1N8R2

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r200
1QVGZ 3CPWZ 1N8R2 1VQN1 3OW2Y 3G4S1 3CCJ1 1VQ81 1VQ91 1NJI2 1Q861 2QEXZ 3CD6Z 1Q811 1KD11 1YJN1 2QA4Z 1Q862 3G6EZ 1VQ71 3CCVZ 1KD12 3CCJZ 1VQ4Z 1S721 1YI21 3CC71 1K9M1 3CCRZ 1YHQZ 1VQ5Z 3CC41 1KQSY 1K9M2 3CCQ1 2OTJ1 3CCE1 1K731 3CCS1 1QVFZ 1YIJ1 3CCLZ 2OTL1 3CMEZ 3CCU1 1QVGY 1K732 3CPWY 1YJ9Z 3CC4Z 1VQ61 3G711 1YIT1 1VQM1 1Q812 2OTLZ 1YJW1 3I551 1VQNZ 3G4SZ 1VQ8Z 1VQ9Z 1VQP1 3CMA1 1K8A1 1YJNZ 1VQMZ 1JJ2Z 1VQ7Z 1VQO1 1K8A2 3I55Z 1S72Z 1YI2Z 1VQL1 3CC7Z 1QVFY 3CMAZ 3CC21 3CCQZ 2OTJZ 1VQOZ 3CCEZ 3CCSZ 1YIJZ 3CCUZ 1W2BZ 1Q821 3CD61 3I561 3CCM1 1VQ6Z 3G71Z 1M901 1VQK1 2QA41 1YITZ 3OW2Z 3G6E1 1Q822 3CCV1 1M902 1VQ41 1YJWZ 1M1K1 1JJ2Y 3I56Z 3CCMZ 3CCR1 1VQ51 1YHQ1 3CXCZ 1VQKZ 1Q7Y1 1VQPZ 1M1K2 3CXCY 1Q7Y2 3CCL1 1KQSZ 1KC81 3CME1 1VQLZ 1YJ91 2QEX1 1N8R1 3CC2Z 1KC82 1W2BY 1NJI1
chains in the Genus database with same CATH superfamily
2M48A 3J81f 3OW2Y 3G4S1 3CCJ1 3GTLI 1VQ81 3D2LA 1Q861 2QEXZ 3CD6Z 1Z01A 1ZB9A 2JA5I 5LL6f 2NVXI 3IX0A 3F3PC 1R9TI 4A93I 4E31A 3TE5B 3CCRZ 3Q87A 3FKII 2R93I 3NFZA 2AKLA 3H3VJ 4A3CI 3NH5A 2JIRA 2JS4A 4RV9A 1QVGY 2P28A 5C3EI 4DK1A 1YJ9Z 3CC4Z 3CPWY 3G711 2V8KA 4NOZA 3CQZI 1NUIA 4NBFA 2HF1A 4E2XA 2JA8I 2QKDA 1YJNZ 2E9HA 2J6AA 2G2KA 1LQLA 1Z03A 1S72Z 2YADA 4E30A 3CMAZ 2O53A 3CC21 3VMIA 3K7AI 1NP6A 4MONA 5C4XI 2NAPA 3HOUI 1USPA 2PM9A 3HKZA 4E33A 3CD61 3I561 3BG0B 2DE5A 2PMZA 1WZNA 1Q822 3I07A 1JWHC 4MD7A 4X6AI 4AYBA 1YJWZ 4E2WA 1JJ2Y 3CCR1 1K83I 1ZH1A 3GTJI 1TFIA 4A3JI 3ESWA 4NBDA 1KQSZ 3S17I 4BY1I 5T64A 1YJ91 1X3ZA 4A3EI 1FDIA 4QTTA 1Y1VI 2KI7B 3GTGI 1TWHI 5IT9f 5D1OA 3IFUA 1YJN1 2QA4Z 3PO3I 1X0TA 3G6EZ 1KD12 4A3MI 1S721 3J80b 2E2HI 1Z02A 3RZDI 5FLXb 1YHQZ 3LUSA 2E7ZA 4DQYB 2YU9I 2RIQA 1QVFZ 2GU2A 2OTL1 3CMEZ 3T4NB 2RPRA 3HOYI 2I3CA 4A3GI 2GTHA 2QREB 4DGLA 2VPZA 1RQFA 4QTUA 4HGZA 1VQM1 1DL6A 3M3YI 2VPYA 1YJW1 1QF8A 4NBEA 3I551 3MONA 2WAQA 1VQNZ 5A2Qb 4BXXI 3MZKB 3I4NI 1RO4A 2AYDA 2BJOA 1VQO1 5IP7I 1K8A2 3S1NI 2V45A 3S1MI 3CC7Z 3EERA 3JAMf 1I6HI 4BY7I 3CCQZ 3CCEZ 4Y52I 3CCSZ 1YIJZ 2W04A 1S7MA 2Q51A 2P3YA 1Q821 3CCM1 1VQ6Z 2JIPA 1TWFI 2QA41 1YITZ 3G6E1 3NDIA 1N2FA 2F4OA 4CL1A 1PFTA 4NB8A 1YHQ1 3CXCZ 1VQKZ 1VQPZ 2W03A 3CXCY 3J81b 4MXUA 2LFUA 2JA6I 1Q7Y2 4A3DI 3CME1 4EWCA 2HU9A 5CM2M 2QEX1 4MRIA 1WCMI 3S1QI 1YUAA 4HH4A 2V3VA 3QWUA 4XX2A 2K3RA 1VQN1 3HOZI 1USPB 2QRCB 3S2DI 1Q811 5FLXf 3HOXI 1KD11 4RVHA 3P5JB 3IF8A 2JMOA 2Y0SA 3CCJZ 3I4MI 1RNIA 3CC71 4RVFA 1SIWA 2DE6A 2JIQA 3CC41 1WJ2A 1KQSY 2KPIA 1RO2A 4NBAA 2JUBA 1K9M2 3CCQ1 4RVDA 3CCE1 3CCS1 2NVTI 1YIJ1 1SFOI 3GTMI 1K732 1VQ61 3S15I 2RBLA 1YIT1 3S16I 2ZAEB 1Y8CA 4NH1C 4A3KI 1Q812 1QXFA 4NFRA 4RS4A 4NBCA 1VQ9Z 5AN9F 2PK7A 1VQP1 3CMA1 4RVGA 1K8A1 4A3BI 2VUGA 2VPWA 1Y1VS 1VLAA 5D1OB 5T67A 1VQ7Z 1X3WA 5D1PA 2R92I 2R6MA 3VMGA 1YI2Z 3GTMS 1QVFY 2IZ3A 3S1RI 3S14I 4Y7NI 5T6BA 2OTJZ 3PO3S 4MH4A 2B63I 1TWCI 3CCUZ 3RZOI 1W2BZ 3H0GI 4A3FI 4MD8A 5IP9I 2JA7I 3OW2Z 4BBRI 4NBHA 1M902 3GTKI 3NDJA 3I56Z 1Q7Y1 2H85A 1M1K2 2R7ZI 3MZLB 2VUMI 1I50I 5IT9b 2OOXB 2E2JI 1VQLZ 3EEDA 4BBSI 3J7A4 3GTQI 5FLMI 1KC82 3NH8A 3PO2I 3IR7A 4E32A 1QVGZ 3CPWZ 1N8R2 2RT9A 2JIOA 3U50C 5C4JI 3HOWI 2K5RA 2O4HA 2JIMA 1VQ91 1NJI2 2F4MA 1L1OC 4NB9A 1Q862 2VF1A 1VQ71 3CCVZ 3GTOI 3VMHA 2LEXA 1VQ4Z 2NVYI 1YI21 1K9M1 1VQ5Z 2NVQI 1TWGI 2EGTA 4TNUA 1Y1WI 3GTPI 2RHBA 2OTJ1 1WW9A 3D9XA 1K731 1RLYA 2QRDB 4A3LI 2OOYB 3CCLZ 3CCU1 1QYPA 1RO0A 3FQMA 3J80f 3M4OI 4MD9A 4NBBA 1WIIA 3GCFA 1KRLA 2V8IA 2OTLZ 2E2II 3G4SZ 3S2HI 1VQ8Z 2JNYA 3JAMb 3F3FC 2M6NA 2QLVB 1VQMZ 1AA6A 2QR1B 1JJ2Z 2IV2X 3KIHA 3I55Z 2VPXA 1ML8A 1ZB8A 1VQL1 2IZ4A 1P9NA 2GTIA 2JR6A 1VQOZ 5A2Qf 2WB1A 3VTNA 1I3QI 3NH4A 5C44I 3G71Z 4HGYA 1FDOA 1M901 2OZKA 1VQK1 4E2YA 3CCV1 4E2ZA 2V8JA 3BG1B 3D6WA 1VQ41 2LIYA 1M1K1 3TDHB 3CCMZ 1VQ51 3FQQA 1TWAI 2Q4ZA 2DE7A 4A3II 3HOVI 3CCL1 1Q16A 1YUKA 1KC81 3VB9A 3GKQA 4NBGA 1N8R1 3CC2Z 1W2BY 4S1TA 3KIFA 1NJI1
chains in the Genus database with same CATH topology
2M48A 3J81f 3OW2Y 3G4S1 3CCJ1 3GTLI 1VQ81 1Q861 2QEXZ 3CD6Z 1Z01A 1ZB9A 2JA5I 5LL6f 2NVXI 3IX0A 3F3PC 1R9TI 4A93I 4E31A 3TE5B 3CCRZ 3Q87A 3FKII 2R93I 3NFZA 2AKLA 3H3VJ 4A3CI 3NH5A 2JS4A 4RV9A 1QVGY 2P28A 5C3EI 4DK1A 1YJ9Z 3CC4Z 3CPWY 3G711 2V8KA 4NOZA 3CQZI 1NUIA 4NBFA 2HF1A 4E2XA 2JA8I 2QKDA 1YJNZ 2E9HA 2J6AA 2G2KA 1LQLA 1Z03A 1S72Z 2YADA 4E30A 3CMAZ 2O53A 3CC21 3VMIA 3K7AI 1NP6A 4MONA 5C4XI 3HOUI 1USPA 2PM9A 3HKZA 4E33A 3CD61 3I561 3BG0B 2DE5A 2PMZA 1Q822 3I07A 1JWHC 4MD7A 4X6AI 4AYBA 1YJWZ 4E2WA 1JJ2Y 3CCR1 1K83I 1ZH1A 3GTJI 1TFIA 4A3JI 3ESWA 4NBDA 1KQSZ 3S17I 4BY1I 5T64A 1YJ91 1X3ZA 4A3EI 4QTTA 1Y1VI 2KI7B 3GTGI 1TWHI 5IT9f 5D1OA 3IFUA 1YJN1 2QA4Z 3PO3I 1X0TA 3G6EZ 1KD12 4A3MI 1S721 3J80b 2E2HI 1Z02A 3RZDI 5FLXb 1YHQZ 3LUSA 4DQYB 2YU9I 2RIQA 1QVFZ 2GU2A 2OTL1 3CMEZ 3T4NB 2RPRA 3HOYI 2I3CA 4A3GI 2GTHA 2QREB 4DGLA 1RQFA 4QTUA 4HGZA 1VQM1 1DL6A 3M3YI 1YJW1 1QF8A 4NBEA 3I551 3MONA 2WAQA 1VQNZ 5A2Qb 4BXXI 3MZKB 3I4NI 1RO4A 2BJOA 1VQO1 5IP7I 1K8A2 3S1NI 3S1MI 3CC7Z 3EERA 3JAMf 1I6HI 4BY7I 3CCQZ 3CCEZ 4Y52I 3CCSZ 1YIJZ 2W04A 1S7MA 2Q51A 2P3YA 1Q821 3CCM1 1VQ6Z 1TWFI 2QA41 1YITZ 3G6E1 3NDIA 1N2FA 2F4OA 4CL1A 1PFTA 4NB8A 1YHQ1 3CXCZ 1VQKZ 1VQPZ 2W03A 3CXCY 3J81b 4MXUA 2LFUA 2JA6I 1Q7Y2 4A3DI 3CME1 4EWCA 2HU9A 5CM2M 2QEX1 4MRIA 1WCMI 3S1QI 1YUAA 4HH4A 3QWUA 4XX2A 2K3RA 1VQN1 3HOZI 1USPB 2QRCB 3S2DI 1Q811 5FLXf 3HOXI 1KD11 4RVHA 3P5JB 3IF8A 2JMOA 2Y0SA 3CCJZ 3I4MI 1RNIA 3CC71 4RVFA 2DE6A 3CC41 1KQSY 2KPIA 1RO2A 4NBAA 2JUBA 1K9M2 3CCQ1 4RVDA 3CCE1 3CCS1 2NVTI 1YIJ1 1SFOI 3GTMI 1K732 1VQ61 3S15I 2RBLA 1YIT1 3S16I 2ZAEB 4NH1C 4A3KI 1Q812 4NFRA 4RS4A 4NBCA 1VQ9Z 5AN9F 2PK7A 1VQP1 3CMA1 4RVGA 1K8A1 4A3BI 2VUGA 1Y1VS 1VLAA 5D1OB 5T67A 1VQ7Z 1X3WA 5D1PA 2R92I 2R6MA 3VMGA 1YI2Z 3GTMS 1QVFY 2IZ3A 3S1RI 3S14I 4Y7NI 5T6BA 2OTJZ 3PO3S 4MH4A 2B63I 1TWCI 3CCUZ 3RZOI 1W2BZ 3H0GI 4A3FI 4MD8A 5IP9I 2JA7I 3OW2Z 4BBRI 4NBHA 1M902 3GTKI 3NDJA 3I56Z 1Q7Y1 2H85A 1M1K2 2R7ZI 3MZLB 2VUMI 1I50I 5IT9b 2OOXB 2E2JI 1VQLZ 3EEDA 4BBSI 3J7A4 3GTQI 5FLMI 1KC82 3NH8A 3PO2I 4E32A 1QVGZ 3CPWZ 1N8R2 2RT9A 3U50C 5C4JI 3HOWI 2K5RA 2O4HA 1VQ91 1NJI2 2F4MA 1L1OC 4NB9A 1Q862 2VF1A 1VQ71 3CCVZ 3GTOI 3VMHA 1VQ4Z 2NVYI 1YI21 1K9M1 1VQ5Z 2NVQI 1TWGI 2EGTA 4TNUA 1Y1WI 3GTPI 2RHBA 2OTJ1 1WW9A 3D9XA 1K731 1RLYA 2QRDB 4A3LI 2OOYB 3CCLZ 3CCU1 1QYPA 1RO0A 3FQMA 3J80f 3M4OI 4MD9A 4NBBA 1WIIA 3GCFA 1KRLA 2V8IA 2OTLZ 2E2II 3G4SZ 3S2HI 1VQ8Z 2JNYA 3JAMb 3F3FC 2M6NA 2QLVB 1VQMZ 2QR1B 1JJ2Z 3KIHA 3I55Z 1ML8A 1ZB8A 1VQL1 2IZ4A 1P9NA 2GTIA 2JR6A 1VQOZ 5A2Qf 2WB1A 3VTNA 1I3QI 3NH4A 5C44I 3G71Z 4HGYA 1M901 1VQK1 2OZKA 4E2YA 3CCV1 4E2ZA 2V8JA 3BG1B 3D6WA 1VQ41 2LIYA 1M1K1 3TDHB 3CCMZ 1VQ51 3FQQA 1TWAI 2Q4ZA 2DE7A 4A3II 3HOVI 3CCL1 1YUKA 1KC81 3VB9A 3GKQA 4NBGA 1N8R1 3CC2Z 1W2BY 4S1TA 3KIFA 1NJI1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG Z;  3CPW Z;  1N8R 2;  1VQN 1;  3OW2 Y;  3G4S 1;  3CCJ 1;  1VQ8 1;  1VQ9 1;  1NJI 2;  1Q86 1;  2QEX Z;  3CD6 Z;  1Q81 1;  1KD1 1;  1YJN 1;  2QA4 Z;  1Q86 2;  3G6E Z;  1VQ7 1;  3CCV Z;  1KD1 2;  3CCJ Z;  1VQ4 Z;  1S72 1;  1YI2 1;  3CC7 1;  1K9M 1;  3CCR Z;  1YHQ Z;  1VQ5 Z;  3CC4 1;  1KQS Y;  1K9M 2;  3CCQ 1;  2OTJ 1;  3CCE 1;  1K73 1;  3CCS 1;  1QVF Z;  1YIJ 1;  3CCL Z;  2OTL 1;  3CME Z;  3CCU 1;  1QVG Y;  1K73 2;  3CPW Y;  1YJ9 Z;  3CC4 Z;  1VQ6 1;  3G71 1;  1YIT 1;  1VQM 1;  1Q81 2;  2OTL Z;  1YJW 1;  3I55 1;  1VQN Z;  3G4S Z;  1VQ8 Z;  1VQ9 Z;  1VQP 1;  3CMA 1;  1K8A 1;  1YJN Z;  1VQM Z;  1JJ2 Z;  1VQ7 Z;  1VQO 1;  1K8A 2;  3I55 Z;  1S72 Z;  1YI2 Z;  1VQL 1;  3CC7 Z;  1QVF Y;  3CMA Z;  3CC2 1;  3CCQ Z;  2OTJ Z;  1VQO Z;  3CCE Z;  3CCS Z;  1YIJ Z;  3CCU Z;  1W2B Z;  1Q82 1;  3CD6 1;  3I56 1;  3CCM 1;  1VQ6 Z;  3G71 Z;  1M90 1;  1VQK 1;  2QA4 1;  1YIT Z;  3OW2 Z;  3G6E 1;  1Q82 2;  3CCV 1;  1M90 2;  1VQ4 1;  1YJW Z;  1M1K 1;  1JJ2 Y;  3I56 Z;  3CCM Z;  3CCR 1;  1VQ5 1;  1YHQ 1;  3CXC Z;  1VQK Z;  1Q7Y 1;  1VQP Z;  1M1K 2;  3CXC Y;  1Q7Y 2;  3CCL 1;  1KQS Z;  1KC8 1;  3CME 1;  1VQL Z;  1YJ9 1;  2QEX 1;  1N8R 1;  3CC2 Z;  1KC8 2;  1W2B Y;  1NJI 1; 
#chains in the Genus database with same CATH topology
 2M48 A;  3J81 f;  3OW2 Y;  3G4S 1;  3CCJ 1;  3GTL I;  1VQ8 1;  3D2L A;  1Q86 1;  2QEX Z;  3CD6 Z;  1Z01 A;  1ZB9 A;  2JA5 I;  5LL6 f;  2NVX I;  3IX0 A;  3F3P C;  1R9T I;  4A93 I;  4E31 A;  3TE5 B;  3CCR Z;  3Q87 A;  3FKI I;  2R93 I;  3NFZ A;  2AKL A;  3H3V J;  4A3C I;  3NH5 A;  2JIR A;  2JS4 A;  4RV9 A;  1QVG Y;  2P28 A;  5C3E I;  4DK1 A;  1YJ9 Z;  3CC4 Z;  3CPW Y;  3G71 1;  2V8K A;  4NOZ A;  3CQZ I;  1NUI A;  4NBF A;  2HF1 A;  4E2X A;  2JA8 I;  2QKD A;  1YJN Z;  2E9H A;  2J6A A;  2G2K A;  1LQL A;  1Z03 A;  1S72 Z;  2YAD A;  4E30 A;  3CMA Z;  2O53 A;  3CC2 1;  3VMI A;  3K7A I;  1NP6 A;  4MON A;  5C4X I;  2NAP A;  3HOU I;  1USP A;  2PM9 A;  3HKZ A;  4E33 A;  3CD6 1;  3I56 1;  3BG0 B;  2DE5 A;  2PMZ A;  1WZN A;  1Q82 2;  3I07 A;  1JWH C;  4MD7 A;  4X6A I;  4AYB A;  1YJW Z;  4E2W A;  1JJ2 Y;  3CCR 1;  1K83 I;  1ZH1 A;  3GTJ I;  1TFI A;  4A3J I;  3ESW A;  4NBD A;  1KQS Z;  3S17 I;  4BY1 I;  5T64 A;  1YJ9 1;  1X3Z A;  4A3E I;  1FDI A;  4QTT A;  1Y1V I;  2KI7 B;  3GTG I;  1TWH I;  5IT9 f;  5D1O A;  3IFU A;  1YJN 1;  2QA4 Z;  3PO3 I;  1X0T A;  3G6E Z;  1KD1 2;  4A3M I;  1S72 1;  3J80 b;  2E2H I;  1Z02 A;  3RZD I;  5FLX b;  1YHQ Z;  3LUS A;  2E7Z A;  4DQY B;  2YU9 I;  2RIQ A;  1QVF Z;  2GU2 A;  2OTL 1;  3CME Z;  3T4N B;  2RPR A;  3HOY I;  2I3C A;  4A3G I;  2GTH A;  2QRE B;  4DGL A;  2VPZ A;  1RQF A;  4QTU A;  4HGZ A;  1VQM 1;  1DL6 A;  3M3Y I;  2VPY A;  1YJW 1;  1QF8 A;  4NBE A;  3I55 1;  3MON A;  2WAQ A;  1VQN Z;  5A2Q b;  4BXX I;  3MZK B;  3I4N I;  1RO4 A;  2AYD A;  2BJO A;  1VQO 1;  5IP7 I;  1K8A 2;  3S1N I;  2V45 A;  3S1M I;  3CC7 Z;  3EER A;  3JAM f;  1I6H I;  4BY7 I;  3CCQ Z;  3CCE Z;  4Y52 I;  3CCS Z;  1YIJ Z;  2W04 A;  1S7M A;  2Q51 A;  2P3Y A;  1Q82 1;  3CCM 1;  1VQ6 Z;  2JIP A;  1TWF I;  2QA4 1;  1YIT Z;  3G6E 1;  3NDI A;  1N2F A;  2F4O A;  4CL1 A;  1PFT A;  4NB8 A;  1YHQ 1;  3CXC Z;  1VQK Z;  1VQP Z;  2W03 A;  3CXC Y;  3J81 b;  4MXU A;  2LFU A;  2JA6 I;  1Q7Y 2;  4A3D I;  3CME 1;  4EWC A;  2HU9 A;  5CM2 M;  2QEX 1;  4MRI A;  1WCM I;  3S1Q I;  1YUA A;  4HH4 A;  2V3V A;  3QWU A;  4XX2 A;  2K3R A;  1VQN 1;  3HOZ I;  1USP B;  2QRC B;  3S2D I;  1Q81 1;  5FLX f;  3HOX I;  1KD1 1;  4RVH A;  3P5J B;  3IF8 A;  2JMO A;  2Y0S A;  3CCJ Z;  3I4M I;  1RNI A;  3CC7 1;  4RVF A;  1SIW A;  2DE6 A;  2JIQ A;  3CC4 1;  1WJ2 A;  1KQS Y;  2KPI A;  1RO2 A;  4NBA A;  2JUB A;  1K9M 2;  3CCQ 1;  4RVD A;  3CCE 1;  3CCS 1;  2NVT I;  1YIJ 1;  1SFO I;  3GTM I;  1K73 2;  1VQ6 1;  3S15 I;  2RBL A;  1YIT 1;  3S16 I;  2ZAE B;  1Y8C A;  4NH1 C;  4A3K I;  1Q81 2;  1QXF A;  4NFR A;  4RS4 A;  4NBC A;  1VQ9 Z;  5AN9 F;  2PK7 A;  1VQP 1;  3CMA 1;  4RVG A;  1K8A 1;  4A3B I;  2VUG A;  2VPW A;  1Y1V S;  1VLA A;  5D1O B;  5T67 A;  1VQ7 Z;  1X3W A;  5D1P A;  2R92 I;  2R6M A;  3VMG A;  1YI2 Z;  3GTM S;  1QVF Y;  2IZ3 A;  3S1R I;  3S14 I;  4Y7N I;  5T6B A;  2OTJ Z;  3PO3 S;  4MH4 A;  2B63 I;  1TWC I;  3CCU Z;  3RZO I;  1W2B Z;  3H0G I;  4A3F I;  4MD8 A;  5IP9 I;  2JA7 I;  3OW2 Z;  4BBR I;  4NBH A;  1M90 2;  3GTK I;  3NDJ A;  3I56 Z;  1Q7Y 1;  2H85 A;  1M1K 2;  2R7Z I;  3MZL B;  2VUM I;  1I50 I;  5IT9 b;  2OOX B;  2E2J I;  1VQL Z;  3EED A;  4BBS I;  3J7A 4;  3GTQ I;  5FLM I;  1KC8 2;  3NH8 A;  3PO2 I;  3IR7 A;  4E32 A;  1QVG Z;  3CPW Z;  1N8R 2;  2RT9 A;  2JIO A;  3U50 C;  5C4J I;  3HOW I;  2K5R A;  2O4H A;  2JIM A;  1VQ9 1;  1NJI 2;  2F4M A;  1L1O C;  4NB9 A;  1Q86 2;  2VF1 A;  1VQ7 1;  3CCV Z;  3GTO I;  3VMH A;  2LEX A;  1VQ4 Z;  2NVY I;  1YI2 1;  1K9M 1;  1VQ5 Z;  2NVQ I;  1TWG I;  2EGT A;  4TNU A;  1Y1W I;  3GTP I;  2RHB A;  2OTJ 1;  1WW9 A;  3D9X A;  1K73 1;  1RLY A;  2QRD B;  4A3L I;  2OOY B;  3CCL Z;  3CCU 1;  1QYP A;  1RO0 A;  3FQM A;  3J80 f;  3M4O I;  4MD9 A;  4NBB A;  1WII A;  3GCF A;  1KRL A;  2V8I A;  2OTL Z;  2E2I I;  3G4S Z;  3S2H I;  1VQ8 Z;  2JNY A;  3JAM b;  3F3F C;  2M6N A;  2QLV B;  1VQM Z;  1AA6 A;  2QR1 B;  1JJ2 Z;  2IV2 X;  3KIH A;  3I55 Z;  2VPX A;  1ML8 A;  1ZB8 A;  1VQL 1;  2IZ4 A;  1P9N A;  2GTI A;  2JR6 A;  1VQO Z;  5A2Q f;  2WB1 A;  3VTN A;  1I3Q I;  3NH4 A;  5C44 I;  3G71 Z;  4HGY A;  1FDO A;  1M90 1;  2OZK A;  1VQK 1;  4E2Y A;  3CCV 1;  4E2Z A;  2V8J A;  3BG1 B;  3D6W A;  1VQ4 1;  2LIY A;  1M1K 1;  3TDH B;  3CCM Z;  1VQ5 1;  3FQQ A;  1TWA I;  2Q4Z A;  2DE7 A;  4A3I I;  3HOV I;  3CCL 1;  1Q16 A;  1YUK A;  1KC8 1;  3VB9 A;  3GKQ A;  4NBG A;  1N8R 1;  3CC2 Z;  1W2B Y;  4S1T A;  3KIF A;  1NJI 1; 
#chains in the Genus database with same CATH homology
 2M48 A;  3J81 f;  3OW2 Y;  3G4S 1;  3CCJ 1;  3GTL I;  1VQ8 1;  1Q86 1;  2QEX Z;  3CD6 Z;  1Z01 A;  1ZB9 A;  2JA5 I;  5LL6 f;  2NVX I;  3IX0 A;  3F3P C;  1R9T I;  4A93 I;  4E31 A;  3TE5 B;  3CCR Z;  3Q87 A;  3FKI I;  2R93 I;  3NFZ A;  2AKL A;  3H3V J;  4A3C I;  3NH5 A;  2JS4 A;  4RV9 A;  1QVG Y;  2P28 A;  5C3E I;  4DK1 A;  1YJ9 Z;  3CC4 Z;  3CPW Y;  3G71 1;  2V8K A;  4NOZ A;  3CQZ I;  1NUI A;  4NBF A;  2HF1 A;  4E2X A;  2JA8 I;  2QKD A;  1YJN Z;  2E9H A;  2J6A A;  2G2K A;  1LQL A;  1Z03 A;  1S72 Z;  2YAD A;  4E30 A;  3CMA Z;  2O53 A;  3CC2 1;  3VMI A;  3K7A I;  1NP6 A;  4MON A;  5C4X I;  3HOU I;  1USP A;  2PM9 A;  3HKZ A;  4E33 A;  3CD6 1;  3I56 1;  3BG0 B;  2DE5 A;  2PMZ A;  1Q82 2;  3I07 A;  1JWH C;  4MD7 A;  4X6A I;  4AYB A;  1YJW Z;  4E2W A;  1JJ2 Y;  3CCR 1;  1K83 I;  1ZH1 A;  3GTJ I;  1TFI A;  4A3J I;  3ESW A;  4NBD A;  1KQS Z;  3S17 I;  4BY1 I;  5T64 A;  1YJ9 1;  1X3Z A;  4A3E I;  4QTT A;  1Y1V I;  2KI7 B;  3GTG I;  1TWH I;  5IT9 f;  5D1O A;  3IFU A;  1YJN 1;  2QA4 Z;  3PO3 I;  1X0T A;  3G6E Z;  1KD1 2;  4A3M I;  1S72 1;  3J80 b;  2E2H I;  1Z02 A;  3RZD I;  5FLX b;  1YHQ Z;  3LUS A;  4DQY B;  2YU9 I;  2RIQ A;  1QVF Z;  2GU2 A;  2OTL 1;  3CME Z;  3T4N B;  2RPR A;  3HOY I;  2I3C A;  4A3G I;  2GTH A;  2QRE B;  4DGL A;  1RQF A;  4QTU A;  4HGZ A;  1VQM 1;  1DL6 A;  3M3Y I;  1YJW 1;  1QF8 A;  4NBE A;  3I55 1;  3MON A;  2WAQ A;  1VQN Z;  5A2Q b;  4BXX I;  3MZK B;  3I4N I;  1RO4 A;  2BJO A;  1VQO 1;  5IP7 I;  1K8A 2;  3S1N I;  3S1M I;  3CC7 Z;  3EER A;  3JAM f;  1I6H I;  4BY7 I;  3CCQ Z;  3CCE Z;  4Y52 I;  3CCS Z;  1YIJ Z;  2W04 A;  1S7M A;  2Q51 A;  2P3Y A;  1Q82 1;  3CCM 1;  1VQ6 Z;  1TWF I;  2QA4 1;  1YIT Z;  3G6E 1;  3NDI A;  1N2F A;  2F4O A;  4CL1 A;  1PFT A;  4NB8 A;  1YHQ 1;  3CXC Z;  1VQK Z;  1VQP Z;  2W03 A;  3CXC Y;  3J81 b;  4MXU A;  2LFU A;  2JA6 I;  1Q7Y 2;  4A3D I;  3CME 1;  4EWC A;  2HU9 A;  5CM2 M;  2QEX 1;  4MRI A;  1WCM I;  3S1Q I;  1YUA A;  4HH4 A;  3QWU A;  4XX2 A;  2K3R A;  1VQN 1;  3HOZ I;  1USP B;  2QRC B;  3S2D I;  1Q81 1;  5FLX f;  3HOX I;  1KD1 1;  4RVH A;  3P5J B;  3IF8 A;  2JMO A;  2Y0S A;  3CCJ Z;  3I4M I;  1RNI A;  3CC7 1;  4RVF A;  2DE6 A;  3CC4 1;  1KQS Y;  2KPI A;  1RO2 A;  4NBA A;  2JUB A;  1K9M 2;  3CCQ 1;  4RVD A;  3CCE 1;  3CCS 1;  2NVT I;  1YIJ 1;  1SFO I;  3GTM I;  1K73 2;  1VQ6 1;  3S15 I;  2RBL A;  1YIT 1;  3S16 I;  2ZAE B;  4NH1 C;  4A3K I;  1Q81 2;  4NFR A;  4RS4 A;  4NBC A;  1VQ9 Z;  5AN9 F;  2PK7 A;  1VQP 1;  3CMA 1;  4RVG A;  1K8A 1;  4A3B I;  2VUG A;  1Y1V S;  1VLA A;  5D1O B;  5T67 A;  1VQ7 Z;  1X3W A;  5D1P A;  2R92 I;  2R6M A;  3VMG A;  1YI2 Z;  3GTM S;  1QVF Y;  2IZ3 A;  3S1R I;  3S14 I;  4Y7N I;  5T6B A;  2OTJ Z;  3PO3 S;  4MH4 A;  2B63 I;  1TWC I;  3CCU Z;  3RZO I;  1W2B Z;  3H0G I;  4A3F I;  4MD8 A;  5IP9 I;  2JA7 I;  3OW2 Z;  4BBR I;  4NBH A;  1M90 2;  3GTK I;  3NDJ A;  3I56 Z;  1Q7Y 1;  2H85 A;  1M1K 2;  2R7Z I;  3MZL B;  2VUM I;  1I50 I;  5IT9 b;  2OOX B;  2E2J I;  1VQL Z;  3EED A;  4BBS I;  3J7A 4;  3GTQ I;  5FLM I;  1KC8 2;  3NH8 A;  3PO2 I;  4E32 A;  1QVG Z;  3CPW Z;  1N8R 2;  2RT9 A;  3U50 C;  5C4J I;  3HOW I;  2K5R A;  2O4H A;  1VQ9 1;  1NJI 2;  2F4M A;  1L1O C;  4NB9 A;  1Q86 2;  2VF1 A;  1VQ7 1;  3CCV Z;  3GTO I;  3VMH A;  1VQ4 Z;  2NVY I;  1YI2 1;  1K9M 1;  1VQ5 Z;  2NVQ I;  1TWG I;  2EGT A;  4TNU A;  1Y1W I;  3GTP I;  2RHB A;  2OTJ 1;  1WW9 A;  3D9X A;  1K73 1;  1RLY A;  2QRD B;  4A3L I;  2OOY B;  3CCL Z;  3CCU 1;  1QYP A;  1RO0 A;  3FQM A;  3J80 f;  3M4O I;  4MD9 A;  4NBB A;  1WII A;  3GCF A;  1KRL A;  2V8I A;  2OTL Z;  2E2I I;  3G4S Z;  3S2H I;  1VQ8 Z;  2JNY A;  3JAM b;  3F3F C;  2M6N A;  2QLV B;  1VQM Z;  2QR1 B;  1JJ2 Z;  3KIH A;  3I55 Z;  1ML8 A;  1ZB8 A;  1VQL 1;  2IZ4 A;  1P9N A;  2GTI A;  2JR6 A;  1VQO Z;  5A2Q f;  2WB1 A;  3VTN A;  1I3Q I;  3NH4 A;  5C44 I;  3G71 Z;  4HGY A;  1M90 1;  1VQK 1;  2OZK A;  4E2Y A;  3CCV 1;  4E2Z A;  2V8J A;  3BG1 B;  3D6W A;  1VQ4 1;  2LIY A;  1M1K 1;  3TDH B;  3CCM Z;  1VQ5 1;  3FQQ A;  1TWA I;  2Q4Z A;  2DE7 A;  4A3I I;  3HOV I;  3CCL 1;  1YUK A;  1KC8 1;  3VB9 A;  3GKQ A;  4NBG A;  1N8R 1;  3CC2 Z;  1W2B Y;  4S1T A;  3KIF A;  1NJI 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...