K8A 2;  4BBR I;  3VMG A;  1N8R 1;  1KRL A;  3CCJ 1;  1W2B Y;  3I56 1;  3F3P C;  4NFR A;  1K8A 1;  3CCQ 1;  3GTO I;  3S1R I;  2LIY A;  4RVH A;  4A3K I;  2BJO A;  3BG1 B;  4MXU A;  2IZ3 A;  3EED A;  3EER A;  1JWH C;  3GTL I;  3GTK I;  2OTJ 1;  1VQ7 1;  4NH1 C;  2ZAE B;  3PO2 I;  4NBF A;  4A3C I;  1RLY A;  4A3G I;  3JAM f;  4Y52 I;  3CXC Y;  3S1M I;  2VUM I;  2J6A A;  3CC7 1;  2O4H A;  1X3W A;  1Q86 1;  1WII A;  5FLM I;  3I07 A;  2QA4 Z;  3BG0 B;  1VQN Z;  1L1O C;  4A93 I;  1KD1 2;  4NB9 A;  2GU2 A;  1RO4 A;  3U50 C;  5AN9 F;  1RO0 A;  3NDJ A;  1VQP 1;  4NBA A;  1Z01 A;  1KQS Y;  2DE5 A;  2QLV B;  1NJI 1;  3VB9 A;  4MON A;  4A3F I;  3CMA 1;  2QRD B;  1ZH1 A;  2E2J I;  1Q82 2;  1VQ6 Z;  1VQK Z;  1Q82 1;  3CCM 1;  2JR6 A;  2LFU A;  1I6H I;  3G6E Z;  2RIQ A;  2V8K A;  2JA5 I;  2P3Y A;  4BY1 I;  1X0T A;  4HH4 A;  4DQY B;  3HOU I;  4RVF A;  2K3R A;  2NVQ I;  1YIT Z;  1NP6 A;  4Y7N I;  5D1O B;  3M3Y I;  4A3D I;  2QEX Z;  3MON A;  2Q51 A;  4HGY A;  2R92 I;  2HU9 A;  1VQ4 Z;  2B63 I;  3ESW A;  2DE6 A;  1TWA I;  2K5R A;  3M4O I;  4NOZ A;  2RHB A;  3TE5 B;  4DGL A;  5IT9 b;  1Q81 1;  1QVG Y;  3S14 I;  3LUS A;  5FLX f;  3CCL 1;  3RZD I;  2H85 A;  3CC4 Z;  1K9M 2;  1JJ2 Y;  3CCU 1;  1QVF Y;  1DL6 A;  1YIJ 1;  1K9M 1;  1I3Q I;  1N2F A;  1VQ8 1;  3HOX I;  3GKQ A;  3NFZ A;  3CCJ Z;  3GTG I;  1YI2 1;  1N8R 2;  4NBC A;  2F4O A;  3S17 I;  2R6M A;  3OW2 Y;  1S7M A;  1VQ7 Z;  3MZK B;  5C44 I;  3I55 1;  2DE7 A;  5A2Q b;  1VQO Z;  4A3L I;  3TDH B;  4E33 A;  1YHQ 1;  2HF1 A;  2KPI A;  1W2B Z;  2WAQ A;  3J80 b;  3S2D I;  3CC7 Z;  1TWG I;  3S16 I;  4BY7 I;  2RBL A;  4S1T A;  3CCS 1;  1Q86 2;  1VQL Z;  1VLA A;  2EGT A;  2NVT I;  5D1O A;  1VQ9 Z;  3CPW Y;  4NBB A;  3D6W A;  1YJ9 Z;  1VQP Z;  3CME Z;  2JA8 I;  3VMI A;  2QRC B;  1USP B;  1NJI 2;  3CCR Z;  3CXC Z;  3CCV 1;  3CD6 1;  3NDI A;  2F4M A;  3H3V J;  3CCE Z;  5C3E I;  4NBG A;  3Q87 A;  3HOZ I;  3GCF A;  2R7Z I;  3G71 Z;  3G4S Z;  4A3B I;  4BBS I;  2JMO A;  2E2H I;  4E2W A;  3F3F C;  1SFO I;  1KQS Z;  3IFU A;  1RQF A;  2OOX B;  4CL1 A;  2QA4 1;  2Y0S A;  4BXX I;  3HKZ A;  1M90 2;  3MZL B;  3KIH A;  1S72 1;  1VQ5 Z;  1YUK A;  2G2K A;  1M90 1;  3J7A 4;  3CQZ I;  3GTJ I;  2OZK A;  1Y1W I;  2PM9 A;  3S1Q I;  3KIF A;  4RV9 A;  4EWC A;  2IZ4 A;  2JS4 A;  5D1P A;  3D9X A;  1YJW Z;  5A2Q f;  1VQK 1;  2E2I I;  1WW9 A;  3VTN A;  1LQL A;  3G6E 1;  3CC2 Z;  3J80 f;  2YAD A;  2QR1 B;  4NB8 A;  4QTU A;  1Q81 2;  2VF1 A;  3JAM b;  3GTM I;  4MD9 A;  4RVG A;  4E32 A;  2GTH A;  3NH8 A;  4A3I I;  2W04 A;  3RZO I;  1TWC I;  1Q7Y 1;  2JNY A;  2OTL 1;  1USP A;  2QEX 1;  3S15 I;  1VQM Z;  1YI2 Z;  2AKL A;  1QVG Z;  2PK7 A;  1VQ4 1;  3HOW I;  5C4X I;  4MRI A;  4RS4 A;  1YJN 1;  3FQQ A;  3I56 Z;  1JJ2 Z;  3CCQ Z;  4E2Z A;  5IP9 I;  3GTM S;  1KC8 1;  2JA7 I;  4NBD A;  2QRE B;  1X3Z A;  1P9N A;  2OOY B;  2OTJ Z;  3CC4 1;  3QWU A;  3J81 b;  1YUA A;  3GTQ I;  4E30 A;  2PMZ A;  1RNI A;  1R9T I;  2VUG A;  3IF8 A;  3OW2 Z;  1Y1V I;  1QYP A;  1NUI A;  5CM2 M;  2I3C A;  3HOY I;  2RPR A;  4DK1 A;  3VMH A;  2Q4Z A;  3CCV Z;  4E31 A;  5T6B A;  3PO3 I;  3CD6 Z;  4QTT A;  1VQO 1;  3CMA Z;  3S1N I;  2NVX I;  3CPW Z;  2E9H A;  5IT9 f;  4A3E I;  3K7A I;  1ZB9 A;  3T4N B;  1Y1V S;  5FLX b;  3CCM Z;  4TNU A;  1VQL 1;  4MD8 A;  4NBH A;  2O53 A;  2GTI A;  5T64 A;  4NBE A;  1VQ9 1;  1S72 Z;  1YJ9 1;  1WCM I;  1KD1 1;  3CME 1;  1VQN 1;  3PO3 S;  3FQM A;  2V8J A;  2RT9 A;  3CCR 1;  1RO2 A;  3IX0 A;  2R93 I;  3NH5 A;  2M48 A;  2NVY I;  3H0G I;  3FKI I;  3CCE 1;  3S2H I;  3G71 1;  3G4S 1;  2M6N A;  1VQ6 1;  2JUB A;  4E2Y A;  3J81 f;  3I4M I;  4E2X A;  2V8I A;  5T67 A;  4A3M I;  1QF8 A;  2JA6 I;  1K83 I;  3CCL Z;  1VQ5 1;  2KI7 B;  3HOV I;  4X6A I;  5C4J I;  1Q7Y 2;  3I4N I;  3CCU Z;  2OTL Z;  5IP7 I;  1YIJ Z;  1YIT 1;  1ZB8 A;  2WB1 A;  3GTP I;  4XX2 A;  4AYB A;  1VQ8 Z;  1YJW 1;  1M1K 2;  1YJN Z;  1Z02 A;  4HGZ A;  4MD7 A;  1M1K 1;  3CC2 1;  1TWH I;  1KC8 2;  4RVD A;  1QVF Z;  1Z03 A;  5LL6 f;  3I55 Z;  1I50 I;  3P5J B;  2QKD A;  1PFT A;  1YHQ Z;  1TWF I;  2W03 A;  4A3J I;  4MH4 A;  1ML8 A;  1K73 2;  2P28 A;  1VQM 1;  3CCS Z;  1TFI A;  3NH4 A;  1K73 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...