1VQ81

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8100
3CCL1 1VQO1 1QVFY 1VQP1 2OTJZ 1W2BY 3CCLZ 1VQOZ 1Q7Y1 1VQPZ 1Q7Y2 3CCR1 3CCU1 3CCRZ 3CCUZ 1VQ41 3CC41 1KC81 1KC82 2QA41 1VQ4Z 3CC4Z 1VQ91 2QA4Z 1YHQ1 1VQL1 3CXCZ 1YJ91 3CCV1 3CCS1 1VQ9Z 1YHQZ 3G6E1 1VQLZ 1YJ9Z 3CCE1 1VQ51 3CCVZ 3CCSZ 1K9M1 3CC21 3G6EZ 1K9M2 3CCJ1 1YJNZ 3CCEZ 1VQ5Z 3CC2Z 3OW2Z 3CD61 3CME1 1K731 1VQ61 3CCJZ 1JJ2Z 1K732 1VQK1 1KQSZ 1K8A1 1Q812 3CMA1 3CD6Z 3CMEZ 1K8A2 1VQ6Z 1VQKZ 2OTL1 3CMAZ 1VQ71 2OTLZ 3CCM1 1YJW1 1JJ2Y 1YI21 1YJN1 1N8R1 1VQ7Z 1Q861 3CCMZ 1YJWZ 1N8R2 1Q862 1QVFZ 1YI2Z 1VQN1 1W2BZ 1S721 3G4S1 3CXCY 1M1K1 1M1K2 1VQNZ 1Q811 1S72Z 3G4SZ 1NJI1 1QVGZ 3CCQ1 1NJI2 3I551 1M901 3CCQZ 1M902 2QEX1 3OW2Y 3I55Z 3CPWZ 1YIT1 3CC71 1KQSY 2QEXZ 1QVGY 1YITZ 3CC7Z 3I561 1VQM1 3G711 1YIJ1 1VQ81 3I56Z 1VQMZ 1KD11 3CPWY 3G71Z 1YIJZ 1Q821 1KD12 2OTJ1 1Q822 1VQ8Z
chains in the Genus database with same CATH superfamily
1X0TA 4MONA 1QVFY 2M6NA 1TWAI 1WJ2A 2V8IA 3TE5B 4CL1A 2YU9I 4A3BI 3GCFA 2E2HI 2E2II 1Q7Y2 3CCU1 2QREB 2W04A 2G2KA 3NDJA 1Y8CA 1YUAA 1Q16A 4MXUA 2NVYI 1USPA 4A3DI 2JR6A 2NAPA 1VQ4Z 1WCMI 1L1OC 1VQ91 1R9TI 1YHQ1 4E32A 2AYDA 1ML8A 2KI7B 4RVHA 1VQLZ 1FDOA 1Y1VS 1I6HI 2O4HA 1K9M2 4HH4A 4NFRA 3OW2Z 3CME1 4NB9A 1Q812 4MD9A 2NVTI 3NH5A 2M48A 2VPZA 2JUBA 1VQKZ 1LQLA 2KPIA 2RPRA 4S1TA 4E31A 3VMHA 2GTIA 5D1OB 4E2WA 1SFOI 2B63I 2RBLA 4NH1C 3GTJI 1N8R1 3PO3I 4E2XA 5D1PA 3CCMZ 5LL6f 1X3WA 4E30A 3S1QI 5T67A 2LFUA 3PO2I 2E2JI 1M1K2 4MD7A 3NH4A 1Q811 4A3II 2HU9A 2V45A 2NVXI 3HOYI 5T6BA 3OW2Y 3CPWZ 3IR7A 3LUSA 2QEXZ 4HGZA 4E2ZA 5C4XI 1VQM1 3S17I 3G711 3GTGI 1Y1VI 2K5RA 1VQ81 1KD11 3H3VJ 5IT9b 4A3LI 1YIJZ 2H85A 1Q822 2ZAEB 1I3QI 1VLAA 4RVFA 1VQO1 3S2HI 2JA6I 4NBAA 1Z03A 4A3GI 1YUKA 2YADA 3CCLZ 1VQPZ 1RO4A 1X3ZA 4A3MI 3CCR1 2F4OA 2OZKA 1TWHI 2E9HA 3J81b 3K7AI 5IP9I 3CC41 3S1NI 4Y7NI 4NOZA 2K3RA 2I3CA 3KIHA 4EWCA 2QLVB 2R93I 2QA4Z 4NBBA 3PO3S 2DE5A 1YJ91 3CCV1 4NBCA 2DE6A 3G6E1 1SIWA 3IFUA 2HF1A 1VQ51 1QXFA 3CCSZ 5FLXb 3J80f 4DK1A 3CCJ1 5FLMI 4MD8A 2VPWA 3CCEZ 3D9XA 3CC2Z 3IX0A 1K731 2R7ZI 2JIMA 2QKDA 2V3VA 1K8A1 3CMA1 3CD6Z 4NBGA 1VQ6Z 5D1OA 1Z01A 5A2Qf 2IZ3A 5C3EI 3D6WA 1VQ71 2OTLZ 1YJW1 2JA5I 1QYPA 1JJ2Y 1YI21 1Q861 2GTHA 1N8R2 2Q51A 2VPXA 1VQN1 4MH4A 3G4S1 2DE7A 1S72Z 2QRDB 1NJI1 4A3EI 1PFTA 3I551 4DGLA 4XX2A 2Q4ZA 3CCQZ 2LEXA 2AKLA 4A93I 2WAQA 1RO0A 3FQQA 3CC71 3JAMf 1QVGY 2PMZA 3U50C 1YITZ 3M3YI 1WZNA 3I561 2J6AA 3NH8A 1RO2A 1RLYA 1USPB 4BY1I 3GTKI 1KD12 4BBSI 3GTMS 4RS4A 5C44I 1JWHC 2OTJZ 3HOVI 2P28A 1TWFI 2IZ4A 5IP7I 2JMOA 2JIPA 3CCUZ 1VQ41 1KC81 3IF8A 3S14I 1TWCI 2P3YA 3S16I 3BG0B 4BY7I 2RT9A 1S7MA 1VQL1 3CXCZ 2OOYB 3BG1B 3GTLI 3S2DI 5CM2M 4A3JI 1VQ9Z 1YHQZ 2JA7I 2R92I 2W03A 3F3FC 2V8KA 4RVGA 3D2LA 3MZKB 1JJ2Z 2V8JA 3H0GI 1K732 4HGYA 1KQSZ 1VQK1 3CMEZ 2WB1A 1K8A2 5C4JI 3I4MI 2JNYA 3F3PC 3GTQI 4AYBA 3J7A4 4BBRI 3CCM1 2JIOA 1YJN1 3GTMI 2QRCB 1Y1WI 3HOWI 1Q862 1AA6A 3GKQA 1KRLA 1W2BZ 2Y0SA 3CXCY 1NP6A 4BXXI 2VUGA 1QVGZ 1NJI2 4NBFA 3P5JB 1M901 3MZLB 2QEX1 1WIIA 2JIRA 1K83I 2QR1B 3NFZA 3CQZI 1KQSY 1FDIA 4NBDA 1QF8A 4A3FI 4E33A 3VMGA 1YIJ1 4NB8A 4A3KI 2NVQI 2R6MA 1VQMZ 3G71Z 1Z02A 4QTUA 1VQ8Z 3RZOI 4X6AI 2IV2X 3CCL1 1VQP1 3Q87A 2E7ZA 1W2BY 2GU2A 1VQOZ 1Q7Y1 3TDHB 5IT9f 4RV9A 1I50I 1TFIA 3CCRZ 3HOXI 1KC82 2RHBA 2QA41 2BJOA 3J80b 3CC4Z 3GTPI 2RIQA 2VF1A 3I4NI 1NUIA 3FKII 1ZB8A 3J81f 3MONA 2OOXB 2JA8I 3CCS1 3HOUI 1YJ9Z 3CCE1 3CCVZ 1K9M1 3CC21 3G6EZ 4MRIA 2JIQA 3T4NB 1YJNZ 5A2Qb 1VQ5Z 1P9NA 3CD61 4QTTA 1RNIA 3CCJZ 1VQ61 3EERA 3VMIA 3QWUA 2EGTA 2VPYA 5FLXf 3HOZI 3S15I 3ESWA 2OTL1 3CMAZ 4NBHA 4A3CI 1WW9A 4TNUA 1VQ7Z 1RQFA 4RVDA 1YJWZ 3VTNA 1QVFZ 1YI2Z 2JS4A 5T64A 1S721 1M1K1 3VB9A 1N2FA 1VQNZ 2PM9A 3G4SZ 3JAMb 4E2YA 3CCQ1 5AN9F 4DQYB 2VUMI 4NBEA 3NDIA 1M902 3I07A 3I55Z 3S1RI 1YIT1 1DL6A 1ZB9A 3RZDI 4Y52I 2F4MA 3M4OI 3CC7Z 3HKZA 3GTOI 3S1MI 3KIFA 2LIYA 3FQMA 2PK7A 1ZH1A 3I56Z 3CPWY 1Q821 2OTJ1 1TWGI 2O53A 3EEDA
chains in the Genus database with same CATH topology
1X0TA 4MONA 1QVFY 2M6NA 1TWAI 2V8IA 3TE5B 4CL1A 2YU9I 4A3BI 3GCFA 2E2HI 2E2II 1Q7Y2 3CCU1 2QREB 2W04A 2G2KA 3NDJA 1YUAA 4MXUA 2NVYI 1USPA 4A3DI 2JR6A 1VQ4Z 1WCMI 1L1OC 1VQ91 1R9TI 1YHQ1 4E32A 1ML8A 2KI7B 4RVHA 1VQLZ 1Y1VS 1I6HI 2O4HA 1K9M2 4HH4A 4NFRA 3OW2Z 3CME1 4NB9A 1Q812 4MD9A 2NVTI 3NH5A 2M48A 2JUBA 1VQKZ 1LQLA 2KPIA 2RPRA 4S1TA 4E31A 3VMHA 2GTIA 5D1OB 4E2WA 1SFOI 2B63I 2RBLA 4NH1C 3GTJI 1N8R1 3PO3I 4E2XA 5D1PA 3CCMZ 5LL6f 1X3WA 4E30A 3S1QI 5T67A 2LFUA 3PO2I 2E2JI 1M1K2 4MD7A 3NH4A 1Q811 4A3II 2HU9A 2NVXI 3HOYI 5T6BA 3OW2Y 3CPWZ 3LUSA 2QEXZ 4HGZA 4E2ZA 5C4XI 1VQM1 3S17I 3G711 3GTGI 1Y1VI 2K5RA 1VQ81 1KD11 3H3VJ 5IT9b 4A3LI 1YIJZ 2H85A 1Q822 2ZAEB 1I3QI 1VLAA 4RVFA 1VQO1 3S2HI 2JA6I 4NBAA 1Z03A 4A3GI 1YUKA 2YADA 3CCLZ 1VQPZ 1RO4A 1X3ZA 4A3MI 3CCR1 2F4OA 2OZKA 1TWHI 2E9HA 3J81b 3K7AI 5IP9I 3CC41 3S1NI 4Y7NI 4NOZA 2K3RA 2I3CA 3KIHA 4EWCA 2QLVB 2R93I 2QA4Z 4NBBA 3PO3S 2DE5A 1YJ91 3CCV1 4NBCA 2DE6A 3G6E1 3IFUA 2HF1A 1VQ51 3CCSZ 5FLXb 3J80f 4DK1A 3CCJ1 5FLMI 4MD8A 3CCEZ 3D9XA 3CC2Z 3IX0A 1K731 2R7ZI 2QKDA 1K8A1 3CMA1 3CD6Z 4NBGA 1VQ6Z 5D1OA 1Z01A 5A2Qf 2IZ3A 5C3EI 3D6WA 1VQ71 2OTLZ 1YJW1 2JA5I 1QYPA 1JJ2Y 1YI21 1Q861 2GTHA 1N8R2 2Q51A 1VQN1 4MH4A 3G4S1 2DE7A 1S72Z 2QRDB 1NJI1 4A3EI 1PFTA 3I551 4DGLA 4XX2A 2Q4ZA 3CCQZ 2AKLA 4A93I 2WAQA 1RO0A 3FQQA 3CC71 3JAMf 1QVGY 2PMZA 3U50C 1YITZ 3M3YI 3I561 2J6AA 3NH8A 1RO2A 1RLYA 1USPB 4BY1I 3GTKI 1KD12 4BBSI 3GTMS 4RS4A 5C44I 1JWHC 2OTJZ 3HOVI 2P28A 1TWFI 2IZ4A 5IP7I 2JMOA 3CCUZ 1VQ41 1KC81 3IF8A 3S14I 1TWCI 2P3YA 3S16I 3BG0B 4BY7I 2RT9A 1S7MA 1VQL1 3CXCZ 2OOYB 3BG1B 3GTLI 3S2DI 5CM2M 4A3JI 1VQ9Z 1YHQZ 2JA7I 2R92I 2W03A 3F3FC 2V8KA 4RVGA 3MZKB 1JJ2Z 2V8JA 3H0GI 1K732 4HGYA 1KQSZ 1VQK1 3CMEZ 2WB1A 1K8A2 5C4JI 3I4MI 2JNYA 3F3PC 3GTQI 4AYBA 3J7A4 4BBRI 3CCM1 1YJN1 3GTMI 2QRCB 1Y1WI 3HOWI 1Q862 3GKQA 1KRLA 1W2BZ 2Y0SA 3CXCY 1NP6A 4BXXI 2VUGA 1QVGZ 1NJI2 4NBFA 3P5JB 1M901 3MZLB 2QEX1 1WIIA 1K83I 2QR1B 3NFZA 3CQZI 1KQSY 4NBDA 1QF8A 4A3FI 4E33A 3VMGA 1YIJ1 4NB8A 4A3KI 2NVQI 2R6MA 1VQMZ 3G71Z 1Z02A 4QTUA 1VQ8Z 3RZOI 4X6AI 3CCL1 1VQP1 3Q87A 1W2BY 2GU2A 1VQOZ 1Q7Y1 3TDHB 5IT9f 4RV9A 1I50I 1TFIA 3CCRZ 3HOXI 1KC82 2RHBA 2QA41 2BJOA 3J80b 3CC4Z 3GTPI 2RIQA 2VF1A 3I4NI 1NUIA 3FKII 1ZB8A 3J81f 3MONA 2OOXB 2JA8I 3CCS1 3HOUI 1YJ9Z 3CCE1 3CCVZ 1K9M1 3CC21 3G6EZ 4MRIA 3T4NB 1YJNZ 5A2Qb 1VQ5Z 1P9NA 3CD61 4QTTA 1RNIA 3CCJZ 1VQ61 3EERA 3VMIA 3QWUA 2EGTA 5FLXf 3HOZI 3S15I 3ESWA 2OTL1 3CMAZ 4NBHA 4A3CI 1WW9A 4TNUA 1VQ7Z 1RQFA 4RVDA 1YJWZ 3VTNA 1QVFZ 1YI2Z 2JS4A 5T64A 1S721 1M1K1 3VB9A 1N2FA 1VQNZ 2PM9A 3G4SZ 3JAMb 4E2YA 3CCQ1 5AN9F 4DQYB 2VUMI 4NBEA 3NDIA 1M902 3I07A 3I55Z 3S1RI 1YIT1 1DL6A 1ZB9A 3RZDI 4Y52I 2F4MA 3M4OI 3CC7Z 3HKZA 3GTOI 3S1MI 3KIFA 2LIYA 3FQMA 2PK7A 1ZH1A 3I56Z 3CPWY 1Q821 2OTJ1 1TWGI 2O53A 3EEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL 1;  1VQO 1;  1QVF Y;  1VQP 1;  2OTJ Z;  1W2B Y;  3CCL Z;  1VQO Z;  1Q7Y 1;  1VQP Z;  1Q7Y 2;  3CCR 1;  3CCU 1;  3CCR Z;  3CCU Z;  1VQ4 1;  3CC4 1;  1KC8 1;  1KC8 2;  2QA4 1;  1VQ4 Z;  3CC4 Z;  1VQ9 1;  2QA4 Z;  1YHQ 1;  1VQL 1;  3CXC Z;  1YJ9 1;  3CCV 1;  3CCS 1;  1VQ9 Z;  1YHQ Z;  3G6E 1;  1VQL Z;  1YJ9 Z;  3CCE 1;  1VQ5 1;  3CCV Z;  3CCS Z;  1K9M 1;  3CC2 1;  3G6E Z;  1K9M 2;  3CCJ 1;  1YJN Z;  3CCE Z;  1VQ5 Z;  3CC2 Z;  3OW2 Z;  3CD6 1;  3CME 1;  1K73 1;  1VQ6 1;  3CCJ Z;  1JJ2 Z;  1K73 2;  1VQK 1;  1KQS Z;  1K8A 1;  1Q81 2;  3CMA 1;  3CD6 Z;  3CME Z;  1K8A 2;  1VQ6 Z;  1VQK Z;  2OTL 1;  3CMA Z;  1VQ7 1;  2OTL Z;  3CCM 1;  1YJW 1;  1JJ2 Y;  1YI2 1;  1YJN 1;  1N8R 1;  1VQ7 Z;  1Q86 1;  3CCM Z;  1YJW Z;  1N8R 2;  1Q86 2;  1QVF Z;  1YI2 Z;  1VQN 1;  1W2B Z;  1S72 1;  3G4S 1;  3CXC Y;  1M1K 1;  1M1K 2;  1VQN Z;  1Q81 1;  1S72 Z;  3G4S Z;  1NJI 1;  1QVG Z;  3CCQ 1;  1NJI 2;  3I55 1;  1M90 1;  3CCQ Z;  1M90 2;  2QEX 1;  3OW2 Y;  3I55 Z;  3CPW Z;  1YIT 1;  3CC7 1;  1KQS Y;  2QEX Z;  1QVG Y;  1YIT Z;  3CC7 Z;  3I56 1;  1VQM 1;  3G71 1;  1YIJ 1;  1VQ8 1;  3I56 Z;  1VQM Z;  1KD1 1;  3CPW Y;  3G71 Z;  1YIJ Z;  1Q82 1;  1KD1 2;  2OTJ 1;  1Q82 2;  1VQ8 Z; 
#chains in the Genus database with same CATH topology
 1X0T A;  4MON A;  1QVF Y;  2M6N A;  1TWA I;  1WJ2 A;  2V8I A;  3TE5 B;  4CL1 A;  2YU9 I;  4A3B I;  3GCF A;  2E2H I;  2E2I I;  1Q7Y 2;  3CCU 1;  2QRE B;  2W04 A;  2G2K A;  3NDJ A;  1Y8C A;  1YUA A;  1Q16 A;  4MXU A;  2NVY I;  1USP A;  4A3D I;  2JR6 A;  2NAP A;  1VQ4 Z;  1WCM I;  1L1O C;  1VQ9 1;  1R9T I;  1YHQ 1;  4E32 A;  2AYD A;  1ML8 A;  2KI7 B;  4RVH A;  1VQL Z;  1FDO A;  1Y1V S;  1I6H I;  2O4H A;  1K9M 2;  4HH4 A;  4NFR A;  3OW2 Z;  3CME 1;  4NB9 A;  1Q81 2;  4MD9 A;  2NVT I;  3NH5 A;  2M48 A;  2VPZ A;  2JUB A;  1VQK Z;  1LQL A;  2KPI A;  2RPR A;  4S1T A;  4E31 A;  3VMH A;  2GTI A;  5D1O B;  4E2W A;  1SFO I;  2B63 I;  2RBL A;  4NH1 C;  3GTJ I;  1N8R 1;  3PO3 I;  4E2X A;  5D1P A;  3CCM Z;  5LL6 f;  1X3W A;  4E30 A;  3S1Q I;  5T67 A;  2LFU A;  3PO2 I;  2E2J I;  1M1K 2;  4MD7 A;  3NH4 A;  1Q81 1;  4A3I I;  2HU9 A;  2V45 A;  2NVX I;  3HOY I;  5T6B A;  3OW2 Y;  3CPW Z;  3IR7 A;  3LUS A;  2QEX Z;  4HGZ A;  4E2Z A;  5C4X I;  1VQM 1;  3S17 I;  3G71 1;  3GTG I;  1Y1V I;  2K5R A;  1VQ8 1;  1KD1 1;  3H3V J;  5IT9 b;  4A3L I;  1YIJ Z;  2H85 A;  1Q82 2;  2ZAE B;  1I3Q I;  1VLA A;  4RVF A;  1VQO 1;  3S2H I;  2JA6 I;  4NBA A;  1Z03 A;  4A3G I;  1YUK A;  2YAD A;  3CCL Z;  1VQP Z;  1RO4 A;  1X3Z A;  4A3M I;  3CCR 1;  2F4O A;  2OZK A;  1TWH I;  2E9H A;  3J81 b;  3K7A I;  5IP9 I;  3CC4 1;  3S1N I;  4Y7N I;  4NOZ A;  2K3R A;  2I3C A;  3KIH A;  4EWC A;  2QLV B;  2R93 I;  2QA4 Z;  4NBB A;  3PO3 S;  2DE5 A;  1YJ9 1;  3CCV 1;  4NBC A;  2DE6 A;  3G6E 1;  1SIW A;  3IFU A;  2HF1 A;  1VQ5 1;  1QXF A;  3CCS Z;  5FLX b;  3J80 f;  4DK1 A;  3CCJ 1;  5FLM I;  4MD8 A;  2VPW A;  3CCE Z;  3D9X A;  3CC2 Z;  3IX0 A;  1K73 1;  2R7Z I;  2JIM A;  2QKD A;  2V3V A;  1K8A 1;  3CMA 1;  3CD6 Z;  4NBG A;  1VQ6 Z;  5D1O A;  1Z01 A;  5A2Q f;  2IZ3 A;  5C3E I;  3D6W A;  1VQ7 1;  2OTL Z;  1YJW 1;  2JA5 I;  1QYP A;  1JJ2 Y;  1YI2 1;  1Q86 1;  2GTH A;  1N8R 2;  2Q51 A;  2VPX A;  1VQN 1;  4MH4 A;  3G4S 1;  2DE7 A;  1S72 Z;  2QRD B;  1NJI 1;  4A3E I;  1PFT A;  3I55 1;  4DGL A;  4XX2 A;  2Q4Z A;  3CCQ Z;  2LEX A;  2AKL A;  4A93 I;  2WAQ A;  1RO0 A;  3FQQ A;  3CC7 1;  3JAM f;  1QVG Y;  2PMZ A;  3U50 C;  1YIT Z;  3M3Y I;  1WZN A;  3I56 1;  2J6A A;  3NH8 A;  1RO2 A;  1RLY A;  1USP B;  4BY1 I;  3GTK I;  1KD1 2;  4BBS I;  3GTM S;  4RS4 A;  5C44 I;  1JWH C;  2OTJ Z;  3HOV I;  2P28 A;  1TWF I;  2IZ4 A;  5IP7 I;  2JMO A;  2JIP A;  3CCU Z;  1VQ4 1;  1KC8 1;  3IF8 A;  3S14 I;  1TWC I;  2P3Y A;  3S16 I;  3BG0 B;  4BY7 I;  2RT9 A;  1S7M A;  1VQL 1;  3CXC Z;  2OOY B;  3BG1 B;  3GTL I;  3S2D I;  5CM2 M;  4A3J I;  1VQ9 Z;  1YHQ Z;  2JA7 I;  2R92 I;  2W03 A;  3F3F C;  2V8K A;  4RVG A;  3D2L A;  3MZK B;  1JJ2 Z;  2V8J A;  3H0G I;  1K73 2;  4HGY A;  1KQS Z;  1VQK 1;  3CME Z;  2WB1 A;  1K8A 2;  5C4J I;  3I4M I;  2JNY A;  3F3P C;  3GTQ I;  4AYB A;  3J7A 4;  4BBR I;  3CCM 1;  2JIO A;  1YJN 1;  3GTM I;  2QRC B;  1Y1W I;  3HOW I;  1Q86 2;  1AA6 A;  3GKQ A;  1KRL A;  1W2B Z;  2Y0S A;  3CXC Y;  1NP6 A;  4BXX I;  2VUG A;  1QVG Z;  1NJI 2;  4NBF A;  3P5J B;  1M90 1;  3MZL B;  2QEX 1;  1WII A;  2JIR A;  1K83 I;  2QR1 B;  3NFZ A;  3CQZ I;  1KQS Y;  1FDI A;  4NBD A;  1QF8 A;  4A3F I;  4E33 A;  3VMG A;  1YIJ 1;  4NB8 A;  4A3K I;  2NVQ I;  2R6M A;  1VQM Z;  3G71 Z;  1Z02 A;  4QTU A;  1VQ8 Z;  3RZO I;  4X6A I;  2IV2 X;  3CCL 1;  1VQP 1;  3Q87 A;  2E7Z A;  1W2B Y;  2GU2 A;  1VQO Z;  1Q7Y 1;  3TDH B;  5IT9 f;  4RV9 A;  1I50 I;  1TFI A;  3CCR Z;  3HOX I;  1KC8 2;  2RHB A;  2QA4 1;  2BJO A;  3J80 b;  3CC4 Z;  3GTP I;  2RIQ A;  2VF1 A;  3I4N I;  1NUI A;  3FKI I;  1ZB8 A;  3J81 f;  3MON A;  2OOX B;  2JA8 I;  3CCS 1;  3HOU I;  1YJ9 Z;  3CCE 1;  3CCV Z;  1K9M 1;  3CC2 1;  3G6E Z;  4MRI A;  2JIQ A;  3T4N B;  1YJN Z;  5A2Q b;  1VQ5 Z;  1P9N A;  3CD6 1;  4QTT A;  1RNI A;  3CCJ Z;  1VQ6 1;  3EER A;  3VMI A;  3QWU A;  2EGT A;  2VPY A;  5FLX f;  3HOZ I;  3S15 I;  3ESW A;  2OTL 1;  3CMA Z;  4NBH A;  4A3C I;  1WW9 A;  4TNU A;  1VQ7 Z;  1RQF A;  4RVD A;  1YJW Z;  3VTN A;  1QVF Z;  1YI2 Z;  2JS4 A;  5T64 A;  1S72 1;  1M1K 1;  3VB9 A;  1N2F A;  1VQN Z;  2PM9 A;  3G4S Z;  3JAM b;  4E2Y A;  3CCQ 1;  5AN9 F;  4DQY B;  2VUM I;  4NBE A;  3NDI A;  1M90 2;  3I07 A;  3I55 Z;  3S1R I;  1YIT 1;  1DL6 A;  1ZB9 A;  3RZD I;  4Y52 I;  2F4M A;  3M4O I;  3CC7 Z;  3HKZ A;  3GTO I;  3S1M I;  3KIF A;  2LIY A;  3FQM A;  2PK7 A;  1ZH1 A;  3I56 Z;  3CPW Y;  1Q82 1;  2OTJ 1;  1TWG I;  2O53 A;  3EED A; 
#chains in the Genus database with same CATH homology
 1X0T A;  4MON A;  1QVF Y;  2M6N A;  1TWA I;  2V8I A;  3TE5 B;  4CL1 A;  2YU9 I;  4A3B I;  3GCF A;  2E2H I;  2E2I I;  1Q7Y 2;  3CCU 1;  2QRE B;  2W04 A;  2G2K A;  3NDJ A;  1YUA A;  4MXU A;  2NVY I;  1USP A;  4A3D I;  2JR6 A;  1VQ4 Z;  1WCM I;  1L1O C;  1VQ9 1;  1R9T I;  1YHQ 1;  4E32 A;  1ML8 A;  2KI7 B;  4RVH A;  1VQL Z;  1Y1V S;  1I6H I;  2O4H A;  1K9M 2;  4HH4 A;  4NFR A;  3OW2 Z;  3CME 1;  4NB9 A;  1Q81 2;  4MD9 A;  2NVT I;  3NH5 A;  2M48 A;  2JUB A;  1VQK Z;  1LQL A;  2KPI A;  2RPR A;  4S1T A;  4E31 A;  3VMH A;  2GTI A;  5D1O B;  4E2W A;  1SFO I;  2B63 I;  2RBL A;  4NH1 C;  3GTJ I;  1N8R 1;  3PO3 I;  4E2X A;  5D1P A;  3CCM Z;  5LL6 f;  1X3W A;  4E30 A;  3S1Q I;  5T67 A;  2LFU A;  3PO2 I;  2E2J I;  1M1K 2;  4MD7 A;  3NH4 A;  1Q81 1;  4A3I I;  2HU9 A;  2NVX I;  3HOY I;  5T6B A;  3OW2 Y;  3CPW Z;  3LUS A;  2QEX Z;  4HGZ A;  4E2Z A;  5C4X I;  1VQM 1;  3S17 I;  3G71 1;  3GTG I;  1Y1V I;  2K5R A;  1VQ8 1;  1KD1 1;  3H3V J;  5IT9 b;  4A3L I;  1YIJ Z;  2H85 A;  1Q82 2;  2ZAE B;  1I3Q I;  1VLA A;  4RVF A;  1VQO 1;  3S2H I;  2JA6 I;  4NBA A;  1Z03 A;  4A3G I;  1YUK A;  2YAD A;  3CCL Z;  1VQP Z;  1RO4 A;  1X3Z A;  4A3M I;  3CCR 1;  2F4O A;  2OZK A;  1TWH I;  2E9H A;  3J81 b;  3K7A I;  5IP9 I;  3CC4 1;  3S1N I;  4Y7N I;  4NOZ A;  2K3R A;  2I3C A;  3KIH A;  4EWC A;  2QLV B;  2R93 I;  2QA4 Z;  4NBB A;  3PO3 S;  2DE5 A;  1YJ9 1;  3CCV 1;  4NBC A;  2DE6 A;  3G6E 1;  3IFU A;  2HF1 A;  1VQ5 1;  3CCS Z;  5FLX b;  3J80 f;  4DK1 A;  3CCJ 1;  5FLM I;  4MD8 A;  3CCE Z;  3D9X A;  3CC2 Z;  3IX0 A;  1K73 1;  2R7Z I;  2QKD A;  1K8A 1;  3CMA 1;  3CD6 Z;  4NBG A;  1VQ6 Z;  5D1O A;  1Z01 A;  5A2Q f;  2IZ3 A;  5C3E I;  3D6W A;  1VQ7 1;  2OTL Z;  1YJW 1;  2JA5 I;  1QYP A;  1JJ2 Y;  1YI2 1;  1Q86 1;  2GTH A;  1N8R 2;  2Q51 A;  1VQN 1;  4MH4 A;  3G4S 1;  2DE7 A;  1S72 Z;  2QRD B;  1NJI 1;  4A3E I;  1PFT A;  3I55 1;  4DGL A;  4XX2 A;  2Q4Z A;  3CCQ Z;  2AKL A;  4A93 I;  2WAQ A;  1RO0 A;  3FQQ A;  3CC7 1;  3JAM f;  1QVG Y;  2PMZ A;  3U50 C;  1YIT Z;  3M3Y I;  3I56 1;  2J6A A;  3NH8 A;  1RO2 A;  1RLY A;  1USP B;  4BY1 I;  3GTK I;  1KD1 2;  4BBS I;  3GTM S;  4RS4 A;  5C44 I;  1JWH C;  2OTJ Z;  3HOV I;  2P28 A;  1TWF I;  2IZ4 A;  5IP7 I;  2JMO A;  3CCU Z;  1VQ4 1;  1KC8 1;  3IF8 A;  3S14 I;  1TWC I;  2P3Y A;  3S16 I;  3BG0 B;  4BY7 I;  2RT9 A;  1S7M A;  1VQL 1;  3CXC Z;  2OOY B;  3BG1 B;  3GTL I;  3S2D I;  5CM2 M;  4A3J I;  1VQ9 Z;  1YHQ Z;  2JA7 I;  2R92 I;  2W03 A;  3F3F C;  2V8K A;  4RVG A;  3MZK B;  1JJ2 Z;  2V8J A;  3H0G I;  1K73 2;  4HGY A;  1KQS Z;  1VQK 1;  3CME Z;  2WB1 A;  1K8A 2;  5C4J I;  3I4M I;  2JNY A;  3F3P C;  3GTQ I;  4AYB A;  3J7A 4;  4BBR I;  3CCM 1;  1YJN 1;  3GTM I;  2QRC B;  1Y1W I;  3HOW I;  1Q86 2;  3GKQ A;  1KRL A;  1W2B Z;  2Y0S A;  3CXC Y;  1NP6 A;  4BXX I;  2VUG A;  1QVG Z;  1NJI 2;  4NBF A;  3P5J B;  1M90 1;  3MZL B;  2QEX 1;  1WII A;  1K83 I;  2QR1 B;  3NFZ A;  3CQZ I;  1KQS Y;  4NBD A;  1QF8 A;  4A3F I;  4E33 A;  3VMG A;  1YIJ 1;  4NB8 A;  4A3K I;  2NVQ I;  2R6M A;  1VQM Z;  3G71 Z;  1Z02 A;  4QTU A;  1VQ8 Z;  3RZO I;  4X6A I;  3CCL 1;  1VQP 1;  3Q87 A;  1W2B Y;  2GU2 A;  1VQO Z;  1Q7Y 1;  3TDH B;  5IT9 f;  4RV9 A;  1I50 I;  1TFI A;  3CCR Z;  3HOX I;  1KC8 2;  2RHB A;  2QA4 1;  2BJO A;  3J80 b;  3CC4 Z;  3GTP I;  2RIQ A;  2VF1 A;  3I4N I;  1NUI A;  3FKI I;  1ZB8 A;  3J81 f;  3MON A;  2OOX B;  2JA8 I;  3CCS 1;  3HOU I;  1YJ9 Z;  3CCE 1;  3CCV Z;  1K9M 1;  3CC2 1;  3G6E Z;  4MRI A;  3T4N B;  1YJN Z;  5A2Q b;  1VQ5 Z;  1P9N A;  3CD6 1;  4QTT A;  1RNI A;  3CCJ Z;  1VQ6 1;  3EER A;  3VMI A;  3QWU A;  2EGT A;  5FLX f;  3HOZ I;  3S15 I;  3ESW A;  2OTL 1;  3CMA Z;  4NBH A;  4A3C I;  1WW9 A;  4TNU A;  1VQ7 Z;  1RQF A;  4RVD A;  1YJW Z;  3VTN A;  1QVF Z;  1YI2 Z;  2JS4 A;  5T64 A;  1S72 1;  1M1K 1;  3VB9 A;  1N2F A;  1VQN Z;  2PM9 A;  3G4S Z;  3JAM b;  4E2Y A;  3CCQ 1;  5AN9 F;  4DQY B;  2VUM I;  4NBE A;  3NDI A;  1M90 2;  3I07 A;  3I55 Z;  3S1R I;  1YIT 1;  1DL6 A;  1ZB9 A;  3RZD I;  4Y52 I;  2F4M A;  3M4O I;  3CC7 Z;  3HKZ A;  3GTO I;  3S1M I;  3KIF A;  2LIY A;  3FQM A;  2PK7 A;  1ZH1 A;  3I56 Z;  3CPW Y;  1Q82 1;  2OTJ 1;  1TWG I;  2O53 A;  3EED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...