1I3QI

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI01
2JNYA 1USPB 3GCFA 2NVTI 2NVYI 4NBHA 4BY7I 4Y52I 5C4XI 4NBBA 2JS4A 5C3EI 3PO3S 1RLYA 3HOVI 3S2HI 2R7ZI 4A93I 3HOYI 2AKLA 3GKQA 3D6WA 1X3ZA 2B63I 1X3WA 1TWFI 2P3YA 3HOWI 3S14I 3I4NI 4NBAA 3GTMS 4NOZA 3HOXI 1Y1VI 3HOZI 3RZOI 1PFTA 4MH4A 3S2DI 3GTGI 4A3JI 3GTPI 3Q87A 3PO2I 1USPA 4NBDA 5CM2M 3S16I 3VB9A 1SFOI 5FLMI 2PK7A 2NVXI 1VLAA 1N2FA 1K83I 2YU9I 3CQZI 4A3BI 4A3EI 2J6AA 3S1NI 3GTJI 2DE5A 3PO3I 2JR6A 1WCMI 2E2II 2JA8I 2R92I 1TWHI 4A3DI 1QYPA 2VUMI 1RO4A 5IP9I 2JA7I 2E2JI 1I3QI 3VMGA 3ESWA 2BJOA 1NUIA 1WW9A 1YUAA 1ZB9A 3S17I 1ML8A 3GTMI 3S1MI 3VMIA 1TWAI 1TFIA 1I50I 4NBCA 3GTOI 1LQLA 4A3LI 4NBFA 2DE6A 1Y1VS 4A3II 3I07A 4QTTA 1TWGI 2HF1A 3LUSA 3GTKI 3FKII 4NBGA 2DE7A 3S15I 1TWCI 2KPIA 4A3KI 3VMHA 2JA5I 2E2HI 3GTQI 4A3GI 4BXXI 1Y1WI 5C4JI 4BBRI 3S1QI 4A3FI 3I4MI 4NB9A 3GTLI 3H0GI 4A3MI 4BY1I 2NVQI 2F4MA 5C44I 4X6AI 3H3VJ 2F4OA 4NBEA 3RZDI 1R9TI 1DL6A 4QTUA 3EERA 4A3CI 5IP7I 1L1OC 4BBSI 2JA6I 3K7AI 3M3YI 1I6HI 1ZB8A 2R93I 4Y7NI 3HOUI 3S1RI 4NB8A 2K5RA 2RBLA 3M4OI 3U50C 4XX2A
chains in the Genus database with same CATH superfamily
2QRCB 3GCFA 1Q861 4NBHA 4BY7I 2JS4A 3HOVI 2QA41 3NDJA 1P9NA 3HOYI 1VQK1 3F3PC 1X3ZA 1X3WA 3CMA1 3S2DI 3GTPI 3PO2I 1USPA 2OTJ1 4NBDA 3VB9A 2GTHA 4MRIA 3CCR1 4A3EI 3CCE1 1N8R1 3J81f 1YJ9Z 1YI2Z 3PO3I 2JR6A 1YIJ1 2VUMI 1RO4A 5IP9I 2JA7I 4RVHA 2V8KA 4RVDA 1I3QI 4MONA 2LFUA 2IV2X 1VQ4Z 2V8IA 3GTMI 2M6NA 3VMIA 2LEXA 3CXCY 1WJ2A 4A3LI 1S72Z 4NBFA 2LIYA 1Y1VS 1K8A2 2IZ3A 5IT9f 2YADA 1YUKA 5T6BA 1KD11 2OZKA 5D1OB 1K9M1 3CC2Z 3KIFA 3CD6Z 3S1QI 3KIHA 1VQOZ 5FLXb 2NVQI 2F4MA 4E31A 1Q7Y2 3HKZA 3NH8A 3VTNA 5A2Qf 1VQMZ 1YIT1 4DGLA 1R9TI 1Q822 1QVGZ 4DK1A 5T67A 1QVGY 4NFRA 3CCSZ 2JA6I 2R93I 3IFUA 3I55Z 3HOUI 3FQQA 2K5RA 1Q811 4S1TA 2E9HA 2JNYA 1ZH1A 3CCMZ 2NVYI 4Y52I 5C3EI 1KC82 3PO3S 1RLYA 3S2HI 1RO0A 2RIQA 1VQ41 4A93I 3F3FC 2K3RA 2Q51A 3GKQA 3CC4Z 2JIRA 2B63I 4RVGA 1X0TA 1S721 2ZAEB 2Y0SA 3GTMS 4NOZA 4E2ZA 1Y1VI 1YHQZ 4TNUA 1M902 1JWHC 3CCVZ 1VQ8Z 3MZLB 3BG1B 1SFOI 2PK7A 2AYDA 1JJ2Z 1FDOA 2RHBA 3CC21 1JJ2Y 1VQ6Z 3CD61 4A3BI 1Y8CA 1N8R2 1VQO1 2R92I 1WIIA 2WB1A 1VQM1 2RT9A 3ESWA 1S7MA 3S1MI 3CCS1 2VUGA 1QF8A 4HGZA 4NH1C 4NBCA 3GTOI 3I551 1YITZ 2O4HA 3NH4A 3CMEZ 1M1K2 1VQLZ 2W03A 4E33A 3CCM1 1AA6A 5IT9b 3P5JB 4HH4A 1KD12 1FDIA 1TWCI 3VMHA 2E2HI 3CC41 1K9M2 1Y1WI 4BBRI 1YHQ1 3OW2Y 3CXCZ 3CCV1 3I561 1VQ81 2HU9A 2OOYB 2O53A 3G4S1 3CC7Z 4NBEA 2V45A 3JAMf 3EERA 4A3CI 1Z01A 2WAQA 1VQ61 5D1OA 3IF8A 4HGYA 1ZB8A 2NAPA 4Y7NI 2QKDA 4E2YA 4XX2A 3CCJ1 5C4XI 4NBBA 2V3VA 2OTLZ 1RNIA 3D6WA 3FQMA 3J7A4 1TWFI 3HOWI 3CME1 3S14I 3I4NI 1VQL1 4NBAA 4E32A 3HOXI 3TE5B 3HOZI 3RZOI 1PFTA 4MH4A 3GTGI 4A3JI 1NJI1 1YJN1 5CM2M 1WZNA 1Q862 2JIMA 2V8JA 1N2FA 1K83I 4RVFA 1K8A1 2M48A 2YU9I 3MZKB 3CQZI 4CL1A 1VQ7Z 2J6AA 3GTJI 2G2KA 1WCMI 2E2II 2JA8I 1TWHI 4A3DI 1QYPA 1Z02A 2E2JI 3CC71 2JMOA 2BJOA 3NFZA 1WW9A 1YUAA 3I56Z 3G71Z 3S17I 4E30A 1TFIA 3G4SZ 5FLXf 1LQLA 2OOXB 1Q7Y1 2Q4ZA 3J80f 2KI7B 2VPZA 4QTTA 1SIWA 1K731 3CPWZ 3CPWY 3J81b 3LUSA 4NBGA 3S15I 2KPIA 3CCJZ 2OTL1 2JA5I 4A3GI 1KQSZ 4BXXI 1VQNZ 1KQSY 3QWUA 5C4JI 1RQFA 4A3FI 1KC81 3EEDA 4E2WA 3H0GI 3GTLI 2QREB 4BY1I 4MD7A 3TDHB 2VF1A 2JIQA 4AYBA 3RZDI 1VQ9Z 2E7ZA 3JAMb 4DQYB 4QTUA 5IP7I 1YJNZ 4BBSI 1M901 3M3YI 1VQ71 1I6HI 3S1RI 2VPWA 4NB8A 4MD9A 1YJW1 3G6EZ 3M4OI 2NVTI 1USPB 3OW2Z 2JUBA 1RO2A 2R7ZI 1VQPZ 1QXFA 3G711 4MXUA 4RV9A 2AKLA 1VQ5Z 2GTIA 2W04A 5A2Qb 1Q16A 2P3YA 4E2XA 3CCQ1 1NP6A 5D1PA 2H85A 3Q87A 1NJI2 2VPXA 1Q812 3S16I 2QEXZ 4EWCA 5FLMI 3NDIA 2NVXI 1VLAA 1M1K1 3CCLZ 2IZ4A 1VQN1 3S1NI 2DE5A 4RS4A 3CCUZ 3IR7A 3D9XA 3IX0A 2EGTA 2VPYA 1W2BZ 1VQ91 1W2BY 3VMGA 1NUIA 2QA4Z 2RPRA 1ZB9A 1ML8A 5T64A 1TWAI 3T4NB 1VQKZ 1I50I 1QVFZ 2I3CA 3G6E1 5AN9F 1QVFY 2DE6A 2R6MA 3J80b 4A3II 3I07A 2P28A 1K732 1TWGI 3CMAZ 2HF1A 1KRLA 3GTKI 3FKII 2PM9A 2DE7A 1VQP1 1YJWZ 2OTJZ 1Z03A 4A3KI 2JIPA 1YJ91 2QRDB 1VQ51 1YI21 3GTQI 2QLVB 2QR1B 3NH5A 3CCRZ 3BG0B 2PMZA 5LL6f 3CCEZ 2GU2A 3I4MI 4NB9A 3MONA 1YIJZ 4A3MI 5C44I 4X6AI 3H3VJ 3CCQZ 2F4OA 2QEX1 1Q821 3CCL1 1DL6A 4MD8A 1L1OC 3K7AI 2JIOA 3D2LA 2RBLA 3CCU1 3U50C
chains in the Genus database with same CATH topology
2QRCB 3GCFA 1Q861 4NBHA 4BY7I 2JS4A 3HOVI 2QA41 3NDJA 1P9NA 3HOYI 1VQK1 3F3PC 1X3ZA 1X3WA 3CMA1 3S2DI 3GTPI 3PO2I 1USPA 2OTJ1 4NBDA 3VB9A 2GTHA 4MRIA 3CCR1 4A3EI 3CCE1 1N8R1 3J81f 1YJ9Z 1YI2Z 3PO3I 2JR6A 1YIJ1 2VUMI 1RO4A 5IP9I 2JA7I 4RVHA 2V8KA 4RVDA 1I3QI 4MONA 2LFUA 1VQ4Z 2V8IA 3GTMI 2M6NA 3VMIA 3CXCY 4A3LI 1S72Z 4NBFA 2LIYA 1Y1VS 1K8A2 2IZ3A 5IT9f 2YADA 1YUKA 5T6BA 1KD11 2OZKA 5D1OB 1K9M1 3CC2Z 3KIFA 3CD6Z 3S1QI 3KIHA 1VQOZ 5FLXb 2NVQI 2F4MA 4E31A 1Q7Y2 3HKZA 3NH8A 3VTNA 5A2Qf 1VQMZ 1YIT1 4DGLA 1R9TI 1Q822 1QVGZ 4DK1A 5T67A 1QVGY 4NFRA 3CCSZ 2JA6I 2R93I 3IFUA 3I55Z 3HOUI 3FQQA 2K5RA 1Q811 4S1TA 2E9HA 2JNYA 1ZH1A 3CCMZ 2NVYI 4Y52I 5C3EI 1KC82 3PO3S 1RLYA 3S2HI 1RO0A 2RIQA 1VQ41 4A93I 3F3FC 2K3RA 2Q51A 3GKQA 3CC4Z 2B63I 4RVGA 1X0TA 1S721 2ZAEB 2Y0SA 3GTMS 4NOZA 4E2ZA 1Y1VI 1YHQZ 4TNUA 1M902 1JWHC 3CCVZ 1VQ8Z 3MZLB 3BG1B 1SFOI 2PK7A 1JJ2Z 2RHBA 3CC21 1JJ2Y 1VQ6Z 3CD61 4A3BI 1N8R2 1VQO1 2R92I 1WIIA 2WB1A 1VQM1 2RT9A 3ESWA 1S7MA 3S1MI 3CCS1 2VUGA 1QF8A 4HGZA 4NH1C 4NBCA 3GTOI 3I551 1YITZ 2O4HA 3NH4A 3CMEZ 1M1K2 1VQLZ 2W03A 4E33A 3CCM1 5IT9b 3P5JB 4HH4A 1KD12 1TWCI 3VMHA 2E2HI 3CC41 1K9M2 1Y1WI 4BBRI 1YHQ1 3OW2Y 3CXCZ 3CCV1 3I561 1VQ81 2HU9A 2OOYB 2O53A 3G4S1 3CC7Z 4NBEA 3JAMf 3EERA 4A3CI 1Z01A 2WAQA 1VQ61 5D1OA 3IF8A 4HGYA 1ZB8A 4Y7NI 2QKDA 4E2YA 4XX2A 3CCJ1 5C4XI 4NBBA 2OTLZ 1RNIA 3D6WA 3FQMA 3J7A4 1TWFI 3HOWI 3CME1 3S14I 3I4NI 1VQL1 4NBAA 4E32A 3HOXI 3TE5B 3HOZI 3RZOI 1PFTA 4MH4A 3GTGI 4A3JI 1NJI1 1YJN1 5CM2M 1Q862 2V8JA 1N2FA 1K83I 4RVFA 1K8A1 2M48A 2YU9I 3MZKB 3CQZI 4CL1A 1VQ7Z 2J6AA 3GTJI 2G2KA 1WCMI 2E2II 2JA8I 1TWHI 4A3DI 1QYPA 1Z02A 2E2JI 3CC71 2JMOA 2BJOA 3NFZA 1WW9A 1YUAA 3I56Z 3G71Z 3S17I 4E30A 1TFIA 3G4SZ 5FLXf 1LQLA 2OOXB 1Q7Y1 2Q4ZA 3J80f 2KI7B 4QTTA 1K731 3CPWZ 3CPWY 3J81b 3LUSA 4NBGA 3S15I 2KPIA 3CCJZ 2OTL1 2JA5I 4A3GI 1KQSZ 4BXXI 1VQNZ 1KQSY 3QWUA 5C4JI 1RQFA 4A3FI 1KC81 3EEDA 4E2WA 3H0GI 3GTLI 2QREB 4BY1I 4MD7A 3TDHB 2VF1A 1VQ9Z 4AYBA 3RZDI 3JAMb 4DQYB 4QTUA 5IP7I 1YJNZ 4BBSI 1M901 3M3YI 1VQ71 1I6HI 3S1RI 4NB8A 4MD9A 1YJW1 3G6EZ 3M4OI 2NVTI 1USPB 3OW2Z 2JUBA 1RO2A 2R7ZI 1VQPZ 3G711 4MXUA 4RV9A 2AKLA 1VQ5Z 2GTIA 2W04A 5A2Qb 2P3YA 4E2XA 3CCQ1 1NP6A 5D1PA 2H85A 3Q87A 1NJI2 1Q812 3S16I 2QEXZ 4EWCA 5FLMI 3NDIA 2NVXI 1VLAA 1M1K1 3CCLZ 2IZ4A 1VQN1 3S1NI 2DE5A 4RS4A 3CCUZ 3D9XA 3IX0A 2EGTA 1W2BZ 1VQ91 1W2BY 3VMGA 1NUIA 2QA4Z 2RPRA 1ZB9A 1ML8A 5T64A 1TWAI 3T4NB 1VQKZ 1I50I 1QVFZ 2I3CA 3G6E1 5AN9F 1QVFY 2DE6A 2R6MA 3J80b 4A3II 3I07A 2P28A 1K732 1TWGI 3CMAZ 2HF1A 1KRLA 3GTKI 3FKII 2PM9A 2DE7A 1VQP1 1YJWZ 2OTJZ 1Z03A 4A3KI 1YJ91 2QRDB 1VQ51 1YI21 3GTQI 2QLVB 2QR1B 3NH5A 3CCRZ 3BG0B 2PMZA 5LL6f 3CCEZ 2GU2A 3I4MI 4NB9A 3MONA 1YIJZ 4A3MI 5C44I 4X6AI 3H3VJ 3CCQZ 2F4OA 2QEX1 1Q821 3CCL1 1DL6A 4MD8A 1L1OC 3K7AI 2RBLA 3CCU1 3U50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNY A;  1USP B;  3GCF A;  2NVT I;  2NVY I;  4NBH A;  4BY7 I;  4Y52 I;  5C4X I;  4NBB A;  2JS4 A;  5C3E I;  3PO3 S;  1RLY A;  3HOV I;  3S2H I;  2R7Z I;  4A93 I;  3HOY I;  2AKL A;  3GKQ A;  3D6W A;  1X3Z A;  2B63 I;  1X3W A;  1TWF I;  2P3Y A;  3HOW I;  3S14 I;  3I4N I;  4NBA A;  3GTM S;  4NOZ A;  3HOX I;  1Y1V I;  3HOZ I;  3RZO I;  1PFT A;  4MH4 A;  3S2D I;  3GTG I;  4A3J I;  3GTP I;  3Q87 A;  3PO2 I;  1USP A;  4NBD A;  5CM2 M;  3S16 I;  3VB9 A;  1SFO I;  5FLM I;  2PK7 A;  2NVX I;  1VLA A;  1N2F A;  1K83 I;  2YU9 I;  3CQZ I;  4A3B I;  4A3E I;  2J6A A;  3S1N I;  3GTJ I;  2DE5 A;  3PO3 I;  2JR6 A;  1WCM I;  2E2I I;  2JA8 I;  2R92 I;  1TWH I;  4A3D I;  1QYP A;  2VUM I;  1RO4 A;  5IP9 I;  2JA7 I;  2E2J I;  1I3Q I;  3VMG A;  3ESW A;  2BJO A;  1NUI A;  1WW9 A;  1YUA A;  1ZB9 A;  3S17 I;  1ML8 A;  3GTM I;  3S1M I;  3VMI A;  1TWA I;  1TFI A;  1I50 I;  4NBC A;  3GTO I;  1LQL A;  4A3L I;  4NBF A;  2DE6 A;  1Y1V S;  4A3I I;  3I07 A;  4QTT A;  1TWG I;  2HF1 A;  3LUS A;  3GTK I;  3FKI I;  4NBG A;  2DE7 A;  3S15 I;  1TWC I;  2KPI A;  4A3K I;  3VMH A;  2JA5 I;  2E2H I;  3GTQ I;  4A3G I;  4BXX I;  1Y1W I;  5C4J I;  4BBR I;  3S1Q I;  4A3F I;  3I4M I;  4NB9 A;  3GTL I;  3H0G I;  4A3M I;  4BY1 I;  2NVQ I;  2F4M A;  5C44 I;  4X6A I;  3H3V J;  2F4O A;  4NBE A;  3RZD I;  1R9T I;  1DL6 A;  4QTU A;  3EER A;  4A3C I;  5IP7 I;  1L1O C;  4BBS I;  2JA6 I;  3K7A I;  3M3Y I;  1I6H I;  1ZB8 A;  2R93 I;  4Y7N I;  3HOU I;  3S1R I;  4NB8 A;  2K5R A;  2RBL A;  3M4O I;  3U50 C;  4XX2 A; 
#chains in the Genus database with same CATH topology
 2QRC B;  3GCF A;  1Q86 1;  4NBH A;  4BY7 I;  2JS4 A;  3HOV I;  2QA4 1;  3NDJ A;  1P9N A;  3HOY I;  1VQK 1;  3F3P C;  1X3Z A;  1X3W A;  3CMA 1;  3S2D I;  3GTP I;  3PO2 I;  1USP A;  2OTJ 1;  4NBD A;  3VB9 A;  2GTH A;  4MRI A;  3CCR 1;  4A3E I;  3CCE 1;  1N8R 1;  3J81 f;  1YJ9 Z;  1YI2 Z;  3PO3 I;  2JR6 A;  1YIJ 1;  2VUM I;  1RO4 A;  5IP9 I;  2JA7 I;  4RVH A;  2V8K A;  4RVD A;  1I3Q I;  4MON A;  2LFU A;  2IV2 X;  1VQ4 Z;  2V8I A;  3GTM I;  2M6N A;  3VMI A;  2LEX A;  3CXC Y;  1WJ2 A;  4A3L I;  1S72 Z;  4NBF A;  2LIY A;  1Y1V S;  1K8A 2;  2IZ3 A;  5IT9 f;  2YAD A;  1YUK A;  5T6B A;  1KD1 1;  2OZK A;  5D1O B;  1K9M 1;  3CC2 Z;  3KIF A;  3CD6 Z;  3S1Q I;  3KIH A;  1VQO Z;  5FLX b;  2NVQ I;  2F4M A;  4E31 A;  1Q7Y 2;  3HKZ A;  3NH8 A;  3VTN A;  5A2Q f;  1VQM Z;  1YIT 1;  4DGL A;  1R9T I;  1Q82 2;  1QVG Z;  4DK1 A;  5T67 A;  1QVG Y;  4NFR A;  3CCS Z;  2JA6 I;  2R93 I;  3IFU A;  3I55 Z;  3HOU I;  3FQQ A;  2K5R A;  1Q81 1;  4S1T A;  2E9H A;  2JNY A;  1ZH1 A;  3CCM Z;  2NVY I;  4Y52 I;  5C3E I;  1KC8 2;  3PO3 S;  1RLY A;  3S2H I;  1RO0 A;  2RIQ A;  1VQ4 1;  4A93 I;  3F3F C;  2K3R A;  2Q51 A;  3GKQ A;  3CC4 Z;  2JIR A;  2B63 I;  4RVG A;  1X0T A;  1S72 1;  2ZAE B;  2Y0S A;  3GTM S;  4NOZ A;  4E2Z A;  1Y1V I;  1YHQ Z;  4TNU A;  1M90 2;  1JWH C;  3CCV Z;  1VQ8 Z;  3MZL B;  3BG1 B;  1SFO I;  2PK7 A;  2AYD A;  1JJ2 Z;  1FDO A;  2RHB A;  3CC2 1;  1JJ2 Y;  1VQ6 Z;  3CD6 1;  4A3B I;  1Y8C A;  1N8R 2;  1VQO 1;  2R92 I;  1WII A;  2WB1 A;  1VQM 1;  2RT9 A;  3ESW A;  1S7M A;  3S1M I;  3CCS 1;  2VUG A;  1QF8 A;  4HGZ A;  4NH1 C;  4NBC A;  3GTO I;  3I55 1;  1YIT Z;  2O4H A;  3NH4 A;  3CME Z;  1M1K 2;  1VQL Z;  2W03 A;  4E33 A;  3CCM 1;  1AA6 A;  5IT9 b;  3P5J B;  4HH4 A;  1KD1 2;  1FDI A;  1TWC I;  3VMH A;  2E2H I;  3CC4 1;  1K9M 2;  1Y1W I;  4BBR I;  1YHQ 1;  3OW2 Y;  3CXC Z;  3CCV 1;  3I56 1;  1VQ8 1;  2HU9 A;  2OOY B;  2O53 A;  3G4S 1;  3CC7 Z;  4NBE A;  2V45 A;  3JAM f;  3EER A;  4A3C I;  1Z01 A;  2WAQ A;  1VQ6 1;  5D1O A;  3IF8 A;  4HGY A;  1ZB8 A;  2NAP A;  4Y7N I;  2QKD A;  4E2Y A;  4XX2 A;  3CCJ 1;  5C4X I;  4NBB A;  2V3V A;  2OTL Z;  1RNI A;  3D6W A;  3FQM A;  3J7A 4;  1TWF I;  3HOW I;  3CME 1;  3S14 I;  3I4N I;  1VQL 1;  4NBA A;  4E32 A;  3HOX I;  3TE5 B;  3HOZ I;  3RZO I;  1PFT A;  4MH4 A;  3GTG I;  4A3J I;  1NJI 1;  1YJN 1;  5CM2 M;  1WZN A;  1Q86 2;  2JIM A;  2V8J A;  1N2F A;  1K83 I;  4RVF A;  1K8A 1;  2M48 A;  2YU9 I;  3MZK B;  3CQZ I;  4CL1 A;  1VQ7 Z;  2J6A A;  3GTJ I;  2G2K A;  1WCM I;  2E2I I;  2JA8 I;  1TWH I;  4A3D I;  1QYP A;  1Z02 A;  2E2J I;  3CC7 1;  2JMO A;  2BJO A;  3NFZ A;  1WW9 A;  1YUA A;  3I56 Z;  3G71 Z;  3S17 I;  4E30 A;  1TFI A;  3G4S Z;  5FLX f;  1LQL A;  2OOX B;  1Q7Y 1;  2Q4Z A;  3J80 f;  2KI7 B;  2VPZ A;  4QTT A;  1SIW A;  1K73 1;  3CPW Z;  3CPW Y;  3J81 b;  3LUS A;  4NBG A;  3S15 I;  2KPI A;  3CCJ Z;  2OTL 1;  2JA5 I;  4A3G I;  1KQS Z;  4BXX I;  1VQN Z;  1KQS Y;  3QWU A;  5C4J I;  1RQF A;  4A3F I;  1KC8 1;  3EED A;  4E2W A;  3H0G I;  3GTL I;  2QRE B;  4BY1 I;  4MD7 A;  3TDH B;  2VF1 A;  2JIQ A;  4AYB A;  3RZD I;  1VQ9 Z;  2E7Z A;  3JAM b;  4DQY B;  4QTU A;  5IP7 I;  1YJN Z;  4BBS I;  1M90 1;  3M3Y I;  1VQ7 1;  1I6H I;  3S1R I;  2VPW A;  4NB8 A;  4MD9 A;  1YJW 1;  3G6E Z;  3M4O I;  2NVT I;  1USP B;  3OW2 Z;  2JUB A;  1RO2 A;  2R7Z I;  1VQP Z;  1QXF A;  3G71 1;  4MXU A;  4RV9 A;  2AKL A;  1VQ5 Z;  2GTI A;  2W04 A;  5A2Q b;  1Q16 A;  2P3Y A;  4E2X A;  3CCQ 1;  1NP6 A;  5D1P A;  2H85 A;  3Q87 A;  1NJI 2;  2VPX A;  1Q81 2;  3S16 I;  2QEX Z;  4EWC A;  5FLM I;  3NDI A;  2NVX I;  1VLA A;  1M1K 1;  3CCL Z;  2IZ4 A;  1VQN 1;  3S1N I;  2DE5 A;  4RS4 A;  3CCU Z;  3IR7 A;  3D9X A;  3IX0 A;  2EGT A;  2VPY A;  1W2B Z;  1VQ9 1;  1W2B Y;  3VMG A;  1NUI A;  2QA4 Z;  2RPR A;  1ZB9 A;  1ML8 A;  5T64 A;  1TWA I;  3T4N B;  1VQK Z;  1I50 I;  1QVF Z;  2I3C A;  3G6E 1;  5AN9 F;  1QVF Y;  2DE6 A;  2R6M A;  3J80 b;  4A3I I;  3I07 A;  2P28 A;  1K73 2;  1TWG I;  3CMA Z;  2HF1 A;  1KRL A;  3GTK I;  3FKI I;  2PM9 A;  2DE7 A;  1VQP 1;  1YJW Z;  2OTJ Z;  1Z03 A;  4A3K I;  2JIP A;  1YJ9 1;  2QRD B;  1VQ5 1;  1YI2 1;  3GTQ I;  2QLV B;  2QR1 B;  3NH5 A;  3CCR Z;  3BG0 B;  2PMZ A;  5LL6 f;  3CCE Z;  2GU2 A;  3I4M I;  4NB9 A;  3MON A;  1YIJ Z;  4A3M I;  5C44 I;  4X6A I;  3H3V J;  3CCQ Z;  2F4O A;  2QEX 1;  1Q82 1;  3CCL 1;  1DL6 A;  4MD8 A;  1L1O C;  3K7A I;  2JIO A;  3D2L A;  2RBL A;  3CCU 1;  3U50 C; 
#chains in the Genus database with same CATH homology
 2QRC B;  3GCF A;  1Q86 1;  4NBH A;  4BY7 I;  2JS4 A;  3HOV I;  2QA4 1;  3NDJ A;  1P9N A;  3HOY I;  1VQK 1;  3F3P C;  1X3Z A;  1X3W A;  3CMA 1;  3S2D I;  3GTP I;  3PO2 I;  1USP A;  2OTJ 1;  4NBD A;  3VB9 A;  2GTH A;  4MRI A;  3CCR 1;  4A3E I;  3CCE 1;  1N8R 1;  3J81 f;  1YJ9 Z;  1YI2 Z;  3PO3 I;  2JR6 A;  1YIJ 1;  2VUM I;  1RO4 A;  5IP9 I;  2JA7 I;  4RVH A;  2V8K A;  4RVD A;  1I3Q I;  4MON A;  2LFU A;  1VQ4 Z;  2V8I A;  3GTM I;  2M6N A;  3VMI A;  3CXC Y;  4A3L I;  1S72 Z;  4NBF A;  2LIY A;  1Y1V S;  1K8A 2;  2IZ3 A;  5IT9 f;  2YAD A;  1YUK A;  5T6B A;  1KD1 1;  2OZK A;  5D1O B;  1K9M 1;  3CC2 Z;  3KIF A;  3CD6 Z;  3S1Q I;  3KIH A;  1VQO Z;  5FLX b;  2NVQ I;  2F4M A;  4E31 A;  1Q7Y 2;  3HKZ A;  3NH8 A;  3VTN A;  5A2Q f;  1VQM Z;  1YIT 1;  4DGL A;  1R9T I;  1Q82 2;  1QVG Z;  4DK1 A;  5T67 A;  1QVG Y;  4NFR A;  3CCS Z;  2JA6 I;  2R93 I;  3IFU A;  3I55 Z;  3HOU I;  3FQQ A;  2K5R A;  1Q81 1;  4S1T A;  2E9H A;  2JNY A;  1ZH1 A;  3CCM Z;  2NVY I;  4Y52 I;  5C3E I;  1KC8 2;  3PO3 S;  1RLY A;  3S2H I;  1RO0 A;  2RIQ A;  1VQ4 1;  4A93 I;  3F3F C;  2K3R A;  2Q51 A;  3GKQ A;  3CC4 Z;  2B63 I;  4RVG A;  1X0T A;  1S72 1;  2ZAE B;  2Y0S A;  3GTM S;  4NOZ A;  4E2Z A;  1Y1V I;  1YHQ Z;  4TNU A;  1M90 2;  1JWH C;  3CCV Z;  1VQ8 Z;  3MZL B;  3BG1 B;  1SFO I;  2PK7 A;  1JJ2 Z;  2RHB A;  3CC2 1;  1JJ2 Y;  1VQ6 Z;  3CD6 1;  4A3B I;  1N8R 2;  1VQO 1;  2R92 I;  1WII A;  2WB1 A;  1VQM 1;  2RT9 A;  3ESW A;  1S7M A;  3S1M I;  3CCS 1;  2VUG A;  1QF8 A;  4HGZ A;  4NH1 C;  4NBC A;  3GTO I;  3I55 1;  1YIT Z;  2O4H A;  3NH4 A;  3CME Z;  1M1K 2;  1VQL Z;  2W03 A;  4E33 A;  3CCM 1;  5IT9 b;  3P5J B;  4HH4 A;  1KD1 2;  1TWC I;  3VMH A;  2E2H I;  3CC4 1;  1K9M 2;  1Y1W I;  4BBR I;  1YHQ 1;  3OW2 Y;  3CXC Z;  3CCV 1;  3I56 1;  1VQ8 1;  2HU9 A;  2OOY B;  2O53 A;  3G4S 1;  3CC7 Z;  4NBE A;  3JAM f;  3EER A;  4A3C I;  1Z01 A;  2WAQ A;  1VQ6 1;  5D1O A;  3IF8 A;  4HGY A;  1ZB8 A;  4Y7N I;  2QKD A;  4E2Y A;  4XX2 A;  3CCJ 1;  5C4X I;  4NBB A;  2OTL Z;  1RNI A;  3D6W A;  3FQM A;  3J7A 4;  1TWF I;  3HOW I;  3CME 1;  3S14 I;  3I4N I;  1VQL 1;  4NBA A;  4E32 A;  3HOX I;  3TE5 B;  3HOZ I;  3RZO I;  1PFT A;  4MH4 A;  3GTG I;  4A3J I;  1NJI 1;  1YJN 1;  5CM2 M;  1Q86 2;  2V8J A;  1N2F A;  1K83 I;  4RVF A;  1K8A 1;  2M48 A;  2YU9 I;  3MZK B;  3CQZ I;  4CL1 A;  1VQ7 Z;  2J6A A;  3GTJ I;  2G2K A;  1WCM I;  2E2I I;  2JA8 I;  1TWH I;  4A3D I;  1QYP A;  1Z02 A;  2E2J I;  3CC7 1;  2JMO A;  2BJO A;  3NFZ A;  1WW9 A;  1YUA A;  3I56 Z;  3G71 Z;  3S17 I;  4E30 A;  1TFI A;  3G4S Z;  5FLX f;  1LQL A;  2OOX B;  1Q7Y 1;  2Q4Z A;  3J80 f;  2KI7 B;  4QTT A;  1K73 1;  3CPW Z;  3CPW Y;  3J81 b;  3LUS A;  4NBG A;  3S15 I;  2KPI A;  3CCJ Z;  2OTL 1;  2JA5 I;  4A3G I;  1KQS Z;  4BXX I;  1VQN Z;  1KQS Y;  3QWU A;  5C4J I;  1RQF A;  4A3F I;  1KC8 1;  3EED A;  4E2W A;  3H0G I;  3GTL I;  2QRE B;  4BY1 I;  4MD7 A;  3TDH B;  2VF1 A;  1VQ9 Z;  4AYB A;  3RZD I;  3JAM b;  4DQY B;  4QTU A;  5IP7 I;  1YJN Z;  4BBS I;  1M90 1;  3M3Y I;  1VQ7 1;  1I6H I;  3S1R I;  4NB8 A;  4MD9 A;  1YJW 1;  3G6E Z;  3M4O I;  2NVT I;  1USP B;  3OW2 Z;  2JUB A;  1RO2 A;  2R7Z I;  1VQP Z;  3G71 1;  4MXU A;  4RV9 A;  2AKL A;  1VQ5 Z;  2GTI A;  2W04 A;  5A2Q b;  2P3Y A;  4E2X A;  3CCQ 1;  1NP6 A;  5D1P A;  2H85 A;  3Q87 A;  1NJI 2;  1Q81 2;  3S16 I;  2QEX Z;  4EWC A;  5FLM I;  3NDI A;  2NVX I;  1VLA A;  1M1K 1;  3CCL Z;  2IZ4 A;  1VQN 1;  3S1N I;  2DE5 A;  4RS4 A;  3CCU Z;  3D9X A;  3IX0 A;  2EGT A;  1W2B Z;  1VQ9 1;  1W2B Y;  3VMG A;  1NUI A;  2QA4 Z;  2RPR A;  1ZB9 A;  1ML8 A;  5T64 A;  1TWA I;  3T4N B;  1VQK Z;  1I50 I;  1QVF Z;  2I3C A;  3G6E 1;  5AN9 F;  1QVF Y;  2DE6 A;  2R6M A;  3J80 b;  4A3I I;  3I07 A;  2P28 A;  1K73 2;  1TWG I;  3CMA Z;  2HF1 A;  1KRL A;  3GTK I;  3FKI I;  2PM9 A;  2DE7 A;  1VQP 1;  1YJW Z;  2OTJ Z;  1Z03 A;  4A3K I;  1YJ9 1;  2QRD B;  1VQ5 1;  1YI2 1;  3GTQ I;  2QLV B;  2QR1 B;  3NH5 A;  3CCR Z;  3BG0 B;  2PMZ A;  5LL6 f;  3CCE Z;  2GU2 A;  3I4M I;  4NB9 A;  3MON A;  1YIJ Z;  4A3M I;  5C44 I;  4X6A I;  3H3V J;  3CCQ Z;  2F4O A;  2QEX 1;  1Q82 1;  3CCL 1;  1DL6 A;  4MD8 A;  1L1O C;  3K7A I;  2RBL A;  3CCU 1;  3U50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...