1N8R2

Structure of large ribosomal subunit in complex with virginiamycin m
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 23S ribosomal RNA
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2002-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1n8r200
3I561 1VQ41 1Q862 3CME1 1VQPZ 1VQN1 1KQSZ 1VQLZ 3CPWZ 1Q821 3CCVZ 3OW2Y 1VQK1 1W2BZ 1VQ5Z 3CCM1 1VQO1 1Q7Y2 1YJ91 3CCEZ 1W2BY 1YJNZ 1QVGZ 1K732 1YI21 1YIJ1 3CC4Z 3CPWY 3G6EZ 1VQ91 3G71Z 1K8A1 3CCQ1 1S721 1K731 3CCJ1 3CXCZ 1VQNZ 3OW2Z 1M902 1Q861 1KQSY 3CC41 1N8R1 1Q822 2QEXZ 1VQMZ 3CCLZ 1YJN1 2OTL1 3CCV1 3CCSZ 1QVGY 1S72Z 1QVFY 2OTJZ 3CCL1 1YJ9Z 1JJ2Z 2QEX1 1Q811 1VQ8Z 1VQ51 1K9M2 3CCU1 3CMA1 2OTJ1 1VQL1 1YITZ 3CCQZ 1YJW1 3CC21 1VQP1 1M1K1 1KD11 3G711 3CC71 3I55Z 1VQ71 3CCRZ 1M901 1M1K2 1YIT1 3CCJZ 1N8R2 3CXCY 3G4SZ 1QVFZ 3CCE1 3CMEZ 3CCUZ 3I56Z 1VQ4Z 1YIJZ 3CCMZ 2QA4Z 3CC7Z 3CD61 1YJWZ 1Q7Y1 1K9M1 3CCS1 1VQ6Z 2OTLZ 3CMAZ 3CCR1 1JJ2Y 2QA41 1NJI2 1VQ7Z 1KC81 1YHQZ 1KD12 1VQKZ 1VQ61 3CC2Z 3G4S1 1NJI1 1Q812 1KC82 1K8A2 1YHQ1 3CD6Z 3G6E1 1VQM1 1VQOZ 1VQ9Z 1VQ81 3I551 1YI2Z
chains in the Genus database with same CATH superfamily
2R92I 1P9NA 1VQPZ 4E33A 1YUAA 2LIYA 1KQSZ 3CPWZ 3RZOI 4HH4A 1Q821 3JAMb 4S1TA 1VQK1 2DE6A 2E7ZA 1VQ5Z 3GTJI 4A3II 5FLMI 1YJ91 1SIWA 2IV2X 4NBEA 3D2LA 2E2JI 1YJNZ 3I4NI 2RT9A 1QVGZ 3FQMA 3MZLB 3CPWY 2JIMA 4A3CI 4TNUA 1K8A1 5D1OA 2JUBA 2K3RA 3CXCZ 3OW2Z 1Z01A 2PK7A 3NH5A 5A2Qf 2JS4A 4BBSI 4MH4A 1NUIA 1N8R1 4DGLA 2JNYA 1VQMZ 2P3YA 3CCSZ 1Y1WI 5IP9I 3NH4A 2GU2A 2F4OA 2E9HA 3TE5B 1USPB 1SFOI 1JJ2Z 3CCU1 3GCFA 4BXXI 1NP6A 3S16I 3HOWI 2KPIA 3G711 3M3YI 4NBDA 3I55Z 3KIFA 1X0TA 3CCRZ 1M901 3ESWA 3S1MI 4NBBA 2R93I 3VB9A 4HGZA 3CCUZ 3I56Z 1YIJZ 3CCMZ 4CL1A 3CD61 4Y52I 4RVDA 2NVTI 1TWFI 1Y1VI 1TWCI 3BG1B 3CCS1 4RS4A 4A3GI 4A3DI 3GTQI 1JJ2Y 1FDIA 1YHQZ 1FDOA 3GTOI 3HOUI 2GTIA 1KC82 2VPXA 2BJOA 1S7MA 1YHQ1 3H3VJ 1VQOZ 5LL6f 3I551 3S2HI 5CM2M 2I3CA 1VQ41 5C44I 3CME1 1VQN1 1VQLZ 2P28A 4BY1I 3K7AI 3CCVZ 3J81b 3FKII 3GTKI 3CCM1 3GTMS 4X6AI 1PFTA 3IF8A 4A3FI 3F3PC 2V45A 3CCEZ 2JA5I 2QKDA 2RIQA 3P5JB 2DE7A 3T4NB 1X3WA 4NBFA 3JAMf 3J80b 1YIJ1 3CC4Z 2RBLA 3HOVI 3G71Z 4NB9A 3VMHA 1Y8CA 2KI7B 3GTLI 3F3FC 3MONA 4AYBA 3CC41 2QRDB 1Q822 2QEXZ 2R7ZI 1YJN1 2VPWA 3EEDA 3IX0A 4A3KI 4E2YA 1S72Z 3HOYI 3S15I 3PO3S 1I50I 2OTJZ 1YJ9Z 3RZDI 5A2Qb 3FQQA 2OTJ1 2E2II 1USPA 5FLXb 2QR1B 4DK1A 1VQL1 2VUGA 1TWGI 3CC21 1YJW1 1M1K1 1KD11 2GTHA 3MZKB 1VQ71 3NDIA 2RPRA 3D6WA 5T6BA 2VUMI 1M1K2 1N8R2 2V8IA 5C3EI 3CMEZ 1VQ4Z 5C4XI 5C4JI 4XX2A 4EWCA 1ZB8A 2WB1A 4MD7A 1YJWZ 3S14I 1Q7Y1 1JWHC 1WIIA 4RV9A 3NFZA 4NBGA 4A3JI 1VQ6Z 4HGYA 3PO3I 4A3LI 1RNIA 3S1RI 1VQ7Z 2G2KA 2AKLA 3H0GI 1RLYA 1WCMI 1VQ61 1NJI1 2V3VA 3CQZI 3G6E1 1VQM1 1VQ9Z 1VQ81 2NVQI 3I561 5D1PA 2OZKA 2QLVB 2Y0SA 1N2FA 1W2BZ 2PMZA 4BBRI 1VQO1 1Q7Y2 2WAQA 4DQYB 3S17I 1QYPA 2QREB 3HOXI 4A93I 1I3QI 2JIOA 5IT9b 1W2BY 2HU9A 1K732 1ZB9A 2HF1A 2IZ3A 1WZNA 2RHBA 3HOZI 1S721 1K731 1QXFA 1VQNZ 1M902 1WJ2A 1KQSY 2M48A 3KIHA 1RO0A 4BY7I 3CCLZ 2OTL1 1DL6A 3CCV1 4NBAA 1AA6A 2O4HA 1QVGY 5T64A 1QVFY 3CCL1 3I07A 1Q811 1VQ8Z 1VQ51 3CMA1 4RVHA 4A3EI 3QWUA 2VF1A 3J80f 4QTTA 2EGTA 1YITZ 3CCQZ 4MRIA 1VQP1 4E30A 2JIRA 1YIT1 2F4MA 4A3BI 4NH1C 3CXCY 3G4SZ 3D9XA 5FLXf 4NOZA 1QF8A 1RO4A 4E31A 5IT9f 2QA4Z 3CC7Z 2QRCB 4Y7NI 1YUKA 2J6AA 1Z02A 1K9M1 1K83I 1TWAI 3CCR1 5T67A 2QA41 1NJI2 1VQKZ 3CC2Z 3G4S1 4A3MI 2LFUA 2OOYB 1Q812 1K8A2 4MD9A 3CD6Z 4NB8A 3Q87A 4NBCA 1YI2Z 2Q51A 4E2WA 5IP7I 2OOXB 1Q862 3I4MI 2VPYA 4E2ZA 1VLAA 3OW2Y 3J7A4 4E2XA 2NAPA 2JR6A 2JMOA 2VPZA 4RVGA 2JA6I 4MONA 3VMGA 3HKZA 3GTGI 3J81f 2W04A 2M6NA 4RVFA 2B63I 2O53A 3GTMI 5D1OB 1YI21 4NFRA 2JIQA 3G6EZ 2W03A 1VQ91 1X3ZA 3NH8A 2JIPA 3CCQ1 3CCJ1 1Q861 3GKQA 1I6HI 2PM9A 4MD8A 1L1OC 2E2HI 2LEXA 2YU9I 3VMIA 3NDJA 1R9TI 3S1NI 1ZH1A 2QEX1 3S1QI 2YADA 1Q16A 2NVXI 1K9M2 3IR7A 1ML8A 3U50C 3TDHB 3VTNA 3M4OI 4E32A 3CC71 1TWHI 1WW9A 2IZ4A 2ZAEB 3EERA 1RO2A 1Y1VS 2JA8I 3CCJZ 1KRLA 3S2DI 1QVFZ 3CCE1 2V8KA 1LQLA 2V8JA 3LUSA 4MXUA 2NVYI 5AN9F 3BG0B 4QTUA 3IFUA 3GTPI 2OTLZ 3CMAZ 3PO2I 2R6MA 1TFIA 1KC81 2AYDA 2DE5A 1KD12 2K5RA 2Q4ZA 1Z03A 2H85A 4NBHA 1RQFA 2JA7I
chains in the Genus database with same CATH topology
2R92I 1P9NA 1VQPZ 4E33A 1YUAA 2LIYA 1KQSZ 3CPWZ 3RZOI 4HH4A 1Q821 3JAMb 4S1TA 1VQK1 2DE6A 1VQ5Z 3GTJI 4A3II 5FLMI 1YJ91 4NBEA 2E2JI 1YJNZ 3I4NI 1QVGZ 2RT9A 3FQMA 3MZLB 3CPWY 4A3CI 4TNUA 1K8A1 5D1OA 2JUBA 2K3RA 3CXCZ 3OW2Z 1Z01A 2PK7A 3NH5A 5A2Qf 2JS4A 4BBSI 4MH4A 1NUIA 1N8R1 4DGLA 2JNYA 1VQMZ 2P3YA 3CCSZ 1Y1WI 5IP9I 3NH4A 2GU2A 2F4OA 2E9HA 3TE5B 1USPB 1SFOI 1JJ2Z 3CCU1 3GCFA 4BXXI 1NP6A 3S16I 3HOWI 2KPIA 3G711 3M3YI 4NBDA 3I55Z 3KIFA 1X0TA 3CCRZ 1M901 3ESWA 3S1MI 4NBBA 2R93I 3VB9A 4HGZA 3CCUZ 3I56Z 1YIJZ 3CCMZ 4CL1A 3CD61 4Y52I 4RVDA 2NVTI 1TWFI 1Y1VI 1TWCI 3BG1B 3CCS1 4RS4A 4A3GI 4A3DI 3GTQI 1JJ2Y 1YHQZ 3GTOI 3HOUI 2GTIA 1KC82 2BJOA 1S7MA 1YHQ1 3H3VJ 1VQOZ 5LL6f 3I551 3S2HI 5CM2M 2I3CA 1VQ41 5C44I 3CME1 1VQN1 1VQLZ 2P28A 4BY1I 3K7AI 3CCVZ 3J81b 3FKII 3GTKI 3CCM1 3GTMS 4X6AI 1PFTA 3IF8A 4A3FI 3F3PC 3CCEZ 2JA5I 2QKDA 2RIQA 3P5JB 2DE7A 3T4NB 1X3WA 4NBFA 3JAMf 3J80b 1YIJ1 3CC4Z 2RBLA 3HOVI 3G71Z 4NB9A 3VMHA 2KI7B 3GTLI 3F3FC 3MONA 4AYBA 3CC41 2QRDB 1Q822 2QEXZ 2R7ZI 1YJN1 3EEDA 3IX0A 4A3KI 4E2YA 1S72Z 3HOYI 3S15I 3PO3S 1I50I 2OTJZ 1YJ9Z 3RZDI 5A2Qb 3FQQA 2OTJ1 2E2II 1USPA 5FLXb 2QR1B 4DK1A 1VQL1 2VUGA 1TWGI 3CC21 1YJW1 1M1K1 1KD11 2GTHA 3MZKB 1VQ71 3NDIA 2RPRA 3D6WA 5T6BA 2VUMI 1M1K2 1N8R2 2V8IA 5C3EI 3CMEZ 1VQ4Z 5C4XI 5C4JI 4XX2A 4EWCA 1ZB8A 2WB1A 4MD7A 1YJWZ 3S14I 1Q7Y1 1JWHC 1WIIA 4RV9A 3NFZA 4NBGA 4A3JI 1VQ6Z 4HGYA 3PO3I 4A3LI 1RNIA 3S1RI 1VQ7Z 2G2KA 2AKLA 3H0GI 1RLYA 1WCMI 1VQ61 1NJI1 3CQZI 3G6E1 1VQM1 1VQ9Z 1VQ81 2NVQI 3I561 5D1PA 2OZKA 2QLVB 2Y0SA 1N2FA 1W2BZ 2PMZA 4BBRI 1VQO1 1Q7Y2 2WAQA 4DQYB 3S17I 1QYPA 2QREB 3HOXI 4A93I 1I3QI 5IT9b 1W2BY 2HU9A 1K732 1ZB9A 2HF1A 2IZ3A 2RHBA 3HOZI 1S721 1K731 1VQNZ 1M902 1KQSY 2M48A 3KIHA 1RO0A 4BY7I 3CCLZ 2OTL1 1DL6A 3CCV1 4NBAA 2O4HA 1QVGY 5T64A 1QVFY 3CCL1 3I07A 1Q811 1VQ8Z 1VQ51 3CMA1 4RVHA 4A3EI 3QWUA 2VF1A 3J80f 4QTTA 2EGTA 1YITZ 3CCQZ 4MRIA 1VQP1 4E30A 1YIT1 2F4MA 4A3BI 4NH1C 3CXCY 3G4SZ 3D9XA 5FLXf 4NOZA 1QF8A 1RO4A 4E31A 5IT9f 2QA4Z 3CC7Z 2QRCB 4Y7NI 1YUKA 2J6AA 1Z02A 1K9M1 1K83I 1TWAI 3CCR1 5T67A 2QA41 1NJI2 1VQKZ 3CC2Z 3G4S1 4A3MI 2LFUA 2OOYB 1Q812 1K8A2 4MD9A 3CD6Z 4NB8A 3Q87A 4NBCA 1YI2Z 2Q51A 4E2WA 5IP7I 2OOXB 1Q862 3I4MI 4E2ZA 1VLAA 3OW2Y 3J7A4 4E2XA 2JR6A 2JMOA 4RVGA 2JA6I 4MONA 3VMGA 3HKZA 3GTGI 3J81f 2W04A 2M6NA 4RVFA 2B63I 2O53A 3GTMI 5D1OB 1YI21 4NFRA 3G6EZ 2W03A 1VQ91 1X3ZA 3NH8A 3CCQ1 3CCJ1 1Q861 3GKQA 1I6HI 2PM9A 4MD8A 1L1OC 2E2HI 2YU9I 3VMIA 3NDJA 1R9TI 3S1NI 1ZH1A 2QEX1 3S1QI 2YADA 2NVXI 1K9M2 1ML8A 3U50C 3TDHB 3VTNA 3M4OI 4E32A 3CC71 1TWHI 1WW9A 2IZ4A 2ZAEB 3EERA 1RO2A 1Y1VS 2JA8I 3CCJZ 1KRLA 3S2DI 1QVFZ 3CCE1 2V8KA 1LQLA 2V8JA 3LUSA 4MXUA 2NVYI 5AN9F 3BG0B 4QTUA 3IFUA 3GTPI 2OTLZ 3CMAZ 3PO2I 2R6MA 1TFIA 1KC81 2DE5A 1KD12 2K5RA 2Q4ZA 1Z03A 2H85A 4NBHA 1RQFA 2JA7I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 1;  1VQ4 1;  1Q86 2;  3CME 1;  1VQP Z;  1VQN 1;  1KQS Z;  1VQL Z;  3CPW Z;  1Q82 1;  3CCV Z;  3OW2 Y;  1VQK 1;  1W2B Z;  1VQ5 Z;  3CCM 1;  1VQO 1;  1Q7Y 2;  1YJ9 1;  3CCE Z;  1W2B Y;  1YJN Z;  1QVG Z;  1K73 2;  1YI2 1;  1YIJ 1;  3CC4 Z;  3CPW Y;  3G6E Z;  1VQ9 1;  3G71 Z;  1K8A 1;  3CCQ 1;  1S72 1;  1K73 1;  3CCJ 1;  3CXC Z;  1VQN Z;  3OW2 Z;  1M90 2;  1Q86 1;  1KQS Y;  3CC4 1;  1N8R 1;  1Q82 2;  2QEX Z;  1VQM Z;  3CCL Z;  1YJN 1;  2OTL 1;  3CCV 1;  3CCS Z;  1QVG Y;  1S72 Z;  1QVF Y;  2OTJ Z;  3CCL 1;  1YJ9 Z;  1JJ2 Z;  2QEX 1;  1Q81 1;  1VQ8 Z;  1VQ5 1;  1K9M 2;  3CCU 1;  3CMA 1;  2OTJ 1;  1VQL 1;  1YIT Z;  3CCQ Z;  1YJW 1;  3CC2 1;  1VQP 1;  1M1K 1;  1KD1 1;  3G71 1;  3CC7 1;  3I55 Z;  1VQ7 1;  3CCR Z;  1M90 1;  1M1K 2;  1YIT 1;  3CCJ Z;  1N8R 2;  3CXC Y;  3G4S Z;  1QVF Z;  3CCE 1;  3CME Z;  3CCU Z;  3I56 Z;  1VQ4 Z;  1YIJ Z;  3CCM Z;  2QA4 Z;  3CC7 Z;  3CD6 1;  1YJW Z;  1Q7Y 1;  1K9M 1;  3CCS 1;  1VQ6 Z;  2OTL Z;  3CMA Z;  3CCR 1;  1JJ2 Y;  2QA4 1;  1NJI 2;  1VQ7 Z;  1KC8 1;  1YHQ Z;  1KD1 2;  1VQK Z;  1VQ6 1;  3CC2 Z;  3G4S 1;  1NJI 1;  1Q81 2;  1KC8 2;  1K8A 2;  1YHQ 1;  3CD6 Z;  3G6E 1;  1VQM 1;  1VQO Z;  1VQ9 Z;  1VQ8 1;  3I55 1;  1YI2 Z; 
#chains in the Genus database with same CATH topology
 2R92 I;  1P9N A;  1VQP Z;  4E33 A;  1YUA A;  2LIY A;  1KQS Z;  3CPW Z;  3RZO I;  4HH4 A;  1Q82 1;  3JAM b;  4S1T A;  1VQK 1;  2DE6 A;  2E7Z A;  1VQ5 Z;  3GTJ I;  4A3I I;  5FLM I;  1YJ9 1;  1SIW A;  2IV2 X;  4NBE A;  3D2L A;  2E2J I;  1YJN Z;  3I4N I;  2RT9 A;  1QVG Z;  3FQM A;  3MZL B;  3CPW Y;  2JIM A;  4A3C I;  4TNU A;  1K8A 1;  5D1O A;  2JUB A;  2K3R A;  3CXC Z;  3OW2 Z;  1Z01 A;  2PK7 A;  3NH5 A;  5A2Q f;  2JS4 A;  4BBS I;  4MH4 A;  1NUI A;  1N8R 1;  4DGL A;  2JNY A;  1VQM Z;  2P3Y A;  3CCS Z;  1Y1W I;  5IP9 I;  3NH4 A;  2GU2 A;  2F4O A;  2E9H A;  3TE5 B;  1USP B;  1SFO I;  1JJ2 Z;  3CCU 1;  3GCF A;  4BXX I;  1NP6 A;  3S16 I;  3HOW I;  2KPI A;  3G71 1;  3M3Y I;  4NBD A;  3I55 Z;  3KIF A;  1X0T A;  3CCR Z;  1M90 1;  3ESW A;  3S1M I;  4NBB A;  2R93 I;  3VB9 A;  4HGZ A;  3CCU Z;  3I56 Z;  1YIJ Z;  3CCM Z;  4CL1 A;  3CD6 1;  4Y52 I;  4RVD A;  2NVT I;  1TWF I;  1Y1V I;  1TWC I;  3BG1 B;  3CCS 1;  4RS4 A;  4A3G I;  4A3D I;  3GTQ I;  1JJ2 Y;  1FDI A;  1YHQ Z;  1FDO A;  3GTO I;  3HOU I;  2GTI A;  1KC8 2;  2VPX A;  2BJO A;  1S7M A;  1YHQ 1;  3H3V J;  1VQO Z;  5LL6 f;  3I55 1;  3S2H I;  5CM2 M;  2I3C A;  1VQ4 1;  5C44 I;  3CME 1;  1VQN 1;  1VQL Z;  2P28 A;  4BY1 I;  3K7A I;  3CCV Z;  3J81 b;  3FKI I;  3GTK I;  3CCM 1;  3GTM S;  4X6A I;  1PFT A;  3IF8 A;  4A3F I;  3F3P C;  2V45 A;  3CCE Z;  2JA5 I;  2QKD A;  2RIQ A;  3P5J B;  2DE7 A;  3T4N B;  1X3W A;  4NBF A;  3JAM f;  3J80 b;  1YIJ 1;  3CC4 Z;  2RBL A;  3HOV I;  3G71 Z;  4NB9 A;  3VMH A;  1Y8C A;  2KI7 B;  3GTL I;  3F3F C;  3MON A;  4AYB A;  3CC4 1;  2QRD B;  1Q82 2;  2QEX Z;  2R7Z I;  1YJN 1;  2VPW A;  3EED A;  3IX0 A;  4A3K I;  4E2Y A;  1S72 Z;  3HOY I;  3S15 I;  3PO3 S;  1I50 I;  2OTJ Z;  1YJ9 Z;  3RZD I;  5A2Q b;  3FQQ A;  2OTJ 1;  2E2I I;  1USP A;  5FLX b;  2QR1 B;  4DK1 A;  1VQL 1;  2VUG A;  1TWG I;  3CC2 1;  1YJW 1;  1M1K 1;  1KD1 1;  2GTH A;  3MZK B;  1VQ7 1;  3NDI A;  2RPR A;  3D6W A;  5T6B A;  2VUM I;  1M1K 2;  1N8R 2;  2V8I A;  5C3E I;  3CME Z;  1VQ4 Z;  5C4X I;  5C4J I;  4XX2 A;  4EWC A;  1ZB8 A;  2WB1 A;  4MD7 A;  1YJW Z;  3S14 I;  1Q7Y 1;  1JWH C;  1WII A;  4RV9 A;  3NFZ A;  4NBG A;  4A3J I;  1VQ6 Z;  4HGY A;  3PO3 I;  4A3L I;  1RNI A;  3S1R I;  1VQ7 Z;  2G2K A;  2AKL A;  3H0G I;  1RLY A;  1WCM I;  1VQ6 1;  1NJI 1;  2V3V A;  3CQZ I;  3G6E 1;  1VQM 1;  1VQ9 Z;  1VQ8 1;  2NVQ I;  3I56 1;  5D1P A;  2OZK A;  2QLV B;  2Y0S A;  1N2F A;  1W2B Z;  2PMZ A;  4BBR I;  1VQO 1;  1Q7Y 2;  2WAQ A;  4DQY B;  3S17 I;  1QYP A;  2QRE B;  3HOX I;  4A93 I;  1I3Q I;  2JIO A;  5IT9 b;  1W2B Y;  2HU9 A;  1K73 2;  1ZB9 A;  2HF1 A;  2IZ3 A;  1WZN A;  2RHB A;  3HOZ I;  1S72 1;  1K73 1;  1QXF A;  1VQN Z;  1M90 2;  1WJ2 A;  1KQS Y;  2M48 A;  3KIH A;  1RO0 A;  4BY7 I;  3CCL Z;  2OTL 1;  1DL6 A;  3CCV 1;  4NBA A;  1AA6 A;  2O4H A;  1QVG Y;  5T64 A;  1QVF Y;  3CCL 1;  3I07 A;  1Q81 1;  1VQ8 Z;  1VQ5 1;  3CMA 1;  4RVH A;  4A3E I;  3QWU A;  2VF1 A;  3J80 f;  4QTT A;  2EGT A;  1YIT Z;  3CCQ Z;  4MRI A;  1VQP 1;  4E30 A;  2JIR A;  1YIT 1;  2F4M A;  4A3B I;  4NH1 C;  3CXC Y;  3G4S Z;  3D9X A;  5FLX f;  4NOZ A;  1QF8 A;  1RO4 A;  4E31 A;  5IT9 f;  2QA4 Z;  3CC7 Z;  2QRC B;  4Y7N I;  1YUK A;  2J6A A;  1Z02 A;  1K9M 1;  1K83 I;  1TWA I;  3CCR 1;  5T67 A;  2QA4 1;  1NJI 2;  1VQK Z;  3CC2 Z;  3G4S 1;  4A3M I;  2LFU A;  2OOY B;  1Q81 2;  1K8A 2;  4MD9 A;  3CD6 Z;  4NB8 A;  3Q87 A;  4NBC A;  1YI2 Z;  2Q51 A;  4E2W A;  5IP7 I;  2OOX B;  1Q86 2;  3I4M I;  2VPY A;  4E2Z A;  1VLA A;  3OW2 Y;  3J7A 4;  4E2X A;  2NAP A;  2JR6 A;  2JMO A;  2VPZ A;  4RVG A;  2JA6 I;  4MON A;  3VMG A;  3HKZ A;  3GTG I;  3J81 f;  2W04 A;  2M6N A;  4RVF A;  2B63 I;  2O53 A;  3GTM I;  5D1O B;  1YI2 1;  4NFR A;  2JIQ A;  3G6E Z;  2W03 A;  1VQ9 1;  1X3Z A;  3NH8 A;  2JIP A;  3CCQ 1;  3CCJ 1;  1Q86 1;  3GKQ A;  1I6H I;  2PM9 A;  4MD8 A;  1L1O C;  2E2H I;  2LEX A;  2YU9 I;  3VMI A;  3NDJ A;  1R9T I;  3S1N I;  1ZH1 A;  2QEX 1;  3S1Q I;  2YAD A;  1Q16 A;  2NVX I;  1K9M 2;  3IR7 A;  1ML8 A;  3U50 C;  3TDH B;  3VTN A;  3M4O I;  4E32 A;  3CC7 1;  1TWH I;  1WW9 A;  2IZ4 A;  2ZAE B;  3EER A;  1RO2 A;  1Y1V S;  2JA8 I;  3CCJ Z;  1KRL A;  3S2D I;  1QVF Z;  3CCE 1;  2V8K A;  1LQL A;  2V8J A;  3LUS A;  4MXU A;  2NVY I;  5AN9 F;  3BG0 B;  4QTU A;  3IFU A;  3GTP I;  2OTL Z;  3CMA Z;  3PO2 I;  2R6M A;  1TFI A;  1KC8 1;  2AYD A;  2DE5 A;  1KD1 2;  2K5R A;  2Q4Z A;  1Z03 A;  2H85 A;  4NBH A;  1RQF A;  2JA7 I; 
#chains in the Genus database with same CATH homology
 2R92 I;  1P9N A;  1VQP Z;  4E33 A;  1YUA A;  2LIY A;  1KQS Z;  3CPW Z;  3RZO I;  4HH4 A;  1Q82 1;  3JAM b;  4S1T A;  1VQK 1;  2DE6 A;  1VQ5 Z;  3GTJ I;  4A3I I;  5FLM I;  1YJ9 1;  4NBE A;  2E2J I;  1YJN Z;  3I4N I;  1QVG Z;  2RT9 A;  3FQM A;  3MZL B;  3CPW Y;  4A3C I;  4TNU A;  1K8A 1;  5D1O A;  2JUB A;  2K3R A;  3CXC Z;  3OW2 Z;  1Z01 A;  2PK7 A;  3NH5 A;  5A2Q f;  2JS4 A;  4BBS I;  4MH4 A;  1NUI A;  1N8R 1;  4DGL A;  2JNY A;  1VQM Z;  2P3Y A;  3CCS Z;  1Y1W I;  5IP9 I;  3NH4 A;  2GU2 A;  2F4O A;  2E9H A;  3TE5 B;  1USP B;  1SFO I;  1JJ2 Z;  3CCU 1;  3GCF A;  4BXX I;  1NP6 A;  3S16 I;  3HOW I;  2KPI A;  3G71 1;  3M3Y I;  4NBD A;  3I55 Z;  3KIF A;  1X0T A;  3CCR Z;  1M90 1;  3ESW A;  3S1M I;  4NBB A;  2R93 I;  3VB9 A;  4HGZ A;  3CCU Z;  3I56 Z;  1YIJ Z;  3CCM Z;  4CL1 A;  3CD6 1;  4Y52 I;  4RVD A;  2NVT I;  1TWF I;  1Y1V I;  1TWC I;  3BG1 B;  3CCS 1;  4RS4 A;  4A3G I;  4A3D I;  3GTQ I;  1JJ2 Y;  1YHQ Z;  3GTO I;  3HOU I;  2GTI A;  1KC8 2;  2BJO A;  1S7M A;  1YHQ 1;  3H3V J;  1VQO Z;  5LL6 f;  3I55 1;  3S2H I;  5CM2 M;  2I3C A;  1VQ4 1;  5C44 I;  3CME 1;  1VQN 1;  1VQL Z;  2P28 A;  4BY1 I;  3K7A I;  3CCV Z;  3J81 b;  3FKI I;  3GTK I;  3CCM 1;  3GTM S;  4X6A I;  1PFT A;  3IF8 A;  4A3F I;  3F3P C;  3CCE Z;  2JA5 I;  2QKD A;  2RIQ A;  3P5J B;  2DE7 A;  3T4N B;  1X3W A;  4NBF A;  3JAM f;  3J80 b;  1YIJ 1;  3CC4 Z;  2RBL A;  3HOV I;  3G71 Z;  4NB9 A;  3VMH A;  2KI7 B;  3GTL I;  3F3F C;  3MON A;  4AYB A;  3CC4 1;  2QRD B;  1Q82 2;  2QEX Z;  2R7Z I;  1YJN 1;  3EED A;  3IX0 A;  4A3K I;  4E2Y A;  1S72 Z;  3HOY I;  3S15 I;  3PO3 S;  1I50 I;  2OTJ Z;  1YJ9 Z;  3RZD I;  5A2Q b;  3FQQ A;  2OTJ 1;  2E2I I;  1USP A;  5FLX b;  2QR1 B;  4DK1 A;  1VQL 1;  2VUG A;  1TWG I;  3CC2 1;  1YJW 1;  1M1K 1;  1KD1 1;  2GTH A;  3MZK B;  1VQ7 1;  3NDI A;  2RPR A;  3D6W A;  5T6B A;  2VUM I;  1M1K 2;  1N8R 2;  2V8I A;  5C3E I;  3CME Z;  1VQ4 Z;  5C4X I;  5C4J I;  4XX2 A;  4EWC A;  1ZB8 A;  2WB1 A;  4MD7 A;  1YJW Z;  3S14 I;  1Q7Y 1;  1JWH C;  1WII A;  4RV9 A;  3NFZ A;  4NBG A;  4A3J I;  1VQ6 Z;  4HGY A;  3PO3 I;  4A3L I;  1RNI A;  3S1R I;  1VQ7 Z;  2G2K A;  2AKL A;  3H0G I;  1RLY A;  1WCM I;  1VQ6 1;  1NJI 1;  3CQZ I;  3G6E 1;  1VQM 1;  1VQ9 Z;  1VQ8 1;  2NVQ I;  3I56 1;  5D1P A;  2OZK A;  2QLV B;  2Y0S A;  1N2F A;  1W2B Z;  2PMZ A;  4BBR I;  1VQO 1;  1Q7Y 2;  2WAQ A;  4DQY B;  3S17 I;  1QYP A;  2QRE B;  3HOX I;  4A93 I;  1I3Q I;  5IT9 b;  1W2B Y;  2HU9 A;  1K73 2;  1ZB9 A;  2HF1 A;  2IZ3 A;  2RHB A;  3HOZ I;  1S72 1;  1K73 1;  1VQN Z;  1M90 2;  1KQS Y;  2M48 A;  3KIH A;  1RO0 A;  4BY7 I;  3CCL Z;  2OTL 1;  1DL6 A;  3CCV 1;  4NBA A;  2O4H A;  1QVG Y;  5T64 A;  1QVF Y;  3CCL 1;  3I07 A;  1Q81 1;  1VQ8 Z;  1VQ5 1;  3CMA 1;  4RVH A;  4A3E I;  3QWU A;  2VF1 A;  3J80 f;  4QTT A;  2EGT A;  1YIT Z;  3CCQ Z;  4MRI A;  1VQP 1;  4E30 A;  1YIT 1;  2F4M A;  4A3B I;  4NH1 C;  3CXC Y;  3G4S Z;  3D9X A;  5FLX f;  4NOZ A;  1QF8 A;  1RO4 A;  4E31 A;  5IT9 f;  2QA4 Z;  3CC7 Z;  2QRC B;  4Y7N I;  1YUK A;  2J6A A;  1Z02 A;  1K9M 1;  1K83 I;  1TWA I;  3CCR 1;  5T67 A;  2QA4 1;  1NJI 2;  1VQK Z;  3CC2 Z;  3G4S 1;  4A3M I;  2LFU A;  2OOY B;  1Q81 2;  1K8A 2;  4MD9 A;  3CD6 Z;  4NB8 A;  3Q87 A;  4NBC A;  1YI2 Z;  2Q51 A;  4E2W A;  5IP7 I;  2OOX B;  1Q86 2;  3I4M I;  4E2Z A;  1VLA A;  3OW2 Y;  3J7A 4;  4E2X A;  2JR6 A;  2JMO A;  4RVG A;  2JA6 I;  4MON A;  3VMG A;  3HKZ A;  3GTG I;  3J81 f;  2W04 A;  2M6N A;  4RVF A;  2B63 I;  2O53 A;  3GTM I;  5D1O B;  1YI2 1;  4NFR A;  3G6E Z;  2W03 A;  1VQ9 1;  1X3Z A;  3NH8 A;  3CCQ 1;  3CCJ 1;  1Q86 1;  3GKQ A;  1I6H I;  2PM9 A;  4MD8 A;  1L1O C;  2E2H I;  2YU9 I;  3VMI A;  3NDJ A;  1R9T I;  3S1N I;  1ZH1 A;  2QEX 1;  3S1Q I;  2YAD A;  2NVX I;  1K9M 2;  1ML8 A;  3U50 C;  3TDH B;  3VTN A;  3M4O I;  4E32 A;  3CC7 1;  1TWH I;  1WW9 A;  2IZ4 A;  2ZAE B;  3EER A;  1RO2 A;  1Y1V S;  2JA8 I;  3CCJ Z;  1KRL A;  3S2D I;  1QVF Z;  3CCE 1;  2V8K A;  1LQL A;  2V8J A;  3LUS A;  4MXU A;  2NVY I;  5AN9 F;  3BG0 B;  4QTU A;  3IFU A;  3GTP I;  2OTL Z;  3CMA Z;  3PO2 I;  2R6M A;  1TFI A;  1KC8 1;  2DE5 A;  1KD1 2;  2K5R A;  2Q4Z A;  1Z03 A;  2H85 A;  4NBH A;  1RQF A;  2JA7 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...