1I3QI

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI01
3GTGI 2YU9I 2KPIA 1R9TI 1WW9A 3S14I 2JS4A 5C4JI 2JA8I 4NBEA 4QTTA 2P3YA 3VMHA 1L1OC 2NVXI 3U50C 2K5RA 3K7AI 3D6WA 3GTQI 4A3KI 3GKQA 1ZB9A 4NBDA 5C3EI 1TFIA 1YUAA 4BY7I 4QTUA 3VMIA 4X6AI 4A93I 2R93I 3GTLI 2BJOA 3HOZI 2B63I 1Y1VS 2JR6A 3HOVI 3Q87A 1TWCI 1X3WA 2E2II 2DE6A 1QYPA 5FLMI 2F4OA 2JA5I 3GTMI 1I50I 4A3EI 2AKLA 5IP7I 3GTJI 3S1MI 4A3FI 4A3LI 2F4MA 3H0GI 4A3GI 3HOUI 4A3CI 4NB9A 2PK7A 3RZOI 1TWAI 4MH4A 3PO3I 1TWGI 3GTOI 3CQZI 3S2DI 2JA7I 1PFTA 3S15I 1TWFI 3S1QI 1Y1WI 5C44I 1N2FA 1WCMI 4Y52I 4BY1I 4NBBA 1Y1VI 4A3DI 1DL6A 1LQLA 2E2HI 4NBCA 4BBRI 4BBSI 4A3BI 2VUMI 3HOXI 4A3II 2R7ZI 4Y7NI 2DE7A 1USPA 4NBAA 4NB8A 5IP9I 1ZB8A 2JNYA 2HF1A 1I6HI 1RLYA 3HOWI 4NBFA 1VLAA 4A3MI 2NVYI 1SFOI 3GTMS 3S2HI 4BXXI 3RZDI 3M3YI 3S1NI 1TWHI 3I07A 1I3QI 5CM2M 3S16I 1USPB 5C4XI 2NVTI 2DE5A 3I4NI 2NVQI 1NUIA 3H3VJ 3FKII 3PO3S 3HOYI 3I4MI 3PO2I 3GCFA 4NBHA 4NOZA 4XX2A 2J6AA 3VB9A 1ML8A 2JA6I 3S1RI 2R92I 1RO4A 3M4OI 3VMGA 3GTKI 2E2JI 4A3JI 2RBLA 3LUSA 1K83I 3GTPI 3ESWA 3S17I 3EERA 1X3ZA 4NBGA
chains in the Genus database with same CATH superfamily
3GTGI 2O4HA 1KC82 1WW9A 3VTNA 5A2Qf 5C4JI 1K731 1NJI1 3D2LA 4NBEA 2V8JA 1L1OC 5A2Qb 3BG0B 2QR1B 2OTJ1 4E2WA 4A3KI 1M901 4MD7A 4BY7I 4X6AI 1VQ71 1YHQZ 3IX0A 1SIWA 1VQ81 2E2II 5AN9F 3CCM1 2W04A 1Q862 3NFZA 2Y0SA 5T67A 2YADA 1YJ91 3CD6Z 3GTMI 2V45A 3S1MI 3NH5A 1QVFY 2F4MA 2GTIA 3H0GI 2M48A 3I55Z 3J81f 4DQYB 3HOUI 4NB9A 3CC41 2E9HA 3OW2Y 3G71Z 1WJ2A 1TWGI 3CQZI 3S2DI 1PFTA 3CCRZ 3P5JB 2QRCB 1N2FA 2OOXB 5C44I 4Y52I 2EGTA 4A3DI 1YITZ 1DL6A 4S1TA 2M6NA 1Q822 4BBSI 4A3BI 1YIJ1 2JMOA 1JJ2Y 3CCJ1 4A3II 2R7ZI 4E2ZA 4E2YA 1YUKA 2DE7A 3TE5B 5IP9I 4NB8A 3CCMZ 1K732 4NBFA 1NJI2 1VLAA 3S2HI 3RZDI 3M3YI 3CCE1 1Q7Y1 2NAPA 4MD9A 2O53A 2RIQA 5C4XI 3KIFA 2NVTI 2RT9A 1ZH1A 3NH4A 2P28A 1M902 3CC4Z 3NDIA 5T6BA 3GCFA 4NBHA 2V8KA 5D1OB 1ML8A 3S1RI 3CCL1 2VPZA 2Q51A 4A3JI 1K9M1 4AYBA 2LIYA 3CC7Z 3S14I 1X0TA 2JS4A 1YHQ1 2JA8I 4QTTA 3VMHA 1VQLZ 3CCJZ 3U50C 2LEXA 3QWUA 2IZ4A 3GTQI 3GKQA 1ZB9A 1TFIA 1YUAA 1QVGY 4E2XA 3CD61 4QTUA 3VMIA 2E7ZA 2W03A 3J7A4 2B63I 5FLXf 2JR6A 3I551 1Y8CA 4MONA 3HOVI 3Q87A 2DE6A 5FLMI 3G711 2R6MA 1WZNA 4HGZA 1RO2A 2RHBA 3CCR1 4NFRA 2AKLA 3GTJI 1VQKZ 4A3FI 4E33A 3OW2Z 4A3LI 2V3VA 3CMEZ 3CCLZ 1YIT1 4E30A 4A3CI 1M1K1 1VQNZ 4DGLA 2VPWA 3CCU1 2JIRA 3PO3I 3GTOI 1Q7Y2 2WAQA 3S15I 1KQSY 2JIOA 3CPWY 4BY1I 1YJN1 4RVHA 3CXCY 1VQ5Z 1W2BZ 1KD11 2ZAEB 2VUMI 4HGYA 3CCQZ 4Y7NI 1K9M2 1USPA 4HH4A 1VQO1 3EEDA 3FQMA 1ZB8A 2JNYA 1KRLA 4A3MI 3GTMS 3IR7A 3S1NI 3I07A 1USPB 2QKDA 4E32A 1NUIA 1VQPZ 3CC71 3NH8A 2PM9A 3PO2I 2H85A 3CCUZ 4CL1A 2VPYA 1Z03A 2QEXZ 1VQL1 4XX2A 4E31A 5D1PA 2RBLA 1YJNZ 3ESWA 3S17I 3EERA 4RVFA 1Z02A 5D1OA 4NH1C 2P3YA 2NVXI 3G4S1 1M1K2 1VQOZ 3MZKB 3J80f 1VQK1 2I3CA 1K8A1 3GTLI 1VQ61 2BJOA 3J80b 3CME1 3HOZI 1Y1VS 2PMZA 1TWCI 1VQN1 1S72Z 1QYPA 1KD12 5LL6f 1Q16A 2JUBA 1I50I 1FDIA 5IP7I 2JIMA 3CMA1 3HKZA 2IV2X 1VQ51 1TWAI 2WB1A 2V8IA 3CCQ1 1TWFI 3G4SZ 3S1QI 3BG1B 3CXCZ 1P9NA 1WCMI 1QVFZ 3T4NB 4NBCA 4MXUA 3HOXI 1VQ6Z 3JAMb 3CCVZ 5T64A 1VQP1 1Z01A 1YI2Z 4NBAA 3IF8A 2QEX1 3HOWI 2OTL1 1SFOI 1AA6A 1N8R1 4BXXI 1JWHC 1RNIA 2QLVB 3I561 2QA41 2QRDB 2VF1A 2DE5A 4MRIA 3CMAZ 2OZKA 1JJ2Z 2NVQI 2LFUA 1Q811 3H3VJ 3CC2Z 3PO3S 3I4MI 1K8A2 4EWCA 4NOZA 3IFUA 2R92I 3GTKI 2K3RA 1VQ4Z 3LUSA 3GTPI 1VQ91 2YU9I 2KPIA 1YJWZ 1R9TI 3FQQA 2KI7B 4RVGA 3MZLB 3CCSZ 1QXFA 1S721 2K5RA 3K7AI 1VQMZ 2G2KA 3F3FC 1FDOA 3D6WA 4NBDA 2GU2A 5C3EI 5IT9f 3KIHA 2OTLZ 3J81b 4A93I 2R93I 5IT9b 2QA4Z 3I56Z 3G6E1 3NDJA 1X3WA 1NP6A 2OTJZ 2JIPA 1RO0A 2F4OA 2IZ3A 2JA5I 1KC81 4A3EI 1QVGZ 4TNUA 1VQ7Z 2VUGA 2HU9A 3MONA 1W2BY 3D9XA 4A3GI 2PK7A 1WIIA 1VQ8Z 4MD8A 4RV9A 1N8R2 3RZOI 1VQ9Z 4MH4A 2JA7I 2GTHA 3CCV1 1YJ9Z 1YI21 1Y1WI 1Q812 4NBBA 4RS4A 1Y1VI 3TDHB 1LQLA 2E2HI 4BBRI 1Q861 4RVDA 2VPXA 1QF8A 2QREB 4DK1A 3G6EZ 3CC21 1KQSZ 1I6HI 2HF1A 1RLYA 3F3PC 3CPWZ 2NVYI 1YIJZ 1RQFA 1TWHI 2AYDA 1I3QI 5CM2M 1VQ41 3S16I 3I4NI 2RPRA 2Q4ZA 3FKII 1YJW1 3HOYI 3JAMf 2JIQA 2J6AA 2OOYB 3VB9A 1Q821 3CCS1 2JA6I 1RO4A 1VQM1 3M4OI 3VMGA 3CCEZ 2E2JI 1K83I 5FLXb 1S7MA 1X3ZA 4NBGA
chains in the Genus database with same CATH topology
3GTGI 2O4HA 1KC82 1WW9A 3VTNA 5A2Qf 5C4JI 1K731 1NJI1 4NBEA 2V8JA 1L1OC 5A2Qb 3BG0B 2QR1B 2OTJ1 4E2WA 4A3KI 1M901 4MD7A 4BY7I 4X6AI 1VQ71 1YHQZ 3IX0A 1VQ81 2E2II 5AN9F 3CCM1 2W04A 1Q862 3NFZA 2Y0SA 5T67A 2YADA 1YJ91 3CD6Z 3GTMI 3S1MI 3NH5A 1QVFY 2F4MA 2GTIA 3H0GI 2M48A 3I55Z 3J81f 4DQYB 3HOUI 4NB9A 3CC41 2E9HA 3OW2Y 3G71Z 1TWGI 3CQZI 3S2DI 1PFTA 3CCRZ 3P5JB 2QRCB 1N2FA 2OOXB 5C44I 4Y52I 2EGTA 4A3DI 1YITZ 1DL6A 4S1TA 2M6NA 1Q822 4BBSI 4A3BI 1YIJ1 2JMOA 1JJ2Y 3CCJ1 4A3II 2R7ZI 4E2ZA 4E2YA 1YUKA 2DE7A 3TE5B 5IP9I 4NB8A 3CCMZ 1K732 4NBFA 1NJI2 1VLAA 3S2HI 3RZDI 3M3YI 3CCE1 1Q7Y1 4MD9A 2O53A 2RIQA 5C4XI 3KIFA 2NVTI 2RT9A 1ZH1A 3NH4A 2P28A 1M902 3CC4Z 3NDIA 5T6BA 3GCFA 4NBHA 2V8KA 5D1OB 1ML8A 3S1RI 3CCL1 2Q51A 4A3JI 1K9M1 4AYBA 2LIYA 3CC7Z 3S14I 1X0TA 2JS4A 1YHQ1 2JA8I 4QTTA 3VMHA 1VQLZ 3CCJZ 3U50C 3QWUA 2IZ4A 3GTQI 3GKQA 1ZB9A 1TFIA 1YUAA 1QVGY 4E2XA 3CD61 4QTUA 3VMIA 2W03A 3J7A4 2B63I 5FLXf 2JR6A 3I551 4MONA 3HOVI 3Q87A 2DE6A 5FLMI 3G711 2R6MA 4HGZA 1RO2A 2RHBA 3CCR1 4NFRA 2AKLA 3GTJI 1VQKZ 4A3FI 4E33A 3OW2Z 4A3LI 3CMEZ 3CCLZ 1YIT1 4E30A 4A3CI 1M1K1 1VQNZ 4DGLA 3CCU1 3PO3I 3GTOI 1Q7Y2 2WAQA 3S15I 1KQSY 3CPWY 4BY1I 1YJN1 4RVHA 3CXCY 1VQ5Z 1W2BZ 1KD11 2ZAEB 2VUMI 4HGYA 3CCQZ 4Y7NI 1K9M2 1USPA 4HH4A 1VQO1 3EEDA 3FQMA 1ZB8A 2JNYA 1KRLA 4A3MI 3GTMS 3S1NI 3I07A 1USPB 2QKDA 4E32A 1NUIA 1VQPZ 3CC71 3NH8A 2PM9A 3PO2I 2H85A 3CCUZ 4CL1A 2QEXZ 1Z03A 1VQL1 4XX2A 4E31A 5D1PA 2RBLA 1YJNZ 3ESWA 3S17I 3EERA 4RVFA 1Z02A 5D1OA 4NH1C 2P3YA 2NVXI 3G4S1 1M1K2 1VQOZ 3MZKB 3J80f 1VQK1 2I3CA 1K8A1 3GTLI 1VQ61 2BJOA 3J80b 3CME1 3HOZI 1Y1VS 2PMZA 1TWCI 1VQN1 1S72Z 1QYPA 1KD12 5LL6f 2JUBA 1I50I 5IP7I 3CMA1 3HKZA 1VQ51 1TWAI 2WB1A 2V8IA 3CCQ1 1TWFI 3G4SZ 3S1QI 3BG1B 3CXCZ 1P9NA 1WCMI 1QVFZ 3T4NB 4NBCA 4MXUA 3HOXI 1VQ6Z 3JAMb 3CCVZ 5T64A 1VQP1 1Z01A 1YI2Z 4NBAA 3IF8A 2QEX1 3HOWI 2OTL1 1SFOI 1N8R1 4BXXI 1JWHC 1RNIA 2QLVB 3I561 2QA41 2QRDB 2VF1A 2DE5A 4MRIA 3CMAZ 2OZKA 1JJ2Z 2NVQI 2LFUA 1Q811 3H3VJ 3CC2Z 3PO3S 3I4MI 1K8A2 4EWCA 4NOZA 3IFUA 2R92I 3GTKI 2K3RA 1VQ4Z 3LUSA 3GTPI 1VQ91 2YU9I 2KPIA 1YJWZ 1R9TI 3FQQA 2KI7B 4RVGA 3MZLB 3CCSZ 1S721 2K5RA 3K7AI 1VQMZ 2G2KA 3F3FC 3D6WA 4NBDA 2GU2A 5C3EI 5IT9f 3KIHA 2OTLZ 3J81b 4A93I 2R93I 5IT9b 2QA4Z 3I56Z 3G6E1 3NDJA 1X3WA 1NP6A 2OTJZ 1RO0A 2F4OA 2IZ3A 2JA5I 1KC81 4A3EI 1QVGZ 4TNUA 1VQ7Z 2VUGA 2HU9A 3MONA 1W2BY 3D9XA 4A3GI 2PK7A 1WIIA 1VQ8Z 4MD8A 4RV9A 1N8R2 3RZOI 1VQ9Z 4MH4A 2JA7I 2GTHA 3CCV1 1YJ9Z 1YI21 1Y1WI 1Q812 4NBBA 4RS4A 1Y1VI 3TDHB 1LQLA 2E2HI 4BBRI 1Q861 4RVDA 1QF8A 2QREB 4DK1A 3G6EZ 3CC21 1KQSZ 1I6HI 2HF1A 1RLYA 3F3PC 3CPWZ 2NVYI 1YIJZ 1RQFA 1TWHI 1VQ41 1I3QI 5CM2M 3S16I 3I4NI 2RPRA 2Q4ZA 3FKII 1YJW1 3HOYI 3JAMf 2J6AA 2OOYB 3VB9A 1Q821 3CCS1 2JA6I 1RO4A 1VQM1 3M4OI 3VMGA 3CCEZ 2E2JI 1K83I 5FLXb 1S7MA 1X3ZA 4NBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG I;  2YU9 I;  2KPI A;  1R9T I;  1WW9 A;  3S14 I;  2JS4 A;  5C4J I;  2JA8 I;  4NBE A;  4QTT A;  2P3Y A;  3VMH A;  1L1O C;  2NVX I;  3U50 C;  2K5R A;  3K7A I;  3D6W A;  3GTQ I;  4A3K I;  3GKQ A;  1ZB9 A;  4NBD A;  5C3E I;  1TFI A;  1YUA A;  4BY7 I;  4QTU A;  3VMI A;  4X6A I;  4A93 I;  2R93 I;  3GTL I;  2BJO A;  3HOZ I;  2B63 I;  1Y1V S;  2JR6 A;  3HOV I;  3Q87 A;  1TWC I;  1X3W A;  2E2I I;  2DE6 A;  1QYP A;  5FLM I;  2F4O A;  2JA5 I;  3GTM I;  1I50 I;  4A3E I;  2AKL A;  5IP7 I;  3GTJ I;  3S1M I;  4A3F I;  4A3L I;  2F4M A;  3H0G I;  4A3G I;  3HOU I;  4A3C I;  4NB9 A;  2PK7 A;  3RZO I;  1TWA I;  4MH4 A;  3PO3 I;  1TWG I;  3GTO I;  3CQZ I;  3S2D I;  2JA7 I;  1PFT A;  3S15 I;  1TWF I;  3S1Q I;  1Y1W I;  5C44 I;  1N2F A;  1WCM I;  4Y52 I;  4BY1 I;  4NBB A;  1Y1V I;  4A3D I;  1DL6 A;  1LQL A;  2E2H I;  4NBC A;  4BBR I;  4BBS I;  4A3B I;  2VUM I;  3HOX I;  4A3I I;  2R7Z I;  4Y7N I;  2DE7 A;  1USP A;  4NBA A;  4NB8 A;  5IP9 I;  1ZB8 A;  2JNY A;  2HF1 A;  1I6H I;  1RLY A;  3HOW I;  4NBF A;  1VLA A;  4A3M I;  2NVY I;  1SFO I;  3GTM S;  3S2H I;  4BXX I;  3RZD I;  3M3Y I;  3S1N I;  1TWH I;  3I07 A;  1I3Q I;  5CM2 M;  3S16 I;  1USP B;  5C4X I;  2NVT I;  2DE5 A;  3I4N I;  2NVQ I;  1NUI A;  3H3V J;  3FKI I;  3PO3 S;  3HOY I;  3I4M I;  3PO2 I;  3GCF A;  4NBH A;  4NOZ A;  4XX2 A;  2J6A A;  3VB9 A;  1ML8 A;  2JA6 I;  3S1R I;  2R92 I;  1RO4 A;  3M4O I;  3VMG A;  3GTK I;  2E2J I;  4A3J I;  2RBL A;  3LUS A;  1K83 I;  3GTP I;  3ESW A;  3S17 I;  3EER A;  1X3Z A;  4NBG A; 
#chains in the Genus database with same CATH topology
 3GTG I;  2O4H A;  1KC8 2;  1WW9 A;  3VTN A;  5A2Q f;  5C4J I;  1K73 1;  1NJI 1;  3D2L A;  4NBE A;  2V8J A;  1L1O C;  5A2Q b;  3BG0 B;  2QR1 B;  2OTJ 1;  4E2W A;  4A3K I;  1M90 1;  4MD7 A;  4BY7 I;  4X6A I;  1VQ7 1;  1YHQ Z;  3IX0 A;  1SIW A;  1VQ8 1;  2E2I I;  5AN9 F;  3CCM 1;  2W04 A;  1Q86 2;  3NFZ A;  2Y0S A;  5T67 A;  2YAD A;  1YJ9 1;  3CD6 Z;  3GTM I;  2V45 A;  3S1M I;  3NH5 A;  1QVF Y;  2F4M A;  2GTI A;  3H0G I;  2M48 A;  3I55 Z;  3J81 f;  4DQY B;  3HOU I;  4NB9 A;  3CC4 1;  2E9H A;  3OW2 Y;  3G71 Z;  1WJ2 A;  1TWG I;  3CQZ I;  3S2D I;  1PFT A;  3CCR Z;  3P5J B;  2QRC B;  1N2F A;  2OOX B;  5C44 I;  4Y52 I;  2EGT A;  4A3D I;  1YIT Z;  1DL6 A;  4S1T A;  2M6N A;  1Q82 2;  4BBS I;  4A3B I;  1YIJ 1;  2JMO A;  1JJ2 Y;  3CCJ 1;  4A3I I;  2R7Z I;  4E2Z A;  4E2Y A;  1YUK A;  2DE7 A;  3TE5 B;  5IP9 I;  4NB8 A;  3CCM Z;  1K73 2;  4NBF A;  1NJI 2;  1VLA A;  3S2H I;  3RZD I;  3M3Y I;  3CCE 1;  1Q7Y 1;  2NAP A;  4MD9 A;  2O53 A;  2RIQ A;  5C4X I;  3KIF A;  2NVT I;  2RT9 A;  1ZH1 A;  3NH4 A;  2P28 A;  1M90 2;  3CC4 Z;  3NDI A;  5T6B A;  3GCF A;  4NBH A;  2V8K A;  5D1O B;  1ML8 A;  3S1R I;  3CCL 1;  2VPZ A;  2Q51 A;  4A3J I;  1K9M 1;  4AYB A;  2LIY A;  3CC7 Z;  3S14 I;  1X0T A;  2JS4 A;  1YHQ 1;  2JA8 I;  4QTT A;  3VMH A;  1VQL Z;  3CCJ Z;  3U50 C;  2LEX A;  3QWU A;  2IZ4 A;  3GTQ I;  3GKQ A;  1ZB9 A;  1TFI A;  1YUA A;  1QVG Y;  4E2X A;  3CD6 1;  4QTU A;  3VMI A;  2E7Z A;  2W03 A;  3J7A 4;  2B63 I;  5FLX f;  2JR6 A;  3I55 1;  1Y8C A;  4MON A;  3HOV I;  3Q87 A;  2DE6 A;  5FLM I;  3G71 1;  2R6M A;  1WZN A;  4HGZ A;  1RO2 A;  2RHB A;  3CCR 1;  4NFR A;  2AKL A;  3GTJ I;  1VQK Z;  4A3F I;  4E33 A;  3OW2 Z;  4A3L I;  2V3V A;  3CME Z;  3CCL Z;  1YIT 1;  4E30 A;  4A3C I;  1M1K 1;  1VQN Z;  4DGL A;  2VPW A;  3CCU 1;  2JIR A;  3PO3 I;  3GTO I;  1Q7Y 2;  2WAQ A;  3S15 I;  1KQS Y;  2JIO A;  3CPW Y;  4BY1 I;  1YJN 1;  4RVH A;  3CXC Y;  1VQ5 Z;  1W2B Z;  1KD1 1;  2ZAE B;  2VUM I;  4HGY A;  3CCQ Z;  4Y7N I;  1K9M 2;  1USP A;  4HH4 A;  1VQO 1;  3EED A;  3FQM A;  1ZB8 A;  2JNY A;  1KRL A;  4A3M I;  3GTM S;  3IR7 A;  3S1N I;  3I07 A;  1USP B;  2QKD A;  4E32 A;  1NUI A;  1VQP Z;  3CC7 1;  3NH8 A;  2PM9 A;  3PO2 I;  2H85 A;  3CCU Z;  4CL1 A;  2VPY A;  1Z03 A;  2QEX Z;  1VQL 1;  4XX2 A;  4E31 A;  5D1P A;  2RBL A;  1YJN Z;  3ESW A;  3S17 I;  3EER A;  4RVF A;  1Z02 A;  5D1O A;  4NH1 C;  2P3Y A;  2NVX I;  3G4S 1;  1M1K 2;  1VQO Z;  3MZK B;  3J80 f;  1VQK 1;  2I3C A;  1K8A 1;  3GTL I;  1VQ6 1;  2BJO A;  3J80 b;  3CME 1;  3HOZ I;  1Y1V S;  2PMZ A;  1TWC I;  1VQN 1;  1S72 Z;  1QYP A;  1KD1 2;  5LL6 f;  1Q16 A;  2JUB A;  1I50 I;  1FDI A;  5IP7 I;  2JIM A;  3CMA 1;  3HKZ A;  2IV2 X;  1VQ5 1;  1TWA I;  2WB1 A;  2V8I A;  3CCQ 1;  1TWF I;  3G4S Z;  3S1Q I;  3BG1 B;  3CXC Z;  1P9N A;  1WCM I;  1QVF Z;  3T4N B;  4NBC A;  4MXU A;  3HOX I;  1VQ6 Z;  3JAM b;  3CCV Z;  5T64 A;  1VQP 1;  1Z01 A;  1YI2 Z;  4NBA A;  3IF8 A;  2QEX 1;  3HOW I;  2OTL 1;  1SFO I;  1AA6 A;  1N8R 1;  4BXX I;  1JWH C;  1RNI A;  2QLV B;  3I56 1;  2QA4 1;  2QRD B;  2VF1 A;  2DE5 A;  4MRI A;  3CMA Z;  2OZK A;  1JJ2 Z;  2NVQ I;  2LFU A;  1Q81 1;  3H3V J;  3CC2 Z;  3PO3 S;  3I4M I;  1K8A 2;  4EWC A;  4NOZ A;  3IFU A;  2R92 I;  3GTK I;  2K3R A;  1VQ4 Z;  3LUS A;  3GTP I;  1VQ9 1;  2YU9 I;  2KPI A;  1YJW Z;  1R9T I;  3FQQ A;  2KI7 B;  4RVG A;  3MZL B;  3CCS Z;  1QXF A;  1S72 1;  2K5R A;  3K7A I;  1VQM Z;  2G2K A;  3F3F C;  1FDO A;  3D6W A;  4NBD A;  2GU2 A;  5C3E I;  5IT9 f;  3KIH A;  2OTL Z;  3J81 b;  4A93 I;  2R93 I;  5IT9 b;  2QA4 Z;  3I56 Z;  3G6E 1;  3NDJ A;  1X3W A;  1NP6 A;  2OTJ Z;  2JIP A;  1RO0 A;  2F4O A;  2IZ3 A;  2JA5 I;  1KC8 1;  4A3E I;  1QVG Z;  4TNU A;  1VQ7 Z;  2VUG A;  2HU9 A;  3MON A;  1W2B Y;  3D9X A;  4A3G I;  2PK7 A;  1WII A;  1VQ8 Z;  4MD8 A;  4RV9 A;  1N8R 2;  3RZO I;  1VQ9 Z;  4MH4 A;  2JA7 I;  2GTH A;  3CCV 1;  1YJ9 Z;  1YI2 1;  1Y1W I;  1Q81 2;  4NBB A;  4RS4 A;  1Y1V I;  3TDH B;  1LQL A;  2E2H I;  4BBR I;  1Q86 1;  4RVD A;  2VPX A;  1QF8 A;  2QRE B;  4DK1 A;  3G6E Z;  3CC2 1;  1KQS Z;  1I6H I;  2HF1 A;  1RLY A;  3F3P C;  3CPW Z;  2NVY I;  1YIJ Z;  1RQF A;  1TWH I;  2AYD A;  1I3Q I;  5CM2 M;  1VQ4 1;  3S16 I;  3I4N I;  2RPR A;  2Q4Z A;  3FKI I;  1YJW 1;  3HOY I;  3JAM f;  2JIQ A;  2J6A A;  2OOY B;  3VB9 A;  1Q82 1;  3CCS 1;  2JA6 I;  1RO4 A;  1VQM 1;  3M4O I;  3VMG A;  3CCE Z;  2E2J I;  1K83 I;  5FLX b;  1S7M A;  1X3Z A;  4NBG A; 
#chains in the Genus database with same CATH homology
 3GTG I;  2O4H A;  1KC8 2;  1WW9 A;  3VTN A;  5A2Q f;  5C4J I;  1K73 1;  1NJI 1;  4NBE A;  2V8J A;  1L1O C;  5A2Q b;  3BG0 B;  2QR1 B;  2OTJ 1;  4E2W A;  4A3K I;  1M90 1;  4MD7 A;  4BY7 I;  4X6A I;  1VQ7 1;  1YHQ Z;  3IX0 A;  1VQ8 1;  2E2I I;  5AN9 F;  3CCM 1;  2W04 A;  1Q86 2;  3NFZ A;  2Y0S A;  5T67 A;  2YAD A;  1YJ9 1;  3CD6 Z;  3GTM I;  3S1M I;  3NH5 A;  1QVF Y;  2F4M A;  2GTI A;  3H0G I;  2M48 A;  3I55 Z;  3J81 f;  4DQY B;  3HOU I;  4NB9 A;  3CC4 1;  2E9H A;  3OW2 Y;  3G71 Z;  1TWG I;  3CQZ I;  3S2D I;  1PFT A;  3CCR Z;  3P5J B;  2QRC B;  1N2F A;  2OOX B;  5C44 I;  4Y52 I;  2EGT A;  4A3D I;  1YIT Z;  1DL6 A;  4S1T A;  2M6N A;  1Q82 2;  4BBS I;  4A3B I;  1YIJ 1;  2JMO A;  1JJ2 Y;  3CCJ 1;  4A3I I;  2R7Z I;  4E2Z A;  4E2Y A;  1YUK A;  2DE7 A;  3TE5 B;  5IP9 I;  4NB8 A;  3CCM Z;  1K73 2;  4NBF A;  1NJI 2;  1VLA A;  3S2H I;  3RZD I;  3M3Y I;  3CCE 1;  1Q7Y 1;  4MD9 A;  2O53 A;  2RIQ A;  5C4X I;  3KIF A;  2NVT I;  2RT9 A;  1ZH1 A;  3NH4 A;  2P28 A;  1M90 2;  3CC4 Z;  3NDI A;  5T6B A;  3GCF A;  4NBH A;  2V8K A;  5D1O B;  1ML8 A;  3S1R I;  3CCL 1;  2Q51 A;  4A3J I;  1K9M 1;  4AYB A;  2LIY A;  3CC7 Z;  3S14 I;  1X0T A;  2JS4 A;  1YHQ 1;  2JA8 I;  4QTT A;  3VMH A;  1VQL Z;  3CCJ Z;  3U50 C;  3QWU A;  2IZ4 A;  3GTQ I;  3GKQ A;  1ZB9 A;  1TFI A;  1YUA A;  1QVG Y;  4E2X A;  3CD6 1;  4QTU A;  3VMI A;  2W03 A;  3J7A 4;  2B63 I;  5FLX f;  2JR6 A;  3I55 1;  4MON A;  3HOV I;  3Q87 A;  2DE6 A;  5FLM I;  3G71 1;  2R6M A;  4HGZ A;  1RO2 A;  2RHB A;  3CCR 1;  4NFR A;  2AKL A;  3GTJ I;  1VQK Z;  4A3F I;  4E33 A;  3OW2 Z;  4A3L I;  3CME Z;  3CCL Z;  1YIT 1;  4E30 A;  4A3C I;  1M1K 1;  1VQN Z;  4DGL A;  3CCU 1;  3PO3 I;  3GTO I;  1Q7Y 2;  2WAQ A;  3S15 I;  1KQS Y;  3CPW Y;  4BY1 I;  1YJN 1;  4RVH A;  3CXC Y;  1VQ5 Z;  1W2B Z;  1KD1 1;  2ZAE B;  2VUM I;  4HGY A;  3CCQ Z;  4Y7N I;  1K9M 2;  1USP A;  4HH4 A;  1VQO 1;  3EED A;  3FQM A;  1ZB8 A;  2JNY A;  1KRL A;  4A3M I;  3GTM S;  3S1N I;  3I07 A;  1USP B;  2QKD A;  4E32 A;  1NUI A;  1VQP Z;  3CC7 1;  3NH8 A;  2PM9 A;  3PO2 I;  2H85 A;  3CCU Z;  4CL1 A;  2QEX Z;  1Z03 A;  1VQL 1;  4XX2 A;  4E31 A;  5D1P A;  2RBL A;  1YJN Z;  3ESW A;  3S17 I;  3EER A;  4RVF A;  1Z02 A;  5D1O A;  4NH1 C;  2P3Y A;  2NVX I;  3G4S 1;  1M1K 2;  1VQO Z;  3MZK B;  3J80 f;  1VQK 1;  2I3C A;  1K8A 1;  3GTL I;  1VQ6 1;  2BJO A;  3J80 b;  3CME 1;  3HOZ I;  1Y1V S;  2PMZ A;  1TWC I;  1VQN 1;  1S72 Z;  1QYP A;  1KD1 2;  5LL6 f;  2JUB A;  1I50 I;  5IP7 I;  3CMA 1;  3HKZ A;  1VQ5 1;  1TWA I;  2WB1 A;  2V8I A;  3CCQ 1;  1TWF I;  3G4S Z;  3S1Q I;  3BG1 B;  3CXC Z;  1P9N A;  1WCM I;  1QVF Z;  3T4N B;  4NBC A;  4MXU A;  3HOX I;  1VQ6 Z;  3JAM b;  3CCV Z;  5T64 A;  1VQP 1;  1Z01 A;  1YI2 Z;  4NBA A;  3IF8 A;  2QEX 1;  3HOW I;  2OTL 1;  1SFO I;  1N8R 1;  4BXX I;  1JWH C;  1RNI A;  2QLV B;  3I56 1;  2QA4 1;  2QRD B;  2VF1 A;  2DE5 A;  4MRI A;  3CMA Z;  2OZK A;  1JJ2 Z;  2NVQ I;  2LFU A;  1Q81 1;  3H3V J;  3CC2 Z;  3PO3 S;  3I4M I;  1K8A 2;  4EWC A;  4NOZ A;  3IFU A;  2R92 I;  3GTK I;  2K3R A;  1VQ4 Z;  3LUS A;  3GTP I;  1VQ9 1;  2YU9 I;  2KPI A;  1YJW Z;  1R9T I;  3FQQ A;  2KI7 B;  4RVG A;  3MZL B;  3CCS Z;  1S72 1;  2K5R A;  3K7A I;  1VQM Z;  2G2K A;  3F3F C;  3D6W A;  4NBD A;  2GU2 A;  5C3E I;  5IT9 f;  3KIH A;  2OTL Z;  3J81 b;  4A93 I;  2R93 I;  5IT9 b;  2QA4 Z;  3I56 Z;  3G6E 1;  3NDJ A;  1X3W A;  1NP6 A;  2OTJ Z;  1RO0 A;  2F4O A;  2IZ3 A;  2JA5 I;  1KC8 1;  4A3E I;  1QVG Z;  4TNU A;  1VQ7 Z;  2VUG A;  2HU9 A;  3MON A;  1W2B Y;  3D9X A;  4A3G I;  2PK7 A;  1WII A;  1VQ8 Z;  4MD8 A;  4RV9 A;  1N8R 2;  3RZO I;  1VQ9 Z;  4MH4 A;  2JA7 I;  2GTH A;  3CCV 1;  1YJ9 Z;  1YI2 1;  1Y1W I;  1Q81 2;  4NBB A;  4RS4 A;  1Y1V I;  3TDH B;  1LQL A;  2E2H I;  4BBR I;  1Q86 1;  4RVD A;  1QF8 A;  2QRE B;  4DK1 A;  3G6E Z;  3CC2 1;  1KQS Z;  1I6H I;  2HF1 A;  1RLY A;  3F3P C;  3CPW Z;  2NVY I;  1YIJ Z;  1RQF A;  1TWH I;  1VQ4 1;  1I3Q I;  5CM2 M;  3S16 I;  3I4N I;  2RPR A;  2Q4Z A;  3FKI I;  1YJW 1;  3HOY I;  3JAM f;  2J6A A;  2OOY B;  3VB9 A;  1Q82 1;  3CCS 1;  2JA6 I;  1RO4 A;  1VQM 1;  3M4O I;  3VMG A;  3CCE Z;  2E2J I;  1K83 I;  5FLX b;  1S7M A;  1X3Z A;  4NBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...