1I3QI

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI01
5C4JI 2VUMI 3PO3S 2P3YA 3GCFA 5IP7I 4NBGA 3GTMI 2JA5I 3HOYI 4Y52I 2B63I 2NVTI 3I4MI 1ZB8A 4A3KI 1X3WA 4NB9A 2AKLA 3S2HI 3S16I 2JA6I 4NBFA 3M3YI 3PO3I 3HOWI 5CM2M 1I3QI 3VB9A 3I4NI 3GTMS 4BY7I 2E2JI 3S14I 1WW9A 5IP9I 3RZOI 1X3ZA 3S1RI 3VMHA 3VMGA 2NVXI 3K7AI 1DL6A 1K83I 1RO4A 1YUAA 2JS4A 4BXXI 1USPB 3U50C 1VLAA 4NBEA 4BBSI 3FKII 2E2II 3S17I 2KPIA 3Q87A 4NBHA 3HOXI 4A3EI 3GTPI 4A3DI 4X6AI 2E2HI 3EERA 1RLYA 1L1OC 3RZDI 2JNYA 5C3EI 3S15I 4NOZA 1PFTA 1QYPA 1ZB9A 3HOZI 2DE5A 4NBAA 1TWGI 3GKQA 4A3JI 1WCMI 3S1MI 1TWAI 3HOUI 3D6WA 4A3FI 2DE7A 4A3BI 5C4XI 1LQLA 2NVYI 2R92I 2DE6A 1TWFI 4BY1I 3H3VJ 3M4OI 2R7ZI 1USPA 1TWHI 4NBCA 3GTJI 1TWCI 3ESWA 4NBDA 1N2FA 4A3CI 1Y1VS 4A3MI 2RBLA 5C44I 2F4MA 3S1QI 1R9TI 4QTTA 3S2DI 3I07A 3VMIA 2YU9I 2K5RA 4BBRI 1SFOI 4NB8A 4QTUA 4Y7NI 3GTQI 1ML8A 3GTOI 4A93I 4A3GI 3GTLI 1I50I 2PK7A 4MH4A 3GTKI 1Y1VI 2F4OA 4XX2A 2J6AA 1Y1WI 1I6HI 4A3II 2JR6A 3HOVI 2HF1A 2R93I 5FLMI 2NVQI 1NUIA 1TFIA 4NBBA 2JA8I 3S1NI 2JA7I 4A3LI 3LUSA 3H0GI 3PO2I 2BJOA 3CQZI 3GTGI
chains in the Genus database with same CATH superfamily
5C4JI 3PO3S 3OW2Z 1YUKA 2RHBA 3KIHA 4DQYB 1KD11 3HOYI 4NFRA 1YJWZ 1ZB8A 4RVHA 4A3KI 1VQK1 1X3WA 3CCRZ 3S2HI 3S16I 2JA6I 3P5JB 3GTMS 1NJI1 1Q7Y2 3S14I 2GTIA 2O4HA 3J80f 4DK1A 3VMHA 1YHQZ 2NVXI 1FDIA 3I551 2JIRA 1RO4A 3CXCZ 4BXXI 2H85A 5LL6f 1RO0A 3HOXI 4A3EI 3GTPI 1Q812 2E2HI 1L1OC 1YJW1 2JIPA 1Z03A 3RZDI 5C3EI 5T6BA 4NOZA 2GTHA 1RNIA 2JIOA 3I561 4NBAA 1TWGI 3FQMA 1Z01A 2JIMA 1TWAI 1VQM1 3BG1B 3I55Z 2YADA 3G4S1 4A3FI 4BY1I 2QRCB 3H3VJ 2QA41 2OZKA 2R7ZI 1YI2Z 5IT9b 1M1K1 4A3CI 4TNUA 4HGZA 3S1QI 5AN9F 3CCS1 3G6EZ 2IZ4A 3IR7A 4E2XA 2K5RA 2HU9A 4E31A 2E7ZA 3GTQI 4NB8A 1ML8A 3MZKB 3GTOI 3GTLI 2PK7A 2QR1B 3IFUA 1I6HI 2J6AA 2JR6A 4DGLA 3CXCY 4E2ZA 5FLMI 1VQ81 3G6E1 2OTJ1 3CC71 1YIJ1 3CCE1 4RV9A 1QVFZ 3QWUA 2P3YA 1VQLZ 1VQ5Z 1QXFA 5T67A 3MZLB 3I4MI 3TDHB 2AKLA 2QEXZ 1S72Z 1VQOZ 3HOWI 5CM2M 1I3QI 3G4SZ 4BY7I 1Y8CA 3D2LA 3CCL1 1VQMZ 1Q821 4RVGA 3RZOI 2V3VA 1JJ2Y 4E30A 2E9HA 2NAPA 3G711 1VQNZ 1Q16A 1K83I 2O53A 3U50C 1K732 4E32A 2VUGA 2E2II 2KPIA 3Q87A 4NBHA 4MD8A 3CD61 4X6AI 3NH8A 3CCQZ 1YJNZ 3HKZA 4CL1A 1PFTA 5D1OB 1ZB9A 2DE5A 1YHQ1 1KC81 4A3JI 1QF8A 1VQ71 3TE5B 3S1MI 2QLVB 3CCM1 1KRLA 1LQLA 1S7MA 2R92I 1VQKZ 3M4OI 2AYDA 4NBCA 1TWCI 1N2FA 1Y1VS 4A3MI 1KQSZ 3I07A 3IF8A 2YU9I 4RS4A 4RVDA 1SFOI 4QTUA 2OOYB 2I3CA 4Y7NI 4AYBA 4MD7A 2VPXA 1JJ2Z 2OTL1 1Y1VI 2F4OA 2R93I 1N8R1 2JA8I 2V45A 1QVFY 3S1NI 2JA7I 1K9M2 2LEXA 2W03A 3PO2I 1NJI2 3CCJ1 2BJOA 3CQZI 2VUMI 3OW2Y 3GCFA 4MRIA 2VPYA 4Y52I 1FDOA 1WIIA 2GU2A 2QKDA 1X0TA 3CC21 3CCV1 3CMEZ 1NP6A 2Y0SA 4NBFA 3PO3I 3CCU1 1YJ9Z 1K8A1 2E2JI 2W04A 1WW9A 1X3ZA 2WB1A 3CPWZ 3S1RI 4RVFA 3CCQ1 1N8R2 2QRDB 1VQP1 5A2Qb 3VMGA 3K7AI 1VQ6Z 1DL6A 4E33A 1WJ2A 1M902 1YUAA 1USPB 2P28A 2R6MA 1VLAA 1W2BZ 1VQN1 4EWCA 2LFUA 3G71Z 3CCUZ 3F3PC 3CC41 1SIWA 3CC4Z 2PM9A 2JNYA 3S15I 2Q51A 1S721 2QEX1 5T64A 1QVGY 1QYPA 3GKQA 1M1K2 5D1OA 3HOUI 2V8IA 1VQ61 3D6WA 2Q4ZA 3J7A4 1VQPZ 3NDJA 3CCEZ 1VQ8Z 1USPA 3NH5A 1QVGZ 4NBDA 1VQ9Z 2JIQA 3CMAZ 3CME1 4E2WA 2F4MA 1WZNA 1R9TI 2VF1A 3S2DI 3JAMb 4BBRI 4A3GI 2PMZA 3T4NB 1K731 4MH4A 3CCSZ 5FLXb 3GTKI 1VQ41 1VQ4Z 1Y1WI 4A3II 2RT9A 3HOVI 2V8KA 3FQQA 2JUBA 5D1PA 2NVQI 1NUIA 1TFIA 2V8JA 2WAQA 1M901 1Q861 1RO2A 1Q822 2JMOA 2RPRA 3MONA 3H0GI 2IV2X 2QA4Z 2OTLZ 3GTGI 3CMA1 1ZH1A 1VQ91 5IP7I 4NBGA 3GTMI 2JA5I 2B63I 2KI7B 1Q7Y1 2NVTI 1W2BY 3I56Z 1KQSY 2G2KA 1RQFA 4NB9A 1AA6A 4HGYA 3CD6Z 2VPWA 3M3YI 1Z02A 3I4NI 3VB9A 2K3RA 1KD12 5IP9I 1Q862 2LIYA 4MONA 3CCMZ 1K9M1 2JS4A 3J81f 1VQ7Z 1JWHC 4NBEA 4BBSI 3FKII 4MXUA 3CCLZ 3IX0A 3S17I 2RIQA 5A2Qf 4A3DI 3EEDA 3J81b 3EERA 1RLYA 1YJN1 1VQ51 1VQL1 3CCR1 2OOXB 3HOZI 2IZ3A 3NFZA 1WCMI 4MD9A 3CPWY 1YJ91 2DE7A 4A3BI 5C4XI 2M6NA 2NVYI 2ZAEB 3KIFA 2DE6A 1TWFI 3CC2Z 3CCVZ 1TWHI 3GTJI 3ESWA 4E2YA 2VPZA 1KC82 2RBLA 1VQO1 3D9XA 5C44I 5FLXf 1Q811 4QTTA 3VMIA 4NH1C 3CCJZ 1P9NA 1YITZ 1YIT1 2QREB 3F3FC 4A93I 5IT9f 4S1TA 1I50I 3J80b 3CC7Z 1YIJZ 1YI21 3VTNA 2OTJZ 3BG0B 4XX2A 3NH4A 2HF1A 4HH4A 3JAMf 2EGTA 2M48A 3NDIA 4NBBA 4A3LI 3LUSA 1K8A2
chains in the Genus database with same CATH topology
5C4JI 3PO3S 3OW2Z 1YUKA 2RHBA 3KIHA 4DQYB 1KD11 3HOYI 4NFRA 1YJWZ 1ZB8A 4RVHA 4A3KI 1VQK1 1X3WA 3CCRZ 3S2HI 3S16I 2JA6I 3P5JB 3GTMS 1NJI1 1Q7Y2 3S14I 2GTIA 2O4HA 3J80f 4DK1A 3VMHA 1YHQZ 2NVXI 3I551 1RO4A 3CXCZ 4BXXI 2H85A 5LL6f 1RO0A 3HOXI 4A3EI 3GTPI 1Q812 2E2HI 1L1OC 1YJW1 1Z03A 3RZDI 5C3EI 5T6BA 4NOZA 2GTHA 1RNIA 3I561 4NBAA 1TWGI 3FQMA 1Z01A 1TWAI 1VQM1 3BG1B 3I55Z 2YADA 3G4S1 4A3FI 4BY1I 2QRCB 3H3VJ 2QA41 2OZKA 2R7ZI 1YI2Z 5IT9b 1M1K1 4A3CI 4TNUA 4HGZA 3S1QI 5AN9F 3CCS1 3G6EZ 2IZ4A 4E2XA 2K5RA 2HU9A 4E31A 3GTQI 4NB8A 1ML8A 3MZKB 3GTOI 3GTLI 2PK7A 2QR1B 3IFUA 1I6HI 2J6AA 2JR6A 4DGLA 3CXCY 4E2ZA 5FLMI 1VQ81 3G6E1 2OTJ1 3CC71 1YIJ1 3CCE1 4RV9A 1QVFZ 3QWUA 2P3YA 1VQLZ 1VQ5Z 5T67A 3MZLB 3I4MI 3TDHB 2AKLA 2QEXZ 1S72Z 1VQOZ 3HOWI 5CM2M 1I3QI 3G4SZ 4BY7I 3CCL1 1VQMZ 1Q821 4RVGA 3RZOI 1JJ2Y 4E30A 2E9HA 3G711 1VQNZ 1K83I 2O53A 3U50C 1K732 4E32A 2VUGA 2E2II 2KPIA 3Q87A 4NBHA 4MD8A 3CD61 4X6AI 3NH8A 3CCQZ 1YJNZ 3HKZA 4CL1A 1PFTA 5D1OB 1ZB9A 2DE5A 1YHQ1 1KC81 4A3JI 1QF8A 1VQ71 3TE5B 3S1MI 2QLVB 3CCM1 1KRLA 1LQLA 1S7MA 2R92I 1VQKZ 3M4OI 4NBCA 1TWCI 1N2FA 1Y1VS 4A3MI 1KQSZ 3I07A 3IF8A 2YU9I 4RS4A 4RVDA 1SFOI 4QTUA 2OOYB 2I3CA 4Y7NI 4AYBA 4MD7A 1JJ2Z 2OTL1 1Y1VI 2F4OA 2R93I 1N8R1 2JA8I 1QVFY 3S1NI 2JA7I 1K9M2 2W03A 3PO2I 1NJI2 3CCJ1 2BJOA 3CQZI 2VUMI 3OW2Y 3GCFA 4MRIA 4Y52I 1WIIA 2GU2A 2QKDA 1X0TA 3CC21 3CCV1 3CMEZ 1NP6A 2Y0SA 4NBFA 3PO3I 3CCU1 1YJ9Z 1K8A1 2E2JI 2W04A 1WW9A 1X3ZA 2WB1A 3CPWZ 3S1RI 4RVFA 3CCQ1 1N8R2 2QRDB 1VQP1 5A2Qb 3VMGA 3K7AI 1VQ6Z 1DL6A 4E33A 1M902 1YUAA 1USPB 2P28A 2R6MA 1VLAA 1W2BZ 1VQN1 4EWCA 2LFUA 3G71Z 3CCUZ 3F3PC 3CC41 3CC4Z 2PM9A 2JNYA 3S15I 2Q51A 1S721 2QEX1 5T64A 1QVGY 1QYPA 3GKQA 1M1K2 5D1OA 3HOUI 2V8IA 1VQ61 3D6WA 2Q4ZA 3J7A4 1VQPZ 3NDJA 3CCEZ 1VQ8Z 1USPA 3NH5A 1QVGZ 4NBDA 1VQ9Z 3CMAZ 3CME1 4E2WA 2F4MA 1R9TI 2VF1A 3S2DI 3JAMb 4BBRI 4A3GI 2PMZA 3T4NB 1K731 4MH4A 3CCSZ 5FLXb 3GTKI 1VQ41 1VQ4Z 1Y1WI 4A3II 2RT9A 3HOVI 2V8KA 3FQQA 2JUBA 5D1PA 2NVQI 1NUIA 1TFIA 2V8JA 2WAQA 1M901 1Q861 1RO2A 1Q822 2JMOA 2RPRA 3MONA 3H0GI 2QA4Z 2OTLZ 3GTGI 3CMA1 1ZH1A 1VQ91 5IP7I 4NBGA 3GTMI 2JA5I 2B63I 2KI7B 1Q7Y1 2NVTI 1W2BY 3I56Z 1KQSY 2G2KA 1RQFA 4NB9A 4HGYA 3CD6Z 3M3YI 1Z02A 3I4NI 3VB9A 2K3RA 1KD12 5IP9I 1Q862 2LIYA 4MONA 3CCMZ 1K9M1 2JS4A 3J81f 1VQ7Z 1JWHC 4NBEA 4BBSI 3FKII 4MXUA 3CCLZ 3IX0A 3S17I 2RIQA 5A2Qf 4A3DI 3EEDA 3J81b 3EERA 1RLYA 1YJN1 1VQ51 1VQL1 3CCR1 2OOXB 3HOZI 2IZ3A 3NFZA 1WCMI 4MD9A 3CPWY 1YJ91 2DE7A 4A3BI 5C4XI 2M6NA 2NVYI 2ZAEB 3KIFA 2DE6A 1TWFI 3CC2Z 3CCVZ 1TWHI 3GTJI 3ESWA 4E2YA 1KC82 2RBLA 1VQO1 3D9XA 5C44I 5FLXf 1Q811 4QTTA 3VMIA 4NH1C 3CCJZ 1P9NA 1YITZ 1YIT1 2QREB 3F3FC 4A93I 5IT9f 4S1TA 1I50I 3J80b 3CC7Z 1YIJZ 1YI21 3VTNA 2OTJZ 3BG0B 4XX2A 3NH4A 2HF1A 4HH4A 3JAMf 2EGTA 2M48A 3NDIA 4NBBA 4A3LI 3LUSA 1K8A2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4J I;  2VUM I;  3PO3 S;  2P3Y A;  3GCF A;  5IP7 I;  4NBG A;  3GTM I;  2JA5 I;  3HOY I;  4Y52 I;  2B63 I;  2NVT I;  3I4M I;  1ZB8 A;  4A3K I;  1X3W A;  4NB9 A;  2AKL A;  3S2H I;  3S16 I;  2JA6 I;  4NBF A;  3M3Y I;  3PO3 I;  3HOW I;  5CM2 M;  1I3Q I;  3VB9 A;  3I4N I;  3GTM S;  4BY7 I;  2E2J I;  3S14 I;  1WW9 A;  5IP9 I;  3RZO I;  1X3Z A;  3S1R I;  3VMH A;  3VMG A;  2NVX I;  3K7A I;  1DL6 A;  1K83 I;  1RO4 A;  1YUA A;  2JS4 A;  4BXX I;  1USP B;  3U50 C;  1VLA A;  4NBE A;  4BBS I;  3FKI I;  2E2I I;  3S17 I;  2KPI A;  3Q87 A;  4NBH A;  3HOX I;  4A3E I;  3GTP I;  4A3D I;  4X6A I;  2E2H I;  3EER A;  1RLY A;  1L1O C;  3RZD I;  2JNY A;  5C3E I;  3S15 I;  4NOZ A;  1PFT A;  1QYP A;  1ZB9 A;  3HOZ I;  2DE5 A;  4NBA A;  1TWG I;  3GKQ A;  4A3J I;  1WCM I;  3S1M I;  1TWA I;  3HOU I;  3D6W A;  4A3F I;  2DE7 A;  4A3B I;  5C4X I;  1LQL A;  2NVY I;  2R92 I;  2DE6 A;  1TWF I;  4BY1 I;  3H3V J;  3M4O I;  2R7Z I;  1USP A;  1TWH I;  4NBC A;  3GTJ I;  1TWC I;  3ESW A;  4NBD A;  1N2F A;  4A3C I;  1Y1V S;  4A3M I;  2RBL A;  5C44 I;  2F4M A;  3S1Q I;  1R9T I;  4QTT A;  3S2D I;  3I07 A;  3VMI A;  2YU9 I;  2K5R A;  4BBR I;  1SFO I;  4NB8 A;  4QTU A;  4Y7N I;  3GTQ I;  1ML8 A;  3GTO I;  4A93 I;  4A3G I;  3GTL I;  1I50 I;  2PK7 A;  4MH4 A;  3GTK I;  1Y1V I;  2F4O A;  4XX2 A;  2J6A A;  1Y1W I;  1I6H I;  4A3I I;  2JR6 A;  3HOV I;  2HF1 A;  2R93 I;  5FLM I;  2NVQ I;  1NUI A;  1TFI A;  4NBB A;  2JA8 I;  3S1N I;  2JA7 I;  4A3L I;  3LUS A;  3H0G I;  3PO2 I;  2BJO A;  3CQZ I;  3GTG I; 
#chains in the Genus database with same CATH topology
 5C4J I;  3PO3 S;  3OW2 Z;  1YUK A;  2RHB A;  3KIH A;  4DQY B;  1KD1 1;  3HOY I;  4NFR A;  1YJW Z;  1ZB8 A;  4RVH A;  4A3K I;  1VQK 1;  1X3W A;  3CCR Z;  3S2H I;  3S16 I;  2JA6 I;  3P5J B;  3GTM S;  1NJI 1;  1Q7Y 2;  3S14 I;  2GTI A;  2O4H A;  3J80 f;  4DK1 A;  3VMH A;  1YHQ Z;  2NVX I;  1FDI A;  3I55 1;  2JIR A;  1RO4 A;  3CXC Z;  4BXX I;  2H85 A;  5LL6 f;  1RO0 A;  3HOX I;  4A3E I;  3GTP I;  1Q81 2;  2E2H I;  1L1O C;  1YJW 1;  2JIP A;  1Z03 A;  3RZD I;  5C3E I;  5T6B A;  4NOZ A;  2GTH A;  1RNI A;  2JIO A;  3I56 1;  4NBA A;  1TWG I;  3FQM A;  1Z01 A;  2JIM A;  1TWA I;  1VQM 1;  3BG1 B;  3I55 Z;  2YAD A;  3G4S 1;  4A3F I;  4BY1 I;  2QRC B;  3H3V J;  2QA4 1;  2OZK A;  2R7Z I;  1YI2 Z;  5IT9 b;  1M1K 1;  4A3C I;  4TNU A;  4HGZ A;  3S1Q I;  5AN9 F;  3CCS 1;  3G6E Z;  2IZ4 A;  3IR7 A;  4E2X A;  2K5R A;  2HU9 A;  4E31 A;  2E7Z A;  3GTQ I;  4NB8 A;  1ML8 A;  3MZK B;  3GTO I;  3GTL I;  2PK7 A;  2QR1 B;  3IFU A;  1I6H I;  2J6A A;  2JR6 A;  4DGL A;  3CXC Y;  4E2Z A;  5FLM I;  1VQ8 1;  3G6E 1;  2OTJ 1;  3CC7 1;  1YIJ 1;  3CCE 1;  4RV9 A;  1QVF Z;  3QWU A;  2P3Y A;  1VQL Z;  1VQ5 Z;  1QXF A;  5T67 A;  3MZL B;  3I4M I;  3TDH B;  2AKL A;  2QEX Z;  1S72 Z;  1VQO Z;  3HOW I;  5CM2 M;  1I3Q I;  3G4S Z;  4BY7 I;  1Y8C A;  3D2L A;  3CCL 1;  1VQM Z;  1Q82 1;  4RVG A;  3RZO I;  2V3V A;  1JJ2 Y;  4E30 A;  2E9H A;  2NAP A;  3G71 1;  1VQN Z;  1Q16 A;  1K83 I;  2O53 A;  3U50 C;  1K73 2;  4E32 A;  2VUG A;  2E2I I;  2KPI A;  3Q87 A;  4NBH A;  4MD8 A;  3CD6 1;  4X6A I;  3NH8 A;  3CCQ Z;  1YJN Z;  3HKZ A;  4CL1 A;  1PFT A;  5D1O B;  1ZB9 A;  2DE5 A;  1YHQ 1;  1KC8 1;  4A3J I;  1QF8 A;  1VQ7 1;  3TE5 B;  3S1M I;  2QLV B;  3CCM 1;  1KRL A;  1LQL A;  1S7M A;  2R92 I;  1VQK Z;  3M4O I;  2AYD A;  4NBC A;  1TWC I;  1N2F A;  1Y1V S;  4A3M I;  1KQS Z;  3I07 A;  3IF8 A;  2YU9 I;  4RS4 A;  4RVD A;  1SFO I;  4QTU A;  2OOY B;  2I3C A;  4Y7N I;  4AYB A;  4MD7 A;  2VPX A;  1JJ2 Z;  2OTL 1;  1Y1V I;  2F4O A;  2R93 I;  1N8R 1;  2JA8 I;  2V45 A;  1QVF Y;  3S1N I;  2JA7 I;  1K9M 2;  2LEX A;  2W03 A;  3PO2 I;  1NJI 2;  3CCJ 1;  2BJO A;  3CQZ I;  2VUM I;  3OW2 Y;  3GCF A;  4MRI A;  2VPY A;  4Y52 I;  1FDO A;  1WII A;  2GU2 A;  2QKD A;  1X0T A;  3CC2 1;  3CCV 1;  3CME Z;  1NP6 A;  2Y0S A;  4NBF A;  3PO3 I;  3CCU 1;  1YJ9 Z;  1K8A 1;  2E2J I;  2W04 A;  1WW9 A;  1X3Z A;  2WB1 A;  3CPW Z;  3S1R I;  4RVF A;  3CCQ 1;  1N8R 2;  2QRD B;  1VQP 1;  5A2Q b;  3VMG A;  3K7A I;  1VQ6 Z;  1DL6 A;  4E33 A;  1WJ2 A;  1M90 2;  1YUA A;  1USP B;  2P28 A;  2R6M A;  1VLA A;  1W2B Z;  1VQN 1;  4EWC A;  2LFU A;  3G71 Z;  3CCU Z;  3F3P C;  3CC4 1;  1SIW A;  3CC4 Z;  2PM9 A;  2JNY A;  3S15 I;  2Q51 A;  1S72 1;  2QEX 1;  5T64 A;  1QVG Y;  1QYP A;  3GKQ A;  1M1K 2;  5D1O A;  3HOU I;  2V8I A;  1VQ6 1;  3D6W A;  2Q4Z A;  3J7A 4;  1VQP Z;  3NDJ A;  3CCE Z;  1VQ8 Z;  1USP A;  3NH5 A;  1QVG Z;  4NBD A;  1VQ9 Z;  2JIQ A;  3CMA Z;  3CME 1;  4E2W A;  2F4M A;  1WZN A;  1R9T I;  2VF1 A;  3S2D I;  3JAM b;  4BBR I;  4A3G I;  2PMZ A;  3T4N B;  1K73 1;  4MH4 A;  3CCS Z;  5FLX b;  3GTK I;  1VQ4 1;  1VQ4 Z;  1Y1W I;  4A3I I;  2RT9 A;  3HOV I;  2V8K A;  3FQQ A;  2JUB A;  5D1P A;  2NVQ I;  1NUI A;  1TFI A;  2V8J A;  2WAQ A;  1M90 1;  1Q86 1;  1RO2 A;  1Q82 2;  2JMO A;  2RPR A;  3MON A;  3H0G I;  2IV2 X;  2QA4 Z;  2OTL Z;  3GTG I;  3CMA 1;  1ZH1 A;  1VQ9 1;  5IP7 I;  4NBG A;  3GTM I;  2JA5 I;  2B63 I;  2KI7 B;  1Q7Y 1;  2NVT I;  1W2B Y;  3I56 Z;  1KQS Y;  2G2K A;  1RQF A;  4NB9 A;  1AA6 A;  4HGY A;  3CD6 Z;  2VPW A;  3M3Y I;  1Z02 A;  3I4N I;  3VB9 A;  2K3R A;  1KD1 2;  5IP9 I;  1Q86 2;  2LIY A;  4MON A;  3CCM Z;  1K9M 1;  2JS4 A;  3J81 f;  1VQ7 Z;  1JWH C;  4NBE A;  4BBS I;  3FKI I;  4MXU A;  3CCL Z;  3IX0 A;  3S17 I;  2RIQ A;  5A2Q f;  4A3D I;  3EED A;  3J81 b;  3EER A;  1RLY A;  1YJN 1;  1VQ5 1;  1VQL 1;  3CCR 1;  2OOX B;  3HOZ I;  2IZ3 A;  3NFZ A;  1WCM I;  4MD9 A;  3CPW Y;  1YJ9 1;  2DE7 A;  4A3B I;  5C4X I;  2M6N A;  2NVY I;  2ZAE B;  3KIF A;  2DE6 A;  1TWF I;  3CC2 Z;  3CCV Z;  1TWH I;  3GTJ I;  3ESW A;  4E2Y A;  2VPZ A;  1KC8 2;  2RBL A;  1VQO 1;  3D9X A;  5C44 I;  5FLX f;  1Q81 1;  4QTT A;  3VMI A;  4NH1 C;  3CCJ Z;  1P9N A;  1YIT Z;  1YIT 1;  2QRE B;  3F3F C;  4A93 I;  5IT9 f;  4S1T A;  1I50 I;  3J80 b;  3CC7 Z;  1YIJ Z;  1YI2 1;  3VTN A;  2OTJ Z;  3BG0 B;  4XX2 A;  3NH4 A;  2HF1 A;  4HH4 A;  3JAM f;  2EGT A;  2M48 A;  3NDI A;  4NBB A;  4A3L I;  3LUS A;  1K8A 2; 
#chains in the Genus database with same CATH homology
 5C4J I;  3PO3 S;  3OW2 Z;  1YUK A;  2RHB A;  3KIH A;  4DQY B;  1KD1 1;  3HOY I;  4NFR A;  1YJW Z;  1ZB8 A;  4RVH A;  4A3K I;  1VQK 1;  1X3W A;  3CCR Z;  3S2H I;  3S16 I;  2JA6 I;  3P5J B;  3GTM S;  1NJI 1;  1Q7Y 2;  3S14 I;  2GTI A;  2O4H A;  3J80 f;  4DK1 A;  3VMH A;  1YHQ Z;  2NVX I;  3I55 1;  1RO4 A;  3CXC Z;  4BXX I;  2H85 A;  5LL6 f;  1RO0 A;  3HOX I;  4A3E I;  3GTP I;  1Q81 2;  2E2H I;  1L1O C;  1YJW 1;  1Z03 A;  3RZD I;  5C3E I;  5T6B A;  4NOZ A;  2GTH A;  1RNI A;  3I56 1;  4NBA A;  1TWG I;  3FQM A;  1Z01 A;  1TWA I;  1VQM 1;  3BG1 B;  3I55 Z;  2YAD A;  3G4S 1;  4A3F I;  4BY1 I;  2QRC B;  3H3V J;  2QA4 1;  2OZK A;  2R7Z I;  1YI2 Z;  5IT9 b;  1M1K 1;  4A3C I;  4TNU A;  4HGZ A;  3S1Q I;  5AN9 F;  3CCS 1;  3G6E Z;  2IZ4 A;  4E2X A;  2K5R A;  2HU9 A;  4E31 A;  3GTQ I;  4NB8 A;  1ML8 A;  3MZK B;  3GTO I;  3GTL I;  2PK7 A;  2QR1 B;  3IFU A;  1I6H I;  2J6A A;  2JR6 A;  4DGL A;  3CXC Y;  4E2Z A;  5FLM I;  1VQ8 1;  3G6E 1;  2OTJ 1;  3CC7 1;  1YIJ 1;  3CCE 1;  4RV9 A;  1QVF Z;  3QWU A;  2P3Y A;  1VQL Z;  1VQ5 Z;  5T67 A;  3MZL B;  3I4M I;  3TDH B;  2AKL A;  2QEX Z;  1S72 Z;  1VQO Z;  3HOW I;  5CM2 M;  1I3Q I;  3G4S Z;  4BY7 I;  3CCL 1;  1VQM Z;  1Q82 1;  4RVG A;  3RZO I;  1JJ2 Y;  4E30 A;  2E9H A;  3G71 1;  1VQN Z;  1K83 I;  2O53 A;  3U50 C;  1K73 2;  4E32 A;  2VUG A;  2E2I I;  2KPI A;  3Q87 A;  4NBH A;  4MD8 A;  3CD6 1;  4X6A I;  3NH8 A;  3CCQ Z;  1YJN Z;  3HKZ A;  4CL1 A;  1PFT A;  5D1O B;  1ZB9 A;  2DE5 A;  1YHQ 1;  1KC8 1;  4A3J I;  1QF8 A;  1VQ7 1;  3TE5 B;  3S1M I;  2QLV B;  3CCM 1;  1KRL A;  1LQL A;  1S7M A;  2R92 I;  1VQK Z;  3M4O I;  4NBC A;  1TWC I;  1N2F A;  1Y1V S;  4A3M I;  1KQS Z;  3I07 A;  3IF8 A;  2YU9 I;  4RS4 A;  4RVD A;  1SFO I;  4QTU A;  2OOY B;  2I3C A;  4Y7N I;  4AYB A;  4MD7 A;  1JJ2 Z;  2OTL 1;  1Y1V I;  2F4O A;  2R93 I;  1N8R 1;  2JA8 I;  1QVF Y;  3S1N I;  2JA7 I;  1K9M 2;  2W03 A;  3PO2 I;  1NJI 2;  3CCJ 1;  2BJO A;  3CQZ I;  2VUM I;  3OW2 Y;  3GCF A;  4MRI A;  4Y52 I;  1WII A;  2GU2 A;  2QKD A;  1X0T A;  3CC2 1;  3CCV 1;  3CME Z;  1NP6 A;  2Y0S A;  4NBF A;  3PO3 I;  3CCU 1;  1YJ9 Z;  1K8A 1;  2E2J I;  2W04 A;  1WW9 A;  1X3Z A;  2WB1 A;  3CPW Z;  3S1R I;  4RVF A;  3CCQ 1;  1N8R 2;  2QRD B;  1VQP 1;  5A2Q b;  3VMG A;  3K7A I;  1VQ6 Z;  1DL6 A;  4E33 A;  1M90 2;  1YUA A;  1USP B;  2P28 A;  2R6M A;  1VLA A;  1W2B Z;  1VQN 1;  4EWC A;  2LFU A;  3G71 Z;  3CCU Z;  3F3P C;  3CC4 1;  3CC4 Z;  2PM9 A;  2JNY A;  3S15 I;  2Q51 A;  1S72 1;  2QEX 1;  5T64 A;  1QVG Y;  1QYP A;  3GKQ A;  1M1K 2;  5D1O A;  3HOU I;  2V8I A;  1VQ6 1;  3D6W A;  2Q4Z A;  3J7A 4;  1VQP Z;  3NDJ A;  3CCE Z;  1VQ8 Z;  1USP A;  3NH5 A;  1QVG Z;  4NBD A;  1VQ9 Z;  3CMA Z;  3CME 1;  4E2W A;  2F4M A;  1R9T I;  2VF1 A;  3S2D I;  3JAM b;  4BBR I;  4A3G I;  2PMZ A;  3T4N B;  1K73 1;  4MH4 A;  3CCS Z;  5FLX b;  3GTK I;  1VQ4 1;  1VQ4 Z;  1Y1W I;  4A3I I;  2RT9 A;  3HOV I;  2V8K A;  3FQQ A;  2JUB A;  5D1P A;  2NVQ I;  1NUI A;  1TFI A;  2V8J A;  2WAQ A;  1M90 1;  1Q86 1;  1RO2 A;  1Q82 2;  2JMO A;  2RPR A;  3MON A;  3H0G I;  2QA4 Z;  2OTL Z;  3GTG I;  3CMA 1;  1ZH1 A;  1VQ9 1;  5IP7 I;  4NBG A;  3GTM I;  2JA5 I;  2B63 I;  2KI7 B;  1Q7Y 1;  2NVT I;  1W2B Y;  3I56 Z;  1KQS Y;  2G2K A;  1RQF A;  4NB9 A;  4HGY A;  3CD6 Z;  3M3Y I;  1Z02 A;  3I4N I;  3VB9 A;  2K3R A;  1KD1 2;  5IP9 I;  1Q86 2;  2LIY A;  4MON A;  3CCM Z;  1K9M 1;  2JS4 A;  3J81 f;  1VQ7 Z;  1JWH C;  4NBE A;  4BBS I;  3FKI I;  4MXU A;  3CCL Z;  3IX0 A;  3S17 I;  2RIQ A;  5A2Q f;  4A3D I;  3EED A;  3J81 b;  3EER A;  1RLY A;  1YJN 1;  1VQ5 1;  1VQL 1;  3CCR 1;  2OOX B;  3HOZ I;  2IZ3 A;  3NFZ A;  1WCM I;  4MD9 A;  3CPW Y;  1YJ9 1;  2DE7 A;  4A3B I;  5C4X I;  2M6N A;  2NVY I;  2ZAE B;  3KIF A;  2DE6 A;  1TWF I;  3CC2 Z;  3CCV Z;  1TWH I;  3GTJ I;  3ESW A;  4E2Y A;  1KC8 2;  2RBL A;  1VQO 1;  3D9X A;  5C44 I;  5FLX f;  1Q81 1;  4QTT A;  3VMI A;  4NH1 C;  3CCJ Z;  1P9N A;  1YIT Z;  1YIT 1;  2QRE B;  3F3F C;  4A93 I;  5IT9 f;  4S1T A;  1I50 I;  3J80 b;  3CC7 Z;  1YIJ Z;  1YI2 1;  3VTN A;  2OTJ Z;  3BG0 B;  4XX2 A;  3NH4 A;  2HF1 A;  4HH4 A;  3JAM f;  2EGT A;  2M48 A;  3NDI A;  4NBB A;  4A3L I;  3LUS A;  1K8A 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...