1I3QI

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
122
structure length
122
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI02
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1i3qI01
5C4XI 2F4MA 2PK7A 4BBRI 3S1NI 4NBCA 4BXXI 2J6AA 1TWHI 3GTJI 4X6AI 3H3VJ 2E2II 2YU9I 3S15I 3S16I 2HF1A 3Q87A 2JNYA 2VUMI 2JA5I 1I3QI 4NBBA 3I07A 3I4NI 3GCFA 3H0GI 1RO4A 3GTPI 3M4OI 4A3EI 4NOZA 3GTMI 1TFIA 2E2HI 3RZDI 3HOWI 4A3DI 2DE7A 3U50C 1TWCI 4Y7NI 4NBEA 3I4MI 3PO3S 4A3GI 1TWAI 1ZB9A 2JR6A 2NVQI 3CQZI 3HOUI 4QTUA 5CM2M 2RBLA 1I6HI 1WW9A 2R93I 2NVXI 3PO3I 3VB9A 5C4JI 5C3EI 3VMGA 4XX2A 2K5RA 4NB9A 4NBFA 1ML8A 4NBHA 4A93I 4BY1I 3GTKI 2JA8I 1X3ZA 1YUAA 2BJOA 2JS4A 1Y1WI 1K83I 3S1MI 1WCMI 3GKQA 1PFTA 2DE6A 3HOVI 2NVTI 2AKLA 2KPIA 2R7ZI 5IP9I 2JA6I 3HOXI 4BY7I 1LQLA 3FKII 4A3MI 2F4OA 4NBGA 3ESWA 3M3YI 3VMIA 4NBAA 3GTOI 4A3BI 4BBSI 4A3JI 1ZB8A 3GTLI 3HOZI 2JA7I 1RLYA 4QTTA 1USPA 3K7AI 3S14I 1I50I 4Y52I 5IP7I 1L1OC 1USPB 4A3LI 1N2FA 1QYPA 2B63I 3EERA 1X3WA 1R9TI 1TWGI 1TWFI 3VMHA 2E2JI 4NB8A 4NBDA 2R92I 3HOYI 3S2DI 2NVYI 5C44I 1NUIA 4A3FI 5FLMI 1DL6A 2P3YA 3GTMS 3GTGI 3GTQI 1Y1VS 3PO2I 4MH4A 3S1RI 1VLAA 4A3KI 3S1QI 4A3II 3RZOI 3LUSA 1SFOI 2DE5A 3S17I 1Y1VI 3S2HI 4A3CI 3D6WA
chains in the Genus database with same CATH superfamily
5C4XI 2F4MA 2VPWA 2PK7A 3NDJA 1K731 3CD6Z 4NBCA 1NJI2 1M901 2GTHA 1TWHI 4X6AI 3CPWY 2VF1A 2Q51A 1VQMZ 5FLXb 2JIOA 1VQP1 1I3QI 3I07A 3I4NI 3I561 1RO4A 4HH4A 3GTPI 3M4OI 1RO0A 4NOZA 3RZDI 2DE7A 4A3GI 3MZLB 2JR6A 2NVQI 2QREB 3CQZI 1QVGZ 2NVXI 5LL6f 3CCS1 3CCMZ 3VMGA 3J81f 4A93I 1ML8A 2R6MA 3CCU1 1Q812 4BY1I 3J7A4 1KQSZ 1VQ4Z 1VQKZ 1YIT1 1AA6A 1PFTA 3HOVI 2W03A 2NVTI 2AKLA 2KPIA 4MRIA 2OOXB 1K8A1 2O53A 3BG0B 4RVHA 2V8IA 2PM9A 3D9XA 1JWHC 2LEXA 1LQLA 3F3FC 2ZAEB 1M902 3CCSZ 1NP6A 2P28A 3VMIA 4NBAA 4A3JI 2VPXA 4RS4A 4CL1A 3HOZI 2H85A 1KD11 1USPA 1YJ91 3NH8A 1YITZ 2B63I 1VQO1 1TWGI 1TWFI 2NAPA 1Q7Y1 4NB8A 3S2DI 3CCJ1 3CCRZ 2RHBA 3CCE1 5FLXf 1YI21 1YJN1 4A3II 2DE5A 3S2HI 2RIQA 1X0TA 1YUKA 1VQOZ 2J6AA 5IT9b 3CC21 2QEXZ 2V8KA 3H3VJ 2E2II 2OZKA 2YU9I 3S15I 3S16I 2HF1A 3MZKB 3Q87A 4DGLA 2JNYA 3F3PC 2JIRA 3GCFA 4A3EI 4RVDA 1QVGY 2JMOA 1KRLA 5T6BA 1TFIA 2E2HI 1YJNZ 4NBEA 4NFRA 3G6EZ 3I4MI 1KD12 1Z01A 3HOUI 4QTUA 2RBLA 4E31A 1KQSY 5C4JI 2QRCB 1Q7Y2 4MD8A 1VQN1 1N8R1 2OTL1 2QA41 3CC7Z 2JA8I 1X3ZA 1K9M1 2BJOA 2JS4A 1Y1WI 1K83I 3GKQA 2M48A 5D1PA 3G711 3G4S1 2E7ZA 1VQ91 1QVFZ 3HKZA 4E2YA 2OOYB 3HOXI 2QRDB 5AN9F 3CCQ1 2IZ4A 3NH4A 4A3MI 4NBGA 3ESWA 1VQ51 3M3YI 2VUGA 3NDIA 2OTLZ 4A3BI 4RVGA 3FQQA 3CME1 1Q821 3GTLI 1VQPZ 3I56Z 3S14I 1I50I 2EGTA 1VQ81 5IP7I 1N2FA 1QYPA 1M1K2 4RV9A 3G71Z 2GTIA 1X3WA 3T4NB 2IZ3A 2E2JI 4NBDA 3CC41 4EWCA 2R92I 3HOYI 2VPYA 2NVYI 1W2BZ 4E33A 1K732 5IT9f 1NUIA 3CCQZ 1S721 4DK1A 1DL6A 1WIIA 2P3YA 2O4HA 3GTMS 3GTGI 1KC81 1Y1VS 1N8R2 3S1RI 3CCUZ 3CMEZ 2OTJ1 4MXUA 4A3KI 5T67A 1S7MA 1SFOI 1K9M2 1Y1VI 4A3CI 1QF8A 2LFUA 2JIQA 2KI7B 3J80b 3GTJI 3CC4Z 4RVFA 2WB1A 1S72Z 1YHQ1 2W04A 2JA5I 4MD7A 3KIFA 4E2XA 3CCV1 1Q822 3HOWI 1VQ61 4A3DI 1TWCI 1YJ9Z 3NFZA 3PO3S 1SIWA 4TNUA 4DQYB 4NH1C 5CM2M 3OW2Z 1K8A2 1WW9A 2R93I 3PO3I 3VB9A 3KIHA 3D2LA 3CCJZ 4XX2A 2LIYA 1QVFY 4NBFA 4NBHA 1JJ2Z 1YUAA 5A2Qf 1RNIA 3CCEZ 3MONA 2WAQA 2HU9A 1KC82 1RQFA 1WCMI 1WZNA 1YI2Z 1YJW1 3CCVZ 1VQ6Z 5IP9I 4BY7I 2JUBA 5D1OB 1Q861 3FKII 3QWUA 3CC2Z 2V45A 1Z02A 3GTOI 1ZB8A 2QLVB 1VQ71 2JA7I 1RLYA 2Y0SA 4QTTA 1W2BY 2GU2A 2JIMA 4Y52I 4A3LI 1YJWZ 3EERA 3NH5A 1R9TI 3JAMb 4E2WA 3CCM1 4E2ZA 3J80f 4A3FI 5FLMI 2PMZA 1WJ2A 3VTNA 5A2Qb 1VQ41 1VQNZ 1VQK1 3GTQI 3PO2I 3TDHB 2QA4Z 2YADA 1VLAA 2JIPA 3CCL1 3TE5B 1VQ7Z 1Q16A 3S17I 5T64A 1VQL1 3G4SZ 4BBRI 1VQ9Z 3S1NI 4BXXI 2G2KA 3BG1B 2QR1B 2IV2X 1ZH1A 4MONA 2VUMI 1FDOA 1Q862 1VQ5Z 4NBBA 3H0GI 1P9NA 1QXFA 3I551 3CPWZ 3OW2Y 3IX0A 3GTMI 3CCLZ 2I3CA 1FDIA 3U50C 4Y7NI 2QKDA 1VQ8Z 1TWAI 1ZB9A 1VQLZ 1JJ2Y 1I6HI 4MD9A 4HGYA 3CCR1 3CMA1 4HGZA 5C3EI 2Q4ZA 4AYBA 4S1TA 2V3VA 2K5RA 4NB9A 3GTKI 2AYDA 1YIJ1 3IFUA 3S1MI 1Y8CA 3I55Z 2DE6A 2OTJZ 1NJI1 3CXCY 2K3RA 2R7ZI 3EEDA 2JA6I 2QEX1 5D1OA 3JAMf 2RPRA 3J81b 3CMAZ 2F4OA 2RT9A 1YHQZ 4BBSI 2VPZA 3IF8A 1YIJZ 3K7AI 3G6E1 3FQMA 1L1OC 1USPB 3CD61 3P5JB 3VMHA 4E32A 5C44I 1Z03A 2M6NA 1RO2A 1Q811 3CXCZ 1VQM1 2V8JA 3CC71 4E30A 4MH4A 1M1K1 3S1QI 2E9HA 3RZOI 3LUSA 3IR7A 3D6WA
chains in the Genus database with same CATH topology
5C4XI 2F4MA 3NDJA 2PK7A 1K731 3CD6Z 4NBCA 1NJI2 1M901 2GTHA 1TWHI 4X6AI 3CPWY 2VF1A 2Q51A 1VQMZ 5FLXb 1VQP1 1I3QI 3I07A 3I4NI 3I561 1RO4A 4HH4A 3GTPI 3M4OI 1RO0A 4NOZA 3RZDI 2DE7A 4A3GI 3MZLB 2JR6A 2NVQI 2QREB 3CQZI 1QVGZ 2NVXI 5LL6f 3CCS1 3CCMZ 3VMGA 3J81f 4A93I 1ML8A 2R6MA 3CCU1 1Q812 4BY1I 3J7A4 1KQSZ 1VQ4Z 1VQKZ 1YIT1 1PFTA 3HOVI 2W03A 2NVTI 2AKLA 2KPIA 4MRIA 2OOXB 1K8A1 2O53A 3BG0B 4RVHA 2V8IA 2PM9A 3D9XA 1JWHC 1LQLA 3F3FC 2ZAEB 1M902 3CCSZ 1NP6A 2P28A 3VMIA 4NBAA 4A3JI 4RS4A 4CL1A 3HOZI 2H85A 1KD11 1USPA 1YJ91 3NH8A 1YITZ 2B63I 1VQO1 1TWGI 1TWFI 1Q7Y1 4NB8A 3S2DI 3CCJ1 3CCRZ 2RHBA 3CCE1 5FLXf 1YI21 1YJN1 4A3II 2DE5A 3S2HI 2RIQA 1X0TA 1YUKA 1VQOZ 2J6AA 5IT9b 3CC21 2QEXZ 2V8KA 3H3VJ 2E2II 2OZKA 2YU9I 3S15I 3S16I 2HF1A 3MZKB 3Q87A 4DGLA 2JNYA 3F3PC 3GCFA 4A3EI 4RVDA 1QVGY 2JMOA 1KRLA 5T6BA 1TFIA 2E2HI 1YJNZ 4NBEA 4NFRA 3G6EZ 3I4MI 1KD12 1Z01A 3HOUI 4QTUA 2RBLA 4E31A 1KQSY 5C4JI 2QRCB 1Q7Y2 4MD8A 1VQN1 1N8R1 2OTL1 2QA41 3CC7Z 2JA8I 1X3ZA 1K9M1 2BJOA 2JS4A 1Y1WI 1K83I 3GKQA 2M48A 5D1PA 3G711 3G4S1 1QVFZ 1VQ91 3HKZA 4E2YA 2OOYB 3HOXI 2QRDB 5AN9F 3CCQ1 2IZ4A 3NH4A 4A3MI 4NBGA 3ESWA 1VQ51 3M3YI 2VUGA 3NDIA 2OTLZ 4A3BI 4RVGA 3FQQA 3CME1 1Q821 3GTLI 1VQPZ 3I56Z 3S14I 1I50I 2EGTA 1VQ81 5IP7I 1N2FA 1QYPA 1M1K2 4RV9A 3G71Z 2GTIA 1X3WA 3T4NB 2IZ3A 2E2JI 4NBDA 3CC41 4EWCA 2R92I 3HOYI 2NVYI 1W2BZ 4E33A 1K732 5IT9f 1NUIA 3CCQZ 1S721 4DK1A 1DL6A 1WIIA 2P3YA 2O4HA 3GTMS 3GTGI 1KC81 1Y1VS 1N8R2 3S1RI 3CCUZ 3CMEZ 2OTJ1 4MXUA 4A3KI 5T67A 1S7MA 1SFOI 1K9M2 1Y1VI 4A3CI 1QF8A 2LFUA 2KI7B 3J80b 3GTJI 3CC4Z 4RVFA 2WB1A 1S72Z 1YHQ1 2W04A 2JA5I 4MD7A 3KIFA 4E2XA 3CCV1 1Q822 3HOWI 1VQ61 4A3DI 1TWCI 1YJ9Z 3NFZA 3PO3S 4TNUA 4DQYB 4NH1C 5CM2M 3OW2Z 1K8A2 1WW9A 2R93I 3PO3I 3VB9A 3KIHA 3CCJZ 4XX2A 2LIYA 1QVFY 4NBFA 4NBHA 1JJ2Z 1YUAA 5A2Qf 1RNIA 3CCEZ 3MONA 2WAQA 2HU9A 1KC82 1RQFA 1WCMI 1YI2Z 1YJW1 3CCVZ 1VQ6Z 5IP9I 4BY7I 2JUBA 5D1OB 1Q861 3FKII 3QWUA 3CC2Z 1Z02A 3GTOI 1ZB8A 2QLVB 1VQ71 2JA7I 1RLYA 2Y0SA 4QTTA 1W2BY 2GU2A 4Y52I 4A3LI 1YJWZ 3EERA 3NH5A 1R9TI 3JAMb 4E2WA 3CCM1 4E2ZA 3J80f 4A3FI 5FLMI 2PMZA 3VTNA 5A2Qb 1VQ41 1VQNZ 1VQK1 3GTQI 3PO2I 3TDHB 2QA4Z 2YADA 1VLAA 3CCL1 3TE5B 1VQ7Z 3S17I 5T64A 1VQL1 3G4SZ 4BBRI 1VQ9Z 3S1NI 4BXXI 2G2KA 3BG1B 2QR1B 1ZH1A 4MONA 2VUMI 1Q862 1VQ5Z 4NBBA 3H0GI 1P9NA 3I551 3CPWZ 3OW2Y 3IX0A 3GTMI 3CCLZ 2I3CA 3U50C 4Y7NI 2QKDA 1VQ8Z 1TWAI 1ZB9A 1VQLZ 1JJ2Y 1I6HI 4MD9A 4HGYA 3CCR1 3CMA1 4HGZA 5C3EI 2Q4ZA 4AYBA 4S1TA 2K5RA 4NB9A 3GTKI 1YIJ1 3IFUA 3S1MI 2DE6A 3I55Z 2OTJZ 1NJI1 3CXCY 2K3RA 2R7ZI 3EEDA 2JA6I 2QEX1 5D1OA 3JAMf 2RPRA 3J81b 3CMAZ 2F4OA 2RT9A 1YHQZ 4BBSI 3IF8A 1YIJZ 3K7AI 3G6E1 3FQMA 1L1OC 1USPB 3CD61 3P5JB 3VMHA 4E32A 5C44I 1Z03A 2M6NA 1RO2A 1Q811 3CXCZ 1VQM1 2V8JA 3CC71 4E30A 4MH4A 1M1K1 3S1QI 2E9HA 3RZOI 3LUSA 3D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X I;  2F4M A;  2PK7 A;  4BBR I;  3S1N I;  4NBC A;  4BXX I;  2J6A A;  1TWH I;  3GTJ I;  4X6A I;  3H3V J;  2E2I I;  2YU9 I;  3S15 I;  3S16 I;  2HF1 A;  3Q87 A;  2JNY A;  2VUM I;  2JA5 I;  1I3Q I;  4NBB A;  3I07 A;  3I4N I;  3GCF A;  3H0G I;  1RO4 A;  3GTP I;  3M4O I;  4A3E I;  4NOZ A;  3GTM I;  1TFI A;  2E2H I;  3RZD I;  3HOW I;  4A3D I;  2DE7 A;  3U50 C;  1TWC I;  4Y7N I;  4NBE A;  3I4M I;  3PO3 S;  4A3G I;  1TWA I;  1ZB9 A;  2JR6 A;  2NVQ I;  3CQZ I;  3HOU I;  4QTU A;  5CM2 M;  2RBL A;  1I6H I;  1WW9 A;  2R93 I;  2NVX I;  3PO3 I;  3VB9 A;  5C4J I;  5C3E I;  3VMG A;  4XX2 A;  2K5R A;  4NB9 A;  4NBF A;  1ML8 A;  4NBH A;  4A93 I;  4BY1 I;  3GTK I;  2JA8 I;  1X3Z A;  1YUA A;  2BJO A;  2JS4 A;  1Y1W I;  1K83 I;  3S1M I;  1WCM I;  3GKQ A;  1PFT A;  2DE6 A;  3HOV I;  2NVT I;  2AKL A;  2KPI A;  2R7Z I;  5IP9 I;  2JA6 I;  3HOX I;  4BY7 I;  1LQL A;  3FKI I;  4A3M I;  2F4O A;  4NBG A;  3ESW A;  3M3Y I;  3VMI A;  4NBA A;  3GTO I;  4A3B I;  4BBS I;  4A3J I;  1ZB8 A;  3GTL I;  3HOZ I;  2JA7 I;  1RLY A;  4QTT A;  1USP A;  3K7A I;  3S14 I;  1I50 I;  4Y52 I;  5IP7 I;  1L1O C;  1USP B;  4A3L I;  1N2F A;  1QYP A;  2B63 I;  3EER A;  1X3W A;  1R9T I;  1TWG I;  1TWF I;  3VMH A;  2E2J I;  4NB8 A;  4NBD A;  2R92 I;  3HOY I;  3S2D I;  2NVY I;  5C44 I;  1NUI A;  4A3F I;  5FLM I;  1DL6 A;  2P3Y A;  3GTM S;  3GTG I;  3GTQ I;  1Y1V S;  3PO2 I;  4MH4 A;  3S1R I;  1VLA A;  4A3K I;  3S1Q I;  4A3I I;  3RZO I;  3LUS A;  1SFO I;  2DE5 A;  3S17 I;  1Y1V I;  3S2H I;  4A3C I;  3D6W A; 
#chains in the Genus database with same CATH topology
 5C4X I;  2F4M A;  2VPW A;  2PK7 A;  3NDJ A;  1K73 1;  3CD6 Z;  4NBC A;  1NJI 2;  1M90 1;  2GTH A;  1TWH I;  4X6A I;  3CPW Y;  2VF1 A;  2Q51 A;  1VQM Z;  5FLX b;  2JIO A;  1VQP 1;  1I3Q I;  3I07 A;  3I4N I;  3I56 1;  1RO4 A;  4HH4 A;  3GTP I;  3M4O I;  1RO0 A;  4NOZ A;  3RZD I;  2DE7 A;  4A3G I;  3MZL B;  2JR6 A;  2NVQ I;  2QRE B;  3CQZ I;  1QVG Z;  2NVX I;  5LL6 f;  3CCS 1;  3CCM Z;  3VMG A;  3J81 f;  4A93 I;  1ML8 A;  2R6M A;  3CCU 1;  1Q81 2;  4BY1 I;  3J7A 4;  1KQS Z;  1VQ4 Z;  1VQK Z;  1YIT 1;  1AA6 A;  1PFT A;  3HOV I;  2W03 A;  2NVT I;  2AKL A;  2KPI A;  4MRI A;  2OOX B;  1K8A 1;  2O53 A;  3BG0 B;  4RVH A;  2V8I A;  2PM9 A;  3D9X A;  1JWH C;  2LEX A;  1LQL A;  3F3F C;  2ZAE B;  1M90 2;  3CCS Z;  1NP6 A;  2P28 A;  3VMI A;  4NBA A;  4A3J I;  2VPX A;  4RS4 A;  4CL1 A;  3HOZ I;  2H85 A;  1KD1 1;  1USP A;  1YJ9 1;  3NH8 A;  1YIT Z;  2B63 I;  1VQO 1;  1TWG I;  1TWF I;  2NAP A;  1Q7Y 1;  4NB8 A;  3S2D I;  3CCJ 1;  3CCR Z;  2RHB A;  3CCE 1;  5FLX f;  1YI2 1;  1YJN 1;  4A3I I;  2DE5 A;  3S2H I;  2RIQ A;  1X0T A;  1YUK A;  1VQO Z;  2J6A A;  5IT9 b;  3CC2 1;  2QEX Z;  2V8K A;  3H3V J;  2E2I I;  2OZK A;  2YU9 I;  3S15 I;  3S16 I;  2HF1 A;  3MZK B;  3Q87 A;  4DGL A;  2JNY A;  3F3P C;  2JIR A;  3GCF A;  4A3E I;  4RVD A;  1QVG Y;  2JMO A;  1KRL A;  5T6B A;  1TFI A;  2E2H I;  1YJN Z;  4NBE A;  4NFR A;  3G6E Z;  3I4M I;  1KD1 2;  1Z01 A;  3HOU I;  4QTU A;  2RBL A;  4E31 A;  1KQS Y;  5C4J I;  2QRC B;  1Q7Y 2;  4MD8 A;  1VQN 1;  1N8R 1;  2OTL 1;  2QA4 1;  3CC7 Z;  2JA8 I;  1X3Z A;  1K9M 1;  2BJO A;  2JS4 A;  1Y1W I;  1K83 I;  3GKQ A;  2M48 A;  5D1P A;  3G71 1;  3G4S 1;  2E7Z A;  1VQ9 1;  1QVF Z;  3HKZ A;  4E2Y A;  2OOY B;  3HOX I;  2QRD B;  5AN9 F;  3CCQ 1;  2IZ4 A;  3NH4 A;  4A3M I;  4NBG A;  3ESW A;  1VQ5 1;  3M3Y I;  2VUG A;  3NDI A;  2OTL Z;  4A3B I;  4RVG A;  3FQQ A;  3CME 1;  1Q82 1;  3GTL I;  1VQP Z;  3I56 Z;  3S14 I;  1I50 I;  2EGT A;  1VQ8 1;  5IP7 I;  1N2F A;  1QYP A;  1M1K 2;  4RV9 A;  3G71 Z;  2GTI A;  1X3W A;  3T4N B;  2IZ3 A;  2E2J I;  4NBD A;  3CC4 1;  4EWC A;  2R92 I;  3HOY I;  2VPY A;  2NVY I;  1W2B Z;  4E33 A;  1K73 2;  5IT9 f;  1NUI A;  3CCQ Z;  1S72 1;  4DK1 A;  1DL6 A;  1WII A;  2P3Y A;  2O4H A;  3GTM S;  3GTG I;  1KC8 1;  1Y1V S;  1N8R 2;  3S1R I;  3CCU Z;  3CME Z;  2OTJ 1;  4MXU A;  4A3K I;  5T67 A;  1S7M A;  1SFO I;  1K9M 2;  1Y1V I;  4A3C I;  1QF8 A;  2LFU A;  2JIQ A;  2KI7 B;  3J80 b;  3GTJ I;  3CC4 Z;  4RVF A;  2WB1 A;  1S72 Z;  1YHQ 1;  2W04 A;  2JA5 I;  4MD7 A;  3KIF A;  4E2X A;  3CCV 1;  1Q82 2;  3HOW I;  1VQ6 1;  4A3D I;  1TWC I;  1YJ9 Z;  3NFZ A;  3PO3 S;  1SIW A;  4TNU A;  4DQY B;  4NH1 C;  5CM2 M;  3OW2 Z;  1K8A 2;  1WW9 A;  2R93 I;  3PO3 I;  3VB9 A;  3KIH A;  3D2L A;  3CCJ Z;  4XX2 A;  2LIY A;  1QVF Y;  4NBF A;  4NBH A;  1JJ2 Z;  1YUA A;  5A2Q f;  1RNI A;  3CCE Z;  3MON A;  2WAQ A;  2HU9 A;  1KC8 2;  1RQF A;  1WCM I;  1WZN A;  1YI2 Z;  1YJW 1;  3CCV Z;  1VQ6 Z;  5IP9 I;  4BY7 I;  2JUB A;  5D1O B;  1Q86 1;  3FKI I;  3QWU A;  3CC2 Z;  2V45 A;  1Z02 A;  3GTO I;  1ZB8 A;  2QLV B;  1VQ7 1;  2JA7 I;  1RLY A;  2Y0S A;  4QTT A;  1W2B Y;  2GU2 A;  2JIM A;  4Y52 I;  4A3L I;  1YJW Z;  3EER A;  3NH5 A;  1R9T I;  3JAM b;  4E2W A;  3CCM 1;  4E2Z A;  3J80 f;  4A3F I;  5FLM I;  2PMZ A;  1WJ2 A;  3VTN A;  5A2Q b;  1VQ4 1;  1VQN Z;  1VQK 1;  3GTQ I;  3PO2 I;  3TDH B;  2QA4 Z;  2YAD A;  1VLA A;  2JIP A;  3CCL 1;  3TE5 B;  1VQ7 Z;  1Q16 A;  3S17 I;  5T64 A;  1VQL 1;  3G4S Z;  4BBR I;  1VQ9 Z;  3S1N I;  4BXX I;  2G2K A;  3BG1 B;  2QR1 B;  2IV2 X;  1ZH1 A;  4MON A;  2VUM I;  1FDO A;  1Q86 2;  1VQ5 Z;  4NBB A;  3H0G I;  1P9N A;  1QXF A;  3I55 1;  3CPW Z;  3OW2 Y;  3IX0 A;  3GTM I;  3CCL Z;  2I3C A;  1FDI A;  3U50 C;  4Y7N I;  2QKD A;  1VQ8 Z;  1TWA I;  1ZB9 A;  1VQL Z;  1JJ2 Y;  1I6H I;  4MD9 A;  4HGY A;  3CCR 1;  3CMA 1;  4HGZ A;  5C3E I;  2Q4Z A;  4AYB A;  4S1T A;  2V3V A;  2K5R A;  4NB9 A;  3GTK I;  2AYD A;  1YIJ 1;  3IFU A;  3S1M I;  1Y8C A;  3I55 Z;  2DE6 A;  2OTJ Z;  1NJI 1;  3CXC Y;  2K3R A;  2R7Z I;  3EED A;  2JA6 I;  2QEX 1;  5D1O A;  3JAM f;  2RPR A;  3J81 b;  3CMA Z;  2F4O A;  2RT9 A;  1YHQ Z;  4BBS I;  2VPZ A;  3IF8 A;  1YIJ Z;  3K7A I;  3G6E 1;  3FQM A;  1L1O C;  1USP B;  3CD6 1;  3P5J B;  3VMH A;  4E32 A;  5C44 I;  1Z03 A;  2M6N A;  1RO2 A;  1Q81 1;  3CXC Z;  1VQM 1;  2V8J A;  3CC7 1;  4E30 A;  4MH4 A;  1M1K 1;  3S1Q I;  2E9H A;  3RZO I;  3LUS A;  3IR7 A;  3D6W A; 
#chains in the Genus database with same CATH homology
 5C4X I;  2F4M A;  3NDJ A;  2PK7 A;  1K73 1;  3CD6 Z;  4NBC A;  1NJI 2;  1M90 1;  2GTH A;  1TWH I;  4X6A I;  3CPW Y;  2VF1 A;  2Q51 A;  1VQM Z;  5FLX b;  1VQP 1;  1I3Q I;  3I07 A;  3I4N I;  3I56 1;  1RO4 A;  4HH4 A;  3GTP I;  3M4O I;  1RO0 A;  4NOZ A;  3RZD I;  2DE7 A;  4A3G I;  3MZL B;  2JR6 A;  2NVQ I;  2QRE B;  3CQZ I;  1QVG Z;  2NVX I;  5LL6 f;  3CCS 1;  3CCM Z;  3VMG A;  3J81 f;  4A93 I;  1ML8 A;  2R6M A;  3CCU 1;  1Q81 2;  4BY1 I;  3J7A 4;  1KQS Z;  1VQ4 Z;  1VQK Z;  1YIT 1;  1PFT A;  3HOV I;  2W03 A;  2NVT I;  2AKL A;  2KPI A;  4MRI A;  2OOX B;  1K8A 1;  2O53 A;  3BG0 B;  4RVH A;  2V8I A;  2PM9 A;  3D9X A;  1JWH C;  1LQL A;  3F3F C;  2ZAE B;  1M90 2;  3CCS Z;  1NP6 A;  2P28 A;  3VMI A;  4NBA A;  4A3J I;  4RS4 A;  4CL1 A;  3HOZ I;  2H85 A;  1KD1 1;  1USP A;  1YJ9 1;  3NH8 A;  1YIT Z;  2B63 I;  1VQO 1;  1TWG I;  1TWF I;  1Q7Y 1;  4NB8 A;  3S2D I;  3CCJ 1;  3CCR Z;  2RHB A;  3CCE 1;  5FLX f;  1YI2 1;  1YJN 1;  4A3I I;  2DE5 A;  3S2H I;  2RIQ A;  1X0T A;  1YUK A;  1VQO Z;  2J6A A;  5IT9 b;  3CC2 1;  2QEX Z;  2V8K A;  3H3V J;  2E2I I;  2OZK A;  2YU9 I;  3S15 I;  3S16 I;  2HF1 A;  3MZK B;  3Q87 A;  4DGL A;  2JNY A;  3F3P C;  3GCF A;  4A3E I;  4RVD A;  1QVG Y;  2JMO A;  1KRL A;  5T6B A;  1TFI A;  2E2H I;  1YJN Z;  4NBE A;  4NFR A;  3G6E Z;  3I4M I;  1KD1 2;  1Z01 A;  3HOU I;  4QTU A;  2RBL A;  4E31 A;  1KQS Y;  5C4J I;  2QRC B;  1Q7Y 2;  4MD8 A;  1VQN 1;  1N8R 1;  2OTL 1;  2QA4 1;  3CC7 Z;  2JA8 I;  1X3Z A;  1K9M 1;  2BJO A;  2JS4 A;  1Y1W I;  1K83 I;  3GKQ A;  2M48 A;  5D1P A;  3G71 1;  3G4S 1;  1QVF Z;  1VQ9 1;  3HKZ A;  4E2Y A;  2OOY B;  3HOX I;  2QRD B;  5AN9 F;  3CCQ 1;  2IZ4 A;  3NH4 A;  4A3M I;  4NBG A;  3ESW A;  1VQ5 1;  3M3Y I;  2VUG A;  3NDI A;  2OTL Z;  4A3B I;  4RVG A;  3FQQ A;  3CME 1;  1Q82 1;  3GTL I;  1VQP Z;  3I56 Z;  3S14 I;  1I50 I;  2EGT A;  1VQ8 1;  5IP7 I;  1N2F A;  1QYP A;  1M1K 2;  4RV9 A;  3G71 Z;  2GTI A;  1X3W A;  3T4N B;  2IZ3 A;  2E2J I;  4NBD A;  3CC4 1;  4EWC A;  2R92 I;  3HOY I;  2NVY I;  1W2B Z;  4E33 A;  1K73 2;  5IT9 f;  1NUI A;  3CCQ Z;  1S72 1;  4DK1 A;  1DL6 A;  1WII A;  2P3Y A;  2O4H A;  3GTM S;  3GTG I;  1KC8 1;  1Y1V S;  1N8R 2;  3S1R I;  3CCU Z;  3CME Z;  2OTJ 1;  4MXU A;  4A3K I;  5T67 A;  1S7M A;  1SFO I;  1K9M 2;  1Y1V I;  4A3C I;  1QF8 A;  2LFU A;  2KI7 B;  3J80 b;  3GTJ I;  3CC4 Z;  4RVF A;  2WB1 A;  1S72 Z;  1YHQ 1;  2W04 A;  2JA5 I;  4MD7 A;  3KIF A;  4E2X A;  3CCV 1;  1Q82 2;  3HOW I;  1VQ6 1;  4A3D I;  1TWC I;  1YJ9 Z;  3NFZ A;  3PO3 S;  4TNU A;  4DQY B;  4NH1 C;  5CM2 M;  3OW2 Z;  1K8A 2;  1WW9 A;  2R93 I;  3PO3 I;  3VB9 A;  3KIH A;  3CCJ Z;  4XX2 A;  2LIY A;  1QVF Y;  4NBF A;  4NBH A;  1JJ2 Z;  1YUA A;  5A2Q f;  1RNI A;  3CCE Z;  3MON A;  2WAQ A;  2HU9 A;  1KC8 2;  1RQF A;  1WCM I;  1YI2 Z;  1YJW 1;  3CCV Z;  1VQ6 Z;  5IP9 I;  4BY7 I;  2JUB A;  5D1O B;  1Q86 1;  3FKI I;  3QWU A;  3CC2 Z;  1Z02 A;  3GTO I;  1ZB8 A;  2QLV B;  1VQ7 1;  2JA7 I;  1RLY A;  2Y0S A;  4QTT A;  1W2B Y;  2GU2 A;  4Y52 I;  4A3L I;  1YJW Z;  3EER A;  3NH5 A;  1R9T I;  3JAM b;  4E2W A;  3CCM 1;  4E2Z A;  3J80 f;  4A3F I;  5FLM I;  2PMZ A;  3VTN A;  5A2Q b;  1VQ4 1;  1VQN Z;  1VQK 1;  3GTQ I;  3PO2 I;  3TDH B;  2QA4 Z;  2YAD A;  1VLA A;  3CCL 1;  3TE5 B;  1VQ7 Z;  3S17 I;  5T64 A;  1VQL 1;  3G4S Z;  4BBR I;  1VQ9 Z;  3S1N I;  4BXX I;  2G2K A;  3BG1 B;  2QR1 B;  1ZH1 A;  4MON A;  2VUM I;  1Q86 2;  1VQ5 Z;  4NBB A;  3H0G I;  1P9N A;  3I55 1;  3CPW Z;  3OW2 Y;  3IX0 A;  3GTM I;  3CCL Z;  2I3C A;  3U50 C;  4Y7N I;  2QKD A;  1VQ8 Z;  1TWA I;  1ZB9 A;  1VQL Z;  1JJ2 Y;  1I6H I;  4MD9 A;  4HGY A;  3CCR 1;  3CMA 1;  4HGZ A;  5C3E I;  2Q4Z A;  4AYB A;  4S1T A;  2K5R A;  4NB9 A;  3GTK I;  1YIJ 1;  3IFU A;  3S1M I;  2DE6 A;  3I55 Z;  2OTJ Z;  1NJI 1;  3CXC Y;  2K3R A;  2R7Z I;  3EED A;  2JA6 I;  2QEX 1;  5D1O A;  3JAM f;  2RPR A;  3J81 b;  3CMA Z;  2F4O A;  2RT9 A;  1YHQ Z;  4BBS I;  3IF8 A;  1YIJ Z;  3K7A I;  3G6E 1;  3FQM A;  1L1O C;  1USP B;  3CD6 1;  3P5J B;  3VMH A;  4E32 A;  5C44 I;  1Z03 A;  2M6N A;  1RO2 A;  1Q81 1;  3CXC Z;  1VQM 1;  2V8J A;  3CC7 1;  4E30 A;  4MH4 A;  1M1K 1;  3S1Q I;  2E9H A;  3RZO I;  3LUS A;  3D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...