1N8R2

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r200
3CMA1 3G6E1 1Q812 1YIJ1 3CD61 3CC71 3CCSZ 3CCQ1 1VQPZ 1S72Z 1K9M2 3G4SZ 3CXCY 1M901 1KQSZ 3CCRZ 1W2BZ 1VQ5Z 1K8A1 3CCUZ 3OW2Y 1VQ7Z 1M902 1VQK1 3CCJZ 3CCVZ 1VQ6Z 3CC41 1VQ41 1YIT1 1YHQZ 1YJNZ 3CCE1 1K8A2 2OTJ1 1VQMZ 3CMEZ 1YJWZ 3CCS1 1VQLZ 1YI2Z 1VQP1 3I55Z 1QVGY 1S721 3G4S1 1QVFZ 1JJ2Y 3CPWY 3CCR1 1K732 1VQ9Z 1Q861 2OTLZ 3CC2Z 1N8R2 1VQ51 1YJ9Z 3CXCZ 1VQ8Z 3CCU1 1VQ71 3CCJ1 3I56Z 2QEXZ 3CCMZ 3CCV1 2QA4Z 1VQNZ 1VQOZ 1VQ61 3CCLZ 1Q862 1K731 3OW2Z 1YHQ1 1M1K2 1YJN1 3CMAZ 3G6EZ 1KQSY 1N8R1 1YIJZ 3CD6Z 1W2BY 3CC7Z 1Q821 3CCQZ 1VQM1 3CME1 1YJW1 1VQL1 1YI21 3I551 1KD11 1NJI1 1KC81 1M1K1 1VQ91 1Q822 1Q7Y2 2OTL1 3CC21 1QVGZ 1KD12 1VQKZ 1NJI2 1YJ91 1JJ2Z 3CPWZ 1VQ81 3CC4Z 1Q811 3I561 3G71Z 2QEX1 3CCM1 2QA41 1KC82 1VQO1 1VQN1 3CCL1 1VQ4Z 1YITZ 1K9M1 3CCEZ 2OTJZ 1Q7Y1 3G711 1QVFY
chains in the Genus database with same CATH superfamily
1RLYA 1TWGI 3MZKB 3CCSZ 1RO2A 3FKII 2E2HI 2E7ZA 1FDIA 4MXUA 2JIMA 2B63I 1K9M2 2R92I 2P28A 3CXCY 3CCRZ 3IX0A 2V45A 1W2BZ 3T4NB 3F3FC 1X3ZA 3U50C 4A3GI 2JR6A 5T6BA 1K8A1 3CCVZ 2K5RA 1WZNA 1VQ41 4NBFA 2LEXA 1YJNZ 1K8A2 3JAMb 3QWUA 4E30A 2Q51A 4A3KI 3GTJI 3HOVI 1WJ2A 3IFUA 3NFZA 3CCS1 2DE6A 1VQLZ 2NVQI 5T64A 2NVYI 1QVFZ 3CPWY 2LIYA 2JA7I 3CCR1 2BJOA 1VQ9Z 3S2DI 4A3EI 5C44I 4E31A 1Q861 2JIOA 3D6WA 2OTLZ 3BG0B 3CXCZ 3J7A4 1VQNZ 3CCV1 4Y52I 3CCLZ 2HF1A 1Q862 5IP9I 2Q4ZA 3IF8A 3J81b 4A3II 1YJN1 3JAMf 3G6EZ 3CD6Z 4A3BI 2GTIA 3CC7Z 4RVDA 1VQL1 3FQMA 1USPB 3VTNA 3PO2I 1N2FA 1NJI1 1X3WA 1RQFA 1SFOI 1TWAI 1Z01A 1M1K1 1VQ91 1NUIA 3PO3S 1Q7Y2 3Q87A 4MONA 2OTL1 1NJI2 3CPWZ 3FQQA 1Q811 3G71Z 1VQN1 2ZAEB 1Z02A 3CCL1 3S1QI 2YU9I 2AYDA 1ZB9A 1QF8A 4HGYA 1YITZ 3CCEZ 3GTQI 1WIIA 3G6E1 1Q812 2E9HA 2J6AA 3CD61 3J80b 3CC71 3GTLI 1VQPZ 1YUAA 4EWCA 3G4SZ 3NH8A 2VPYA 4NBEA 4TNUA 1M901 3D2LA 4BXXI 3I4NI 3CQZI 1YUKA 1WW9A 1Y1VS 1M902 3VB9A 3NDJA 2JA6I 2VUGA 3TDHB 3S14I 3EEDA 1Q16A 1YIT1 3CCE1 4A3LI 2KPIA 2GU2A 2O4HA 3J80f 3CMEZ 2VPZA 2AKLA 1VQP1 2JS4A 1QVGY 3G4S1 1TWHI 1K732 2RHBA 2I3CA 2JNYA 3GTOI 4NOZA 4NBAA 4RV9A 2QEXZ 3CCMZ 2QA4Z 1FDOA 1VQOZ 4MH4A 3KIFA 2GTHA 2RBLA 4NH1C 3CMAZ 1KQSY 2P3YA 2V8IA 1YIJZ 5IT9f 2KI7B 5A2Qb 1ZB8A 3CCQZ 3S2HI 3CME1 1I6HI 3MONA 2R6MA 5D1OA 1KD11 2JA8I 4XX2A 2NVXI 4QTTA 3I07A 2QR1B 4NBBA 1KRLA 1I50I 1QVFY 1QVGZ 4BY1I 3GKQA 1KD12 1VQKZ 5C3EI 2WB1A 3CC4Z 3CCM1 2QEX1 1Y1VI 2W03A 2QA41 3S15I 1VQO1 3RZDI 4NB8A 1Q7Y1 2QRCB 3CMA1 1YIJ1 1DL6A 3HOXI 5A2Qf 3GTMS 4A93I 3CCQ1 4BBRI 1PFTA 5D1PA 1KQSZ 2RIQA 2O53A 2E2JI 1ML8A 3HOWI 3F3PC 4AYBA 4CL1A 1VQ5Z 2OZKA 4E2WA 2M6NA 1WCMI 1VLAA 3CCUZ 3LUSA 3OW2Y 1VQ7Z 4HGZA 3CCJZ 1VQK1 1USPA 3CC41 3VMGA 2IZ3A 1R9TI 1RO4A 4A3CI 1SIWA 4NBDA 2Y0SA 4A3JI 2DE5A 1YI2Z 1JWHC 2K3RA 4A3MI 5T67A 1AA6A 1JJ2Y 4RS4A 3NH5A 4RVGA 1N8R2 1VQ51 1S7MA 1YJ9Z 3D9XA 1VQ8Z 3CCU1 1VQ71 3CCJ1 1TWCI 4E2XA 3GCFA 1K731 5IT9b 2VUMI 3OW2Z 4MD8A 4DK1A 2IV2X 2OOXB 2QREB 3NDIA 4E2YA 2F4OA 1YI21 3GTMI 5FLXf 3S1RI 4RVFA 4Y7NI 3S1MI 4QTUA 2QRDB 3MZLB 1KC81 3PO3I 1TWFI 4A3DI 2VF1A 4BBSI 3H0GI 5CM2M 1YJ91 1JJ2Z 1VQ81 2IZ4A 2VPWA 4DGLA 1Z03A 2WAQA 1KC82 3NH4A 1RNIA 3GTKI 3GTPI 3S16I 4HH4A 2OTJZ 3RZOI 5D1OB 1K83I 4A3FI 2RPRA 4MD7A 1S72Z 4E2ZA 2EGTA 1LQLA 2NVTI 3BG1B 1P9NA 2HU9A 2H85A 4E33A 1ZH1A 2PMZA 3S1NI 3VMIA 3I4MI 1QYPA 1VQ6Z 3TE5B 3H3VJ 3M4OI 1NP6A 1TFIA 3HOYI 2G2KA 1YHQZ 2QLVB 5LL6f 2OTJ1 2V3VA 2JA5I 2M48A 4NBCA 2NAPA 4NBGA 4E32A 2E2II 1VQMZ 3VMHA 1YJWZ 3I55Z 1S721 5C4JI 2F4MA 5FLMI 5AN9F 2OOYB 5IP7I 4DQYB 1L1OC 4RVHA 1X0TA 3CC2Z 5C4XI 3HKZA 3M3YI 2W04A 3I56Z 1VQ61 3ESWA 3HOZI 3HOUI 2PK7A 2QKDA 4X6AI 2R93I 1M1K2 1YHQ1 1N8R1 3EERA 5FLXb 3KIHA 2JMOA 1W2BY 1RO0A 1Q821 1QXFA 3J81f 1VQM1 1YJW1 4MRIA 4MD9A 3I551 2JIPA 4NBHA 2R7ZI 1Q822 1Y8CA 4BY7I 2LFUA 3P5JB 2JUBA 3CC21 2YADA 1I3QI 3S17I 3K7AI 2JIRA 2VPXA 3GTGI 2V8JA 3I561 4NB9A 2DE7A 2RT9A 2V8KA 4NFRA 1Y1WI 1VQ4Z 3IR7A 2JIQA 1K9M1 4S1TA 3G711 2PM9A
chains in the Genus database with same CATH topology
1RLYA 1TWGI 3MZKB 3CCSZ 1RO2A 3FKII 2E2HI 4MXUA 2B63I 1K9M2 2R92I 2P28A 3CXCY 3CCRZ 3IX0A 1W2BZ 3T4NB 3F3FC 1X3ZA 3U50C 4A3GI 2JR6A 5T6BA 1K8A1 3CCVZ 2K5RA 1VQ41 4NBFA 1YJNZ 1K8A2 3JAMb 3QWUA 4E30A 2Q51A 4A3KI 3GTJI 3HOVI 3IFUA 3NFZA 3CCS1 2DE6A 1VQLZ 2NVQI 5T64A 2NVYI 1QVFZ 3CPWY 2LIYA 2JA7I 3CCR1 2BJOA 1VQ9Z 3S2DI 4A3EI 5C44I 4E31A 1Q861 3D6WA 2OTLZ 3BG0B 3CXCZ 3J7A4 1VQNZ 3CCV1 4Y52I 3CCLZ 2HF1A 1Q862 5IP9I 2Q4ZA 3IF8A 3J81b 4A3II 1YJN1 3JAMf 3G6EZ 3CD6Z 4A3BI 2GTIA 3CC7Z 4RVDA 1VQL1 3FQMA 1USPB 3VTNA 3PO2I 1N2FA 1NJI1 1X3WA 1RQFA 1SFOI 1TWAI 1Z01A 1M1K1 1VQ91 1NUIA 3PO3S 1Q7Y2 3Q87A 4MONA 2OTL1 1NJI2 3CPWZ 3FQQA 1Q811 3G71Z 1VQN1 2ZAEB 1Z02A 3CCL1 3S1QI 2YU9I 1ZB9A 1QF8A 4HGYA 1YITZ 3CCEZ 3GTQI 1WIIA 3G6E1 1Q812 2E9HA 2J6AA 3CD61 3J80b 3CC71 3GTLI 1VQPZ 1YUAA 4EWCA 3G4SZ 3NH8A 4NBEA 4TNUA 1M901 4BXXI 3I4NI 3CQZI 1YUKA 1WW9A 1Y1VS 1M902 3VB9A 3NDJA 2JA6I 2VUGA 3TDHB 3S14I 3EEDA 1YIT1 3CCE1 4A3LI 2KPIA 2GU2A 2O4HA 3J80f 3CMEZ 2AKLA 1VQP1 2JS4A 1QVGY 3G4S1 1TWHI 1K732 2RHBA 2I3CA 2JNYA 3GTOI 4NOZA 4NBAA 4RV9A 2QEXZ 3CCMZ 2QA4Z 1VQOZ 4MH4A 3KIFA 2GTHA 2RBLA 4NH1C 3CMAZ 1KQSY 2P3YA 2V8IA 1YIJZ 5IT9f 2KI7B 5A2Qb 1ZB8A 3CCQZ 3S2HI 3CME1 1I6HI 3MONA 2R6MA 5D1OA 1KD11 2JA8I 4XX2A 2NVXI 4QTTA 3I07A 2QR1B 4NBBA 1KRLA 1I50I 1QVFY 1QVGZ 4BY1I 3GKQA 1KD12 1VQKZ 5C3EI 2WB1A 3CC4Z 3CCM1 2QEX1 1Y1VI 2W03A 2QA41 3S15I 1VQO1 3RZDI 4NB8A 1Q7Y1 2QRCB 3CMA1 1YIJ1 1DL6A 3HOXI 5A2Qf 3GTMS 4A93I 3CCQ1 4BBRI 1PFTA 5D1PA 1KQSZ 2RIQA 2O53A 2E2JI 1ML8A 3HOWI 3F3PC 4AYBA 4CL1A 1VQ5Z 2OZKA 4E2WA 2M6NA 1WCMI 1VLAA 3CCUZ 3LUSA 3OW2Y 1VQ7Z 4HGZA 3CCJZ 1VQK1 1USPA 3CC41 3VMGA 2IZ3A 1R9TI 1RO4A 4A3CI 4NBDA 2Y0SA 4A3JI 2DE5A 1YI2Z 1JWHC 2K3RA 4A3MI 5T67A 1JJ2Y 4RS4A 3NH5A 4RVGA 1N8R2 1VQ51 1S7MA 1YJ9Z 3D9XA 1VQ8Z 3CCU1 1VQ71 3CCJ1 1TWCI 4E2XA 3GCFA 1K731 5IT9b 2VUMI 3OW2Z 4MD8A 4DK1A 2OOXB 2QREB 3NDIA 4E2YA 2F4OA 1YI21 3GTMI 5FLXf 3S1RI 4RVFA 4Y7NI 3S1MI 4QTUA 2QRDB 3MZLB 1KC81 3PO3I 1TWFI 4A3DI 2VF1A 4BBSI 3H0GI 5CM2M 1YJ91 1JJ2Z 1VQ81 2IZ4A 4DGLA 1Z03A 2WAQA 1KC82 3NH4A 1RNIA 3GTKI 3GTPI 3S16I 4HH4A 2OTJZ 3RZOI 5D1OB 1K83I 4A3FI 2RPRA 4MD7A 1S72Z 4E2ZA 2EGTA 1LQLA 2NVTI 3BG1B 1P9NA 2HU9A 2H85A 4E33A 1ZH1A 2PMZA 3S1NI 3VMIA 3I4MI 1QYPA 1VQ6Z 3TE5B 3H3VJ 3M4OI 1NP6A 1TFIA 3HOYI 2G2KA 1YHQZ 2QLVB 5LL6f 2OTJ1 2JA5I 2M48A 4NBCA 4NBGA 4E32A 2E2II 1VQMZ 3VMHA 1YJWZ 3I55Z 1S721 5C4JI 2F4MA 5FLMI 5AN9F 2OOYB 5IP7I 4DQYB 1L1OC 4RVHA 1X0TA 3CC2Z 5C4XI 3HKZA 3M3YI 2W04A 3I56Z 1VQ61 3ESWA 3HOZI 3HOUI 2PK7A 2QKDA 4X6AI 2R93I 1M1K2 1YHQ1 1N8R1 3EERA 5FLXb 3KIHA 2JMOA 1W2BY 1RO0A 1Q821 3J81f 1VQM1 1YJW1 4MRIA 4MD9A 3I551 4NBHA 2R7ZI 1Q822 4BY7I 2LFUA 3P5JB 2JUBA 3CC21 2YADA 1I3QI 3S17I 3K7AI 3GTGI 2V8JA 3I561 4NB9A 2DE7A 2RT9A 2V8KA 4NFRA 1Y1WI 1VQ4Z 1K9M1 4S1TA 3G711 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA 1;  3G6E 1;  1Q81 2;  1YIJ 1;  3CD6 1;  3CC7 1;  3CCS Z;  3CCQ 1;  1VQP Z;  1S72 Z;  1K9M 2;  3G4S Z;  3CXC Y;  1M90 1;  1KQS Z;  3CCR Z;  1W2B Z;  1VQ5 Z;  1K8A 1;  3CCU Z;  3OW2 Y;  1VQ7 Z;  1M90 2;  1VQK 1;  3CCJ Z;  3CCV Z;  1VQ6 Z;  3CC4 1;  1VQ4 1;  1YIT 1;  1YHQ Z;  1YJN Z;  3CCE 1;  1K8A 2;  2OTJ 1;  1VQM Z;  3CME Z;  1YJW Z;  3CCS 1;  1VQL Z;  1YI2 Z;  1VQP 1;  3I55 Z;  1QVG Y;  1S72 1;  3G4S 1;  1QVF Z;  1JJ2 Y;  3CPW Y;  3CCR 1;  1K73 2;  1VQ9 Z;  1Q86 1;  2OTL Z;  3CC2 Z;  1N8R 2;  1VQ5 1;  1YJ9 Z;  3CXC Z;  1VQ8 Z;  3CCU 1;  1VQ7 1;  3CCJ 1;  3I56 Z;  2QEX Z;  3CCM Z;  3CCV 1;  2QA4 Z;  1VQN Z;  1VQO Z;  1VQ6 1;  3CCL Z;  1Q86 2;  1K73 1;  3OW2 Z;  1YHQ 1;  1M1K 2;  1YJN 1;  3CMA Z;  3G6E Z;  1KQS Y;  1N8R 1;  1YIJ Z;  3CD6 Z;  1W2B Y;  3CC7 Z;  1Q82 1;  3CCQ Z;  1VQM 1;  3CME 1;  1YJW 1;  1VQL 1;  1YI2 1;  3I55 1;  1KD1 1;  1NJI 1;  1KC8 1;  1M1K 1;  1VQ9 1;  1Q82 2;  1Q7Y 2;  2OTL 1;  3CC2 1;  1QVG Z;  1KD1 2;  1VQK Z;  1NJI 2;  1YJ9 1;  1JJ2 Z;  3CPW Z;  1VQ8 1;  3CC4 Z;  1Q81 1;  3I56 1;  3G71 Z;  2QEX 1;  3CCM 1;  2QA4 1;  1KC8 2;  1VQO 1;  1VQN 1;  3CCL 1;  1VQ4 Z;  1YIT Z;  1K9M 1;  3CCE Z;  2OTJ Z;  1Q7Y 1;  3G71 1;  1QVF Y; 
#chains in the Genus database with same CATH topology
 1RLY A;  1TWG I;  3MZK B;  3CCS Z;  1RO2 A;  3FKI I;  2E2H I;  2E7Z A;  1FDI A;  4MXU A;  2JIM A;  2B63 I;  1K9M 2;  2R92 I;  2P28 A;  3CXC Y;  3CCR Z;  3IX0 A;  2V45 A;  1W2B Z;  3T4N B;  3F3F C;  1X3Z A;  3U50 C;  4A3G I;  2JR6 A;  5T6B A;  1K8A 1;  3CCV Z;  2K5R A;  1WZN A;  1VQ4 1;  4NBF A;  2LEX A;  1YJN Z;  1K8A 2;  3JAM b;  3QWU A;  4E30 A;  2Q51 A;  4A3K I;  3GTJ I;  3HOV I;  1WJ2 A;  3IFU A;  3NFZ A;  3CCS 1;  2DE6 A;  1VQL Z;  2NVQ I;  5T64 A;  2NVY I;  1QVF Z;  3CPW Y;  2LIY A;  2JA7 I;  3CCR 1;  2BJO A;  1VQ9 Z;  3S2D I;  4A3E I;  5C44 I;  4E31 A;  1Q86 1;  2JIO A;  3D6W A;  2OTL Z;  3BG0 B;  3CXC Z;  3J7A 4;  1VQN Z;  3CCV 1;  4Y52 I;  3CCL Z;  2HF1 A;  1Q86 2;  5IP9 I;  2Q4Z A;  3IF8 A;  3J81 b;  4A3I I;  1YJN 1;  3JAM f;  3G6E Z;  3CD6 Z;  4A3B I;  2GTI A;  3CC7 Z;  4RVD A;  1VQL 1;  3FQM A;  1USP B;  3VTN A;  3PO2 I;  1N2F A;  1NJI 1;  1X3W A;  1RQF A;  1SFO I;  1TWA I;  1Z01 A;  1M1K 1;  1VQ9 1;  1NUI A;  3PO3 S;  1Q7Y 2;  3Q87 A;  4MON A;  2OTL 1;  1NJI 2;  3CPW Z;  3FQQ A;  1Q81 1;  3G71 Z;  1VQN 1;  2ZAE B;  1Z02 A;  3CCL 1;  3S1Q I;  2YU9 I;  2AYD A;  1ZB9 A;  1QF8 A;  4HGY A;  1YIT Z;  3CCE Z;  3GTQ I;  1WII A;  3G6E 1;  1Q81 2;  2E9H A;  2J6A A;  3CD6 1;  3J80 b;  3CC7 1;  3GTL I;  1VQP Z;  1YUA A;  4EWC A;  3G4S Z;  3NH8 A;  2VPY A;  4NBE A;  4TNU A;  1M90 1;  3D2L A;  4BXX I;  3I4N I;  3CQZ I;  1YUK A;  1WW9 A;  1Y1V S;  1M90 2;  3VB9 A;  3NDJ A;  2JA6 I;  2VUG A;  3TDH B;  3S14 I;  3EED A;  1Q16 A;  1YIT 1;  3CCE 1;  4A3L I;  2KPI A;  2GU2 A;  2O4H A;  3J80 f;  3CME Z;  2VPZ A;  2AKL A;  1VQP 1;  2JS4 A;  1QVG Y;  3G4S 1;  1TWH I;  1K73 2;  2RHB A;  2I3C A;  2JNY A;  3GTO I;  4NOZ A;  4NBA A;  4RV9 A;  2QEX Z;  3CCM Z;  2QA4 Z;  1FDO A;  1VQO Z;  4MH4 A;  3KIF A;  2GTH A;  2RBL A;  4NH1 C;  3CMA Z;  1KQS Y;  2P3Y A;  2V8I A;  1YIJ Z;  5IT9 f;  2KI7 B;  5A2Q b;  1ZB8 A;  3CCQ Z;  3S2H I;  3CME 1;  1I6H I;  3MON A;  2R6M A;  5D1O A;  1KD1 1;  2JA8 I;  4XX2 A;  2NVX I;  4QTT A;  3I07 A;  2QR1 B;  4NBB A;  1KRL A;  1I50 I;  1QVF Y;  1QVG Z;  4BY1 I;  3GKQ A;  1KD1 2;  1VQK Z;  5C3E I;  2WB1 A;  3CC4 Z;  3CCM 1;  2QEX 1;  1Y1V I;  2W03 A;  2QA4 1;  3S15 I;  1VQO 1;  3RZD I;  4NB8 A;  1Q7Y 1;  2QRC B;  3CMA 1;  1YIJ 1;  1DL6 A;  3HOX I;  5A2Q f;  3GTM S;  4A93 I;  3CCQ 1;  4BBR I;  1PFT A;  5D1P A;  1KQS Z;  2RIQ A;  2O53 A;  2E2J I;  1ML8 A;  3HOW I;  3F3P C;  4AYB A;  4CL1 A;  1VQ5 Z;  2OZK A;  4E2W A;  2M6N A;  1WCM I;  1VLA A;  3CCU Z;  3LUS A;  3OW2 Y;  1VQ7 Z;  4HGZ A;  3CCJ Z;  1VQK 1;  1USP A;  3CC4 1;  3VMG A;  2IZ3 A;  1R9T I;  1RO4 A;  4A3C I;  1SIW A;  4NBD A;  2Y0S A;  4A3J I;  2DE5 A;  1YI2 Z;  1JWH C;  2K3R A;  4A3M I;  5T67 A;  1AA6 A;  1JJ2 Y;  4RS4 A;  3NH5 A;  4RVG A;  1N8R 2;  1VQ5 1;  1S7M A;  1YJ9 Z;  3D9X A;  1VQ8 Z;  3CCU 1;  1VQ7 1;  3CCJ 1;  1TWC I;  4E2X A;  3GCF A;  1K73 1;  5IT9 b;  2VUM I;  3OW2 Z;  4MD8 A;  4DK1 A;  2IV2 X;  2OOX B;  2QRE B;  3NDI A;  4E2Y A;  2F4O A;  1YI2 1;  3GTM I;  5FLX f;  3S1R I;  4RVF A;  4Y7N I;  3S1M I;  4QTU A;  2QRD B;  3MZL B;  1KC8 1;  3PO3 I;  1TWF I;  4A3D I;  2VF1 A;  4BBS I;  3H0G I;  5CM2 M;  1YJ9 1;  1JJ2 Z;  1VQ8 1;  2IZ4 A;  2VPW A;  4DGL A;  1Z03 A;  2WAQ A;  1KC8 2;  3NH4 A;  1RNI A;  3GTK I;  3GTP I;  3S16 I;  4HH4 A;  2OTJ Z;  3RZO I;  5D1O B;  1K83 I;  4A3F I;  2RPR A;  4MD7 A;  1S72 Z;  4E2Z A;  2EGT A;  1LQL A;  2NVT I;  3BG1 B;  1P9N A;  2HU9 A;  2H85 A;  4E33 A;  1ZH1 A;  2PMZ A;  3S1N I;  3VMI A;  3I4M I;  1QYP A;  1VQ6 Z;  3TE5 B;  3H3V J;  3M4O I;  1NP6 A;  1TFI A;  3HOY I;  2G2K A;  1YHQ Z;  2QLV B;  5LL6 f;  2OTJ 1;  2V3V A;  2JA5 I;  2M48 A;  4NBC A;  2NAP A;  4NBG A;  4E32 A;  2E2I I;  1VQM Z;  3VMH A;  1YJW Z;  3I55 Z;  1S72 1;  5C4J I;  2F4M A;  5FLM I;  5AN9 F;  2OOY B;  5IP7 I;  4DQY B;  1L1O C;  4RVH A;  1X0T A;  3CC2 Z;  5C4X I;  3HKZ A;  3M3Y I;  2W04 A;  3I56 Z;  1VQ6 1;  3ESW A;  3HOZ I;  3HOU I;  2PK7 A;  2QKD A;  4X6A I;  2R93 I;  1M1K 2;  1YHQ 1;  1N8R 1;  3EER A;  5FLX b;  3KIH A;  2JMO A;  1W2B Y;  1RO0 A;  1Q82 1;  1QXF A;  3J81 f;  1VQM 1;  1YJW 1;  4MRI A;  4MD9 A;  3I55 1;  2JIP A;  4NBH A;  2R7Z I;  1Q82 2;  1Y8C A;  4BY7 I;  2LFU A;  3P5J B;  2JUB A;  3CC2 1;  2YAD A;  1I3Q I;  3S17 I;  3K7A I;  2JIR A;  2VPX A;  3GTG I;  2V8J A;  3I56 1;  4NB9 A;  2DE7 A;  2RT9 A;  2V8K A;  4NFR A;  1Y1W I;  1VQ4 Z;  3IR7 A;  2JIQ A;  1K9M 1;  4S1T A;  3G71 1;  2PM9 A; 
#chains in the Genus database with same CATH homology
 1RLY A;  1TWG I;  3MZK B;  3CCS Z;  1RO2 A;  3FKI I;  2E2H I;  4MXU A;  2B63 I;  1K9M 2;  2R92 I;  2P28 A;  3CXC Y;  3CCR Z;  3IX0 A;  1W2B Z;  3T4N B;  3F3F C;  1X3Z A;  3U50 C;  4A3G I;  2JR6 A;  5T6B A;  1K8A 1;  3CCV Z;  2K5R A;  1VQ4 1;  4NBF A;  1YJN Z;  1K8A 2;  3JAM b;  3QWU A;  4E30 A;  2Q51 A;  4A3K I;  3GTJ I;  3HOV I;  3IFU A;  3NFZ A;  3CCS 1;  2DE6 A;  1VQL Z;  2NVQ I;  5T64 A;  2NVY I;  1QVF Z;  3CPW Y;  2LIY A;  2JA7 I;  3CCR 1;  2BJO A;  1VQ9 Z;  3S2D I;  4A3E I;  5C44 I;  4E31 A;  1Q86 1;  3D6W A;  2OTL Z;  3BG0 B;  3CXC Z;  3J7A 4;  1VQN Z;  3CCV 1;  4Y52 I;  3CCL Z;  2HF1 A;  1Q86 2;  5IP9 I;  2Q4Z A;  3IF8 A;  3J81 b;  4A3I I;  1YJN 1;  3JAM f;  3G6E Z;  3CD6 Z;  4A3B I;  2GTI A;  3CC7 Z;  4RVD A;  1VQL 1;  3FQM A;  1USP B;  3VTN A;  3PO2 I;  1N2F A;  1NJI 1;  1X3W A;  1RQF A;  1SFO I;  1TWA I;  1Z01 A;  1M1K 1;  1VQ9 1;  1NUI A;  3PO3 S;  1Q7Y 2;  3Q87 A;  4MON A;  2OTL 1;  1NJI 2;  3CPW Z;  3FQQ A;  1Q81 1;  3G71 Z;  1VQN 1;  2ZAE B;  1Z02 A;  3CCL 1;  3S1Q I;  2YU9 I;  1ZB9 A;  1QF8 A;  4HGY A;  1YIT Z;  3CCE Z;  3GTQ I;  1WII A;  3G6E 1;  1Q81 2;  2E9H A;  2J6A A;  3CD6 1;  3J80 b;  3CC7 1;  3GTL I;  1VQP Z;  1YUA A;  4EWC A;  3G4S Z;  3NH8 A;  4NBE A;  4TNU A;  1M90 1;  4BXX I;  3I4N I;  3CQZ I;  1YUK A;  1WW9 A;  1Y1V S;  1M90 2;  3VB9 A;  3NDJ A;  2JA6 I;  2VUG A;  3TDH B;  3S14 I;  3EED A;  1YIT 1;  3CCE 1;  4A3L I;  2KPI A;  2GU2 A;  2O4H A;  3J80 f;  3CME Z;  2AKL A;  1VQP 1;  2JS4 A;  1QVG Y;  3G4S 1;  1TWH I;  1K73 2;  2RHB A;  2I3C A;  2JNY A;  3GTO I;  4NOZ A;  4NBA A;  4RV9 A;  2QEX Z;  3CCM Z;  2QA4 Z;  1VQO Z;  4MH4 A;  3KIF A;  2GTH A;  2RBL A;  4NH1 C;  3CMA Z;  1KQS Y;  2P3Y A;  2V8I A;  1YIJ Z;  5IT9 f;  2KI7 B;  5A2Q b;  1ZB8 A;  3CCQ Z;  3S2H I;  3CME 1;  1I6H I;  3MON A;  2R6M A;  5D1O A;  1KD1 1;  2JA8 I;  4XX2 A;  2NVX I;  4QTT A;  3I07 A;  2QR1 B;  4NBB A;  1KRL A;  1I50 I;  1QVF Y;  1QVG Z;  4BY1 I;  3GKQ A;  1KD1 2;  1VQK Z;  5C3E I;  2WB1 A;  3CC4 Z;  3CCM 1;  2QEX 1;  1Y1V I;  2W03 A;  2QA4 1;  3S15 I;  1VQO 1;  3RZD I;  4NB8 A;  1Q7Y 1;  2QRC B;  3CMA 1;  1YIJ 1;  1DL6 A;  3HOX I;  5A2Q f;  3GTM S;  4A93 I;  3CCQ 1;  4BBR I;  1PFT A;  5D1P A;  1KQS Z;  2RIQ A;  2O53 A;  2E2J I;  1ML8 A;  3HOW I;  3F3P C;  4AYB A;  4CL1 A;  1VQ5 Z;  2OZK A;  4E2W A;  2M6N A;  1WCM I;  1VLA A;  3CCU Z;  3LUS A;  3OW2 Y;  1VQ7 Z;  4HGZ A;  3CCJ Z;  1VQK 1;  1USP A;  3CC4 1;  3VMG A;  2IZ3 A;  1R9T I;  1RO4 A;  4A3C I;  4NBD A;  2Y0S A;  4A3J I;  2DE5 A;  1YI2 Z;  1JWH C;  2K3R A;  4A3M I;  5T67 A;  1JJ2 Y;  4RS4 A;  3NH5 A;  4RVG A;  1N8R 2;  1VQ5 1;  1S7M A;  1YJ9 Z;  3D9X A;  1VQ8 Z;  3CCU 1;  1VQ7 1;  3CCJ 1;  1TWC I;  4E2X A;  3GCF A;  1K73 1;  5IT9 b;  2VUM I;  3OW2 Z;  4MD8 A;  4DK1 A;  2OOX B;  2QRE B;  3NDI A;  4E2Y A;  2F4O A;  1YI2 1;  3GTM I;  5FLX f;  3S1R I;  4RVF A;  4Y7N I;  3S1M I;  4QTU A;  2QRD B;  3MZL B;  1KC8 1;  3PO3 I;  1TWF I;  4A3D I;  2VF1 A;  4BBS I;  3H0G I;  5CM2 M;  1YJ9 1;  1JJ2 Z;  1VQ8 1;  2IZ4 A;  4DGL A;  1Z03 A;  2WAQ A;  1KC8 2;  3NH4 A;  1RNI A;  3GTK I;  3GTP I;  3S16 I;  4HH4 A;  2OTJ Z;  3RZO I;  5D1O B;  1K83 I;  4A3F I;  2RPR A;  4MD7 A;  1S72 Z;  4E2Z A;  2EGT A;  1LQL A;  2NVT I;  3BG1 B;  1P9N A;  2HU9 A;  2H85 A;  4E33 A;  1ZH1 A;  2PMZ A;  3S1N I;  3VMI A;  3I4M I;  1QYP A;  1VQ6 Z;  3TE5 B;  3H3V J;  3M4O I;  1NP6 A;  1TFI A;  3HOY I;  2G2K A;  1YHQ Z;  2QLV B;  5LL6 f;  2OTJ 1;  2JA5 I;  2M48 A;  4NBC A;  4NBG A;  4E32 A;  2E2I I;  1VQM Z;  3VMH A;  1YJW Z;  3I55 Z;  1S72 1;  5C4J I;  2F4M A;  5FLM I;  5AN9 F;  2OOY B;  5IP7 I;  4DQY B;  1L1O C;  4RVH A;  1X0T A;  3CC2 Z;  5C4X I;  3HKZ A;  3M3Y I;  2W04 A;  3I56 Z;  1VQ6 1;  3ESW A;  3HOZ I;  3HOU I;  2PK7 A;  2QKD A;  4X6A I;  2R93 I;  1M1K 2;  1YHQ 1;  1N8R 1;  3EER A;  5FLX b;  3KIH A;  2JMO A;  1W2B Y;  1RO0 A;  1Q82 1;  3J81 f;  1VQM 1;  1YJW 1;  4MRI A;  4MD9 A;  3I55 1;  4NBH A;  2R7Z I;  1Q82 2;  4BY7 I;  2LFU A;  3P5J B;  2JUB A;  3CC2 1;  2YAD A;  1I3Q I;  3S17 I;  3K7A I;  3GTG I;  2V8J A;  3I56 1;  4NB9 A;  2DE7 A;  2RT9 A;  2V8K A;  4NFR A;  1Y1W I;  1VQ4 Z;  1K9M 1;  4S1T A;  3G71 1;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...