1VQ81

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8100
1K9M1 1K8A2 3CCM1 1Q7Y1 1KQSZ 1YJWZ 1NJI1 1K9M2 3CCSZ 2QEX1 3CCVZ 1YIJZ 1S72Z 1VQ9Z 1NJI2 1QVGZ 3CCQ1 3CC2Z 1VQN1 1M902 3CCRZ 3CXCZ 3I561 3CMEZ 1Q861 1VQ7Z 1YJN1 2OTL1 1Q862 1KQSY 3G71Z 3OW2Y 3CCE1 3CCJZ 1VQKZ 3CPWZ 1VQP1 1Q821 3CMAZ 3CXCY 3CCMZ 1Q822 1VQ81 2QEXZ 3CC41 3CCL1 1YJ91 1M901 1VQL1 1VQ61 3G6E1 3CCQZ 1M1K2 1VQNZ 3I56Z 3CPWY 1YIT1 1K731 1YJNZ 2OTLZ 3I551 1K732 1YHQ1 1W2BZ 3CCEZ 1QVFZ 1VQPZ 3CD61 1QVGY 3G4S1 1VQ8Z 2QA41 1YI21 1VQ41 1N8R1 3CCLZ 1M1K1 3CC4Z 1YJ9Z 1VQ6Z 2OTJ1 1Q811 1VQO1 1VQ51 1KC81 1N8R2 1QVFY 1Q812 1KC82 1VQK1 1YITZ 3CC71 3CCU1 3I55Z 1VQM1 1JJ2Z 1KD12 1YHQZ 1YJW1 3CD6Z 3CCS1 3OW2Z 3CCV1 1YIJ1 1S721 1Q7Y2 1VQ91 3CC21 3G4SZ 2QA4Z 1YI2Z 1VQ4Z 3CCR1 3CME1 1VQLZ 1VQ71 2OTJZ 3G6EZ 1VQOZ 1VQ5Z 1JJ2Y 1W2BY 3G711 3CCJ1 1KD11 1K8A1 3CC7Z 3CCUZ 1VQMZ 3CMA1
chains in the Genus database with same CATH superfamily
3VB9A 4NBFA 2V45A 3HKZA 2QREB 4NBGA 1NJI1 1K9M2 4DK1A 5D1OB 3CCQ1 3CC2Z 3M3YI 5T6BA 5A2Qf 2KI7B 2JIQA 3VMIA 2F4OA 1Q16A 4NFRA 3RZOI 2R6MA 4A3MI 3GTQI 3OW2Y 1VQKZ 3CCJZ 4RS4A 4RVFA 3I4MI 2QR1B 3D6WA 3BG1B 1PFTA 1N2FA 4BBRI 3S1NI 2WAQA 2Y0SA 3NDJA 3GTJI 3CCQZ 2RIQA 1Y1VS 2EGTA 5FLXf 3K7AI 2V3VA 1YIT1 1KRLA 3S16I 2R93I 3I551 3ESWA 1K732 1K83I 1VLAA 4RVGA 1W2BZ 3IX0A 5T67A 2Q4ZA 3S1MI 2YADA 3NH8A 4E2WA 4E33A 2JIRA 1VQ51 1KC81 1N8R2 2PK7A 3U50C 2VPWA 1YITZ 3I55Z 1RNIA 2P28A 1ML8A 3D2LA 1S721 2JUBA 4E32A 3F3FC 3J80f 1Z02A 2M48A 3J7A4 1VQ71 5A2Qb 4DGLA 4A3LI 1RO2A 1JJ2Y 1VQ5Z 2DE5A 4MD7A 1W2BY 3J81f 4E30A 4BY1I 4A3FI 4TNUA 2QRDB 1K8A1 1USPA 4E31A 1I3QI 2V8KA 2LEXA 2JIMA 2B63I 2R7ZI 4RV9A 3GTMS 2K3RA 2IV2X 3PO3S 3GTOI 2QEX1 5IT9f 1RLYA 1S72Z 1Z03A 1NJI2 2M6NA 3HOWI 4HGZA 1VQN1 1R9TI 1Q861 1VQ7Z 2VPYA 4MXUA 1Z01A 1YJN1 2OTL1 2P3YA 2OZKA 4S1TA 3CCE1 3GTKI 1Q821 2V8JA 1VQ81 1YUAA 2QEXZ 3CCL1 1VQL1 5D1PA 2JNYA 3G6E1 1RO0A 1VQNZ 2YU9I 2K5RA 3CPWY 1RQFA 3GTGI 1X0TA 1YJNZ 2OTLZ 2Q51A 5D1OA 5CM2M 3PO2I 3CCEZ 4NBAA 3I07A 2VUMI 3S1QI 2RBLA 1VQ8Z 1VQ41 5IP9I 1QXFA 2RT9A 3IR7A 5C3EI 3CCLZ 3J80b 4NBDA 1Q811 1WIIA 2ZAEB 3IF8A 1QVFY 1KC82 5AN9F 3J81b 3T4NB 3CCU1 2QRCB 4A3GI 2JA6I 3IFUA 1JJ2Z 1KD12 1SIWA 2QKDA 4NBCA 4XX2A 1YJW1 4A3EI 2OOXB 3CCV1 1YIJ1 1Q7Y2 5IT9b 3S17I 3EERA 2IZ3A 4NBBA 2LFUA 1VQ4Z 3CCR1 3CME1 1ZB9A 1ZH1A 1ZB8A 2JR6A 2HF1A 2JA7I 3S2DI 4A93I 5FLMI 1KD11 4BY7I 3CCUZ 3S1RI 1WJ2A 3CMA1 1L1OC 2JIOA 1K8A2 1RO4A 1Q7Y1 1YJWZ 1TWAI 3S14I 3CCVZ 1YIJZ 3GKQA 2E2JI 1WZNA 1QVGZ 4RVHA 3F3PC 3CCRZ 2VUGA 4A3JI 3CMEZ 4A3KI 4AYBA 1Q862 1KQSY 1TFIA 3EEDA 2AKLA 3CPWZ 1VQP1 3HOVI 4DQYB 3CMAZ 3VMGA 1P9NA 1NUIA 1LQLA 3CXCY 1Q822 3GTPI 2NAPA 2PMZA 3CC41 1YJ91 3FQQA 4EWCA 1M1K2 2RHBA 2IZ4A 4MD9A 5FLXb 4BXXI 3KIHA 1Y8CA 2G2KA 4NBHA 1YHQ1 1QVFZ 2HU9A 3NDIA 1VQPZ 1QF8A 3P5JB 3FKII 1QVGY 4HH4A 5T64A 2VF1A 1YI21 2E9HA 3CC4Z 1M1K1 1YJ9Z 2OTJ1 3MONA 1WCMI 4X6AI 1WW9A 3BG0B 2WB1A 3VTNA 4NBEA 4Y7NI 1Q812 1Y1VI 4NOZA 4MONA 1VQK1 3CC71 2LIYA 4E2YA 1I50I 2I3CA 1YHQZ 3HOXI 3D9XA 3Q87A 4CL1A 3CCS1 1VQ91 2JA5I 3TDHB 3RZDI 1YI2Z 3TE5B 1VQLZ 1QYPA 2NVTI 2OTJZ 2R92I 3G6EZ 2VPXA 2KPIA 3G711 4HGYA 2RPRA 2W04A 3CC7Z 2DE7A 2O53A 3NFZA 2E2HI 1K9M1 3NH5A 3CCM1 1KQSZ 3CCSZ 3HOZI 1S7MA 1Y1WI 3GTLI 3JAMf 5C4JI 1VQ9Z 4MRIA 2V8IA 4Y52I 1M902 2H85A 3CXCZ 3I561 2QLVB 1FDOA 3GCFA 3H0GI 2W03A 4MH4A 3G71Z 3VMHA 2GTHA 2E7ZA 4MD8A 4A3BI 4A3II 5C44I 4A3CI 3CCMZ 4BBSI 1TWFI 3GTMI 4RVDA 2O4HA 1M901 1VQ61 3PO3I 1AA6A 2OOYB 3I56Z 2GU2A 5LL6f 3HOUI 3HOYI 1K731 1TWHI 2AYDA 2JMOA 4E2ZA 1NP6A 3S15I 4QTUA 4QTTA 2JA8I 3CD61 4NB8A 2DE6A 1JWHC 3H3VJ 2NVXI 2BJOA 5C4XI 3G4S1 2NVYI 2QA41 1N8R1 2JIPA 3NH4A 1VQ6Z 2NVQI 1USPB 5IP7I 1VQO1 3MZLB 1X3ZA 3FQMA 2PM9A 4A3DI 1DL6A 3S2HI 3MZKB 1X3WA 1VQM1 4NB9A 2F4MA 1TWCI 3CD6Z 3OW2Z 3CQZI 2J6AA 2VPZA 2E2II 3CC21 3JAMb 2JS4A 3KIFA 3G4SZ 2QA4Z 1YUKA 4NH1C 1I6HI 1TWGI 3LUSA 1VQOZ 1FDIA 3CCJ1 4E2XA 3M4OI 3I4NI 1SFOI 1VQMZ 3QWUA 2GTIA
chains in the Genus database with same CATH topology
3VB9A 4NBFA 3HKZA 1NJI1 2QREB 4NBGA 1K9M2 4DK1A 5D1OB 3CCQ1 3CC2Z 3M3YI 5T6BA 5A2Qf 2KI7B 3VMIA 2F4OA 4NFRA 3RZOI 2R6MA 4A3MI 3GTQI 3OW2Y 1VQKZ 3CCJZ 4RS4A 4RVFA 3I4MI 2QR1B 3D6WA 3BG1B 1PFTA 1N2FA 4BBRI 3S1NI 2WAQA 2Y0SA 3NDJA 3GTJI 3CCQZ 2RIQA 1Y1VS 2EGTA 5FLXf 3K7AI 1YIT1 1KRLA 3S16I 2R93I 3I551 3ESWA 1K732 1K83I 1VLAA 4RVGA 1W2BZ 3IX0A 5T67A 2Q4ZA 3S1MI 2YADA 3NH8A 4E2WA 4E33A 1VQ51 1KC81 1N8R2 2PK7A 3U50C 1YITZ 3I55Z 1RNIA 2P28A 1ML8A 1S721 2JUBA 4E32A 3F3FC 3J80f 1Z02A 2M48A 3J7A4 1VQ71 5A2Qb 4DGLA 4A3LI 1RO2A 1JJ2Y 1VQ5Z 2DE5A 4MD7A 1W2BY 3J81f 4E30A 4BY1I 4A3FI 4TNUA 2QRDB 1K8A1 1USPA 4E31A 1I3QI 2V8KA 2B63I 2R7ZI 4RV9A 3GTMS 2K3RA 3PO3S 3GTOI 2QEX1 5IT9f 1RLYA 1S72Z 1Z03A 1NJI2 2M6NA 3HOWI 4HGZA 1VQN1 1R9TI 1Q861 1VQ7Z 4MXUA 1Z01A 1YJN1 2OTL1 2P3YA 2OZKA 4S1TA 3CCE1 3GTKI 1Q821 2V8JA 1VQ81 1YUAA 2QEXZ 3CCL1 1VQL1 5D1PA 2JNYA 3G6E1 1RO0A 1VQNZ 2YU9I 2K5RA 3CPWY 1RQFA 3GTGI 1X0TA 1YJNZ 2OTLZ 2Q51A 5D1OA 5CM2M 3PO2I 3CCEZ 4NBAA 3I07A 2VUMI 3S1QI 2RBLA 1VQ8Z 1VQ41 5IP9I 3J80b 2RT9A 5C3EI 3CCLZ 4NBDA 1Q811 1WIIA 2ZAEB 3IF8A 1QVFY 1KC82 5AN9F 3J81b 3T4NB 3CCU1 2QRCB 4A3GI 2JA6I 3IFUA 1JJ2Z 1KD12 4NBCA 2QKDA 4XX2A 1YJW1 4A3EI 2OOXB 3CCV1 1YIJ1 1Q7Y2 5IT9b 3S17I 3EERA 2IZ3A 4NBBA 2LFUA 1VQ4Z 3CCR1 3CME1 1ZB9A 1ZH1A 1ZB8A 2JR6A 2HF1A 2JA7I 3S2DI 4A93I 5FLMI 1KD11 4BY7I 3CCUZ 3S1RI 3CMA1 1L1OC 1K8A2 1RO4A 1Q7Y1 1YJWZ 1TWAI 3S14I 3CCVZ 1YIJZ 3GKQA 2E2JI 1QVGZ 4RVHA 3F3PC 3CCRZ 2VUGA 4A3JI 3CMEZ 4A3KI 4AYBA 1Q862 1KQSY 1TFIA 3EEDA 2AKLA 3CPWZ 1VQP1 3HOVI 4DQYB 3CMAZ 3VMGA 1P9NA 1NUIA 1LQLA 3CXCY 1Q822 3GTPI 2PMZA 3CC41 1YJ91 3FQQA 4EWCA 1M1K2 2RHBA 2IZ4A 4MD9A 5FLXb 4BXXI 3KIHA 2G2KA 4NBHA 1YHQ1 1QVFZ 2HU9A 3NDIA 1VQPZ 1QF8A 3P5JB 3FKII 1QVGY 4HH4A 5T64A 2VF1A 1YI21 2E9HA 3CC4Z 1M1K1 1YJ9Z 2OTJ1 3MONA 1WCMI 4X6AI 1WW9A 3BG0B 2WB1A 3VTNA 4NBEA 4Y7NI 1Q812 1Y1VI 4NOZA 4MONA 1VQK1 3CC71 2LIYA 4E2YA 1I50I 2I3CA 1YHQZ 3HOXI 3D9XA 3Q87A 4CL1A 3CCS1 1VQ91 2JA5I 3TDHB 3RZDI 1YI2Z 3TE5B 1VQLZ 1QYPA 2NVTI 2OTJZ 2R92I 3G6EZ 2KPIA 3G711 4HGYA 2RPRA 2W04A 3CC7Z 2DE7A 2O53A 3NFZA 2E2HI 1K9M1 3NH5A 3CCM1 1KQSZ 3CCSZ 3HOZI 1S7MA 1Y1WI 3GTLI 3JAMf 5C4JI 1VQ9Z 4MRIA 2V8IA 4Y52I 1M902 2H85A 3CXCZ 3I561 2QLVB 3GCFA 3H0GI 2W03A 4MH4A 3G71Z 3VMHA 2GTHA 4MD8A 4A3BI 4A3II 5C44I 4A3CI 3CCMZ 4BBSI 1TWFI 3GTMI 4RVDA 2O4HA 1M901 1VQ61 3PO3I 2OOYB 3I56Z 2GU2A 5LL6f 3HOUI 3HOYI 1K731 1TWHI 2JMOA 4E2ZA 1NP6A 3S15I 4QTUA 4QTTA 2JA8I 3CD61 4NB8A 2DE6A 1JWHC 3H3VJ 2NVXI 2BJOA 5C4XI 3G4S1 2NVYI 2QA41 1N8R1 3NH4A 1VQ6Z 2NVQI 1USPB 5IP7I 1VQO1 3MZLB 1X3ZA 3FQMA 2PM9A 4A3DI 1DL6A 3S2HI 3MZKB 1X3WA 1VQM1 4NB9A 2F4MA 1TWCI 3CD6Z 3OW2Z 3CQZI 2J6AA 2E2II 3CC21 3JAMb 2JS4A 3KIFA 3G4SZ 2QA4Z 1YUKA 4NH1C 1I6HI 1TWGI 3LUSA 1VQOZ 3CCJ1 4E2XA 3M4OI 3I4NI 1SFOI 1VQMZ 3QWUA 2GTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9M 1;  1K8A 2;  3CCM 1;  1Q7Y 1;  1KQS Z;  1YJW Z;  1NJI 1;  1K9M 2;  3CCS Z;  2QEX 1;  3CCV Z;  1YIJ Z;  1S72 Z;  1VQ9 Z;  1NJI 2;  1QVG Z;  3CCQ 1;  3CC2 Z;  1VQN 1;  1M90 2;  3CCR Z;  3CXC Z;  3I56 1;  3CME Z;  1Q86 1;  1VQ7 Z;  1YJN 1;  2OTL 1;  1Q86 2;  1KQS Y;  3G71 Z;  3OW2 Y;  3CCE 1;  3CCJ Z;  1VQK Z;  3CPW Z;  1VQP 1;  1Q82 1;  3CMA Z;  3CXC Y;  3CCM Z;  1Q82 2;  1VQ8 1;  2QEX Z;  3CC4 1;  3CCL 1;  1YJ9 1;  1M90 1;  1VQL 1;  1VQ6 1;  3G6E 1;  3CCQ Z;  1M1K 2;  1VQN Z;  3I56 Z;  3CPW Y;  1YIT 1;  1K73 1;  1YJN Z;  2OTL Z;  3I55 1;  1K73 2;  1YHQ 1;  1W2B Z;  3CCE Z;  1QVF Z;  1VQP Z;  3CD6 1;  1QVG Y;  3G4S 1;  1VQ8 Z;  2QA4 1;  1YI2 1;  1VQ4 1;  1N8R 1;  3CCL Z;  1M1K 1;  3CC4 Z;  1YJ9 Z;  1VQ6 Z;  2OTJ 1;  1Q81 1;  1VQO 1;  1VQ5 1;  1KC8 1;  1N8R 2;  1QVF Y;  1Q81 2;  1KC8 2;  1VQK 1;  1YIT Z;  3CC7 1;  3CCU 1;  3I55 Z;  1VQM 1;  1JJ2 Z;  1KD1 2;  1YHQ Z;  1YJW 1;  3CD6 Z;  3CCS 1;  3OW2 Z;  3CCV 1;  1YIJ 1;  1S72 1;  1Q7Y 2;  1VQ9 1;  3CC2 1;  3G4S Z;  2QA4 Z;  1YI2 Z;  1VQ4 Z;  3CCR 1;  3CME 1;  1VQL Z;  1VQ7 1;  2OTJ Z;  3G6E Z;  1VQO Z;  1VQ5 Z;  1JJ2 Y;  1W2B Y;  3G71 1;  3CCJ 1;  1KD1 1;  1K8A 1;  3CC7 Z;  3CCU Z;  1VQM Z;  3CMA 1; 
#chains in the Genus database with same CATH topology
 3VB9 A;  4NBF A;  2V45 A;  3HKZ A;  2QRE B;  4NBG A;  1NJI 1;  1K9M 2;  4DK1 A;  5D1O B;  3CCQ 1;  3CC2 Z;  3M3Y I;  5T6B A;  5A2Q f;  2KI7 B;  2JIQ A;  3VMI A;  2F4O A;  1Q16 A;  4NFR A;  3RZO I;  2R6M A;  4A3M I;  3GTQ I;  3OW2 Y;  1VQK Z;  3CCJ Z;  4RS4 A;  4RVF A;  3I4M I;  2QR1 B;  3D6W A;  3BG1 B;  1PFT A;  1N2F A;  4BBR I;  3S1N I;  2WAQ A;  2Y0S A;  3NDJ A;  3GTJ I;  3CCQ Z;  2RIQ A;  1Y1V S;  2EGT A;  5FLX f;  3K7A I;  2V3V A;  1YIT 1;  1KRL A;  3S16 I;  2R93 I;  3I55 1;  3ESW A;  1K73 2;  1K83 I;  1VLA A;  4RVG A;  1W2B Z;  3IX0 A;  5T67 A;  2Q4Z A;  3S1M I;  2YAD A;  3NH8 A;  4E2W A;  4E33 A;  2JIR A;  1VQ5 1;  1KC8 1;  1N8R 2;  2PK7 A;  3U50 C;  2VPW A;  1YIT Z;  3I55 Z;  1RNI A;  2P28 A;  1ML8 A;  3D2L A;  1S72 1;  2JUB A;  4E32 A;  3F3F C;  3J80 f;  1Z02 A;  2M48 A;  3J7A 4;  1VQ7 1;  5A2Q b;  4DGL A;  4A3L I;  1RO2 A;  1JJ2 Y;  1VQ5 Z;  2DE5 A;  4MD7 A;  1W2B Y;  3J81 f;  4E30 A;  4BY1 I;  4A3F I;  4TNU A;  2QRD B;  1K8A 1;  1USP A;  4E31 A;  1I3Q I;  2V8K A;  2LEX A;  2JIM A;  2B63 I;  2R7Z I;  4RV9 A;  3GTM S;  2K3R A;  2IV2 X;  3PO3 S;  3GTO I;  2QEX 1;  5IT9 f;  1RLY A;  1S72 Z;  1Z03 A;  1NJI 2;  2M6N A;  3HOW I;  4HGZ A;  1VQN 1;  1R9T I;  1Q86 1;  1VQ7 Z;  2VPY A;  4MXU A;  1Z01 A;  1YJN 1;  2OTL 1;  2P3Y A;  2OZK A;  4S1T A;  3CCE 1;  3GTK I;  1Q82 1;  2V8J A;  1VQ8 1;  1YUA A;  2QEX Z;  3CCL 1;  1VQL 1;  5D1P A;  2JNY A;  3G6E 1;  1RO0 A;  1VQN Z;  2YU9 I;  2K5R A;  3CPW Y;  1RQF A;  3GTG I;  1X0T A;  1YJN Z;  2OTL Z;  2Q51 A;  5D1O A;  5CM2 M;  3PO2 I;  3CCE Z;  4NBA A;  3I07 A;  2VUM I;  3S1Q I;  2RBL A;  1VQ8 Z;  1VQ4 1;  5IP9 I;  1QXF A;  2RT9 A;  3IR7 A;  5C3E I;  3CCL Z;  3J80 b;  4NBD A;  1Q81 1;  1WII A;  2ZAE B;  3IF8 A;  1QVF Y;  1KC8 2;  5AN9 F;  3J81 b;  3T4N B;  3CCU 1;  2QRC B;  4A3G I;  2JA6 I;  3IFU A;  1JJ2 Z;  1KD1 2;  1SIW A;  2QKD A;  4NBC A;  4XX2 A;  1YJW 1;  4A3E I;  2OOX B;  3CCV 1;  1YIJ 1;  1Q7Y 2;  5IT9 b;  3S17 I;  3EER A;  2IZ3 A;  4NBB A;  2LFU A;  1VQ4 Z;  3CCR 1;  3CME 1;  1ZB9 A;  1ZH1 A;  1ZB8 A;  2JR6 A;  2HF1 A;  2JA7 I;  3S2D I;  4A93 I;  5FLM I;  1KD1 1;  4BY7 I;  3CCU Z;  3S1R I;  1WJ2 A;  3CMA 1;  1L1O C;  2JIO A;  1K8A 2;  1RO4 A;  1Q7Y 1;  1YJW Z;  1TWA I;  3S14 I;  3CCV Z;  1YIJ Z;  3GKQ A;  2E2J I;  1WZN A;  1QVG Z;  4RVH A;  3F3P C;  3CCR Z;  2VUG A;  4A3J I;  3CME Z;  4A3K I;  4AYB A;  1Q86 2;  1KQS Y;  1TFI A;  3EED A;  2AKL A;  3CPW Z;  1VQP 1;  3HOV I;  4DQY B;  3CMA Z;  3VMG A;  1P9N A;  1NUI A;  1LQL A;  3CXC Y;  1Q82 2;  3GTP I;  2NAP A;  2PMZ A;  3CC4 1;  1YJ9 1;  3FQQ A;  4EWC A;  1M1K 2;  2RHB A;  2IZ4 A;  4MD9 A;  5FLX b;  4BXX I;  3KIH A;  1Y8C A;  2G2K A;  4NBH A;  1YHQ 1;  1QVF Z;  2HU9 A;  3NDI A;  1VQP Z;  1QF8 A;  3P5J B;  3FKI I;  1QVG Y;  4HH4 A;  5T64 A;  2VF1 A;  1YI2 1;  2E9H A;  3CC4 Z;  1M1K 1;  1YJ9 Z;  2OTJ 1;  3MON A;  1WCM I;  4X6A I;  1WW9 A;  3BG0 B;  2WB1 A;  3VTN A;  4NBE A;  4Y7N I;  1Q81 2;  1Y1V I;  4NOZ A;  4MON A;  1VQK 1;  3CC7 1;  2LIY A;  4E2Y A;  1I50 I;  2I3C A;  1YHQ Z;  3HOX I;  3D9X A;  3Q87 A;  4CL1 A;  3CCS 1;  1VQ9 1;  2JA5 I;  3TDH B;  3RZD I;  1YI2 Z;  3TE5 B;  1VQL Z;  1QYP A;  2NVT I;  2OTJ Z;  2R92 I;  3G6E Z;  2VPX A;  2KPI A;  3G71 1;  4HGY A;  2RPR A;  2W04 A;  3CC7 Z;  2DE7 A;  2O53 A;  3NFZ A;  2E2H I;  1K9M 1;  3NH5 A;  3CCM 1;  1KQS Z;  3CCS Z;  3HOZ I;  1S7M A;  1Y1W I;  3GTL I;  3JAM f;  5C4J I;  1VQ9 Z;  4MRI A;  2V8I A;  4Y52 I;  1M90 2;  2H85 A;  3CXC Z;  3I56 1;  2QLV B;  1FDO A;  3GCF A;  3H0G I;  2W03 A;  4MH4 A;  3G71 Z;  3VMH A;  2GTH A;  2E7Z A;  4MD8 A;  4A3B I;  4A3I I;  5C44 I;  4A3C I;  3CCM Z;  4BBS I;  1TWF I;  3GTM I;  4RVD A;  2O4H A;  1M90 1;  1VQ6 1;  3PO3 I;  1AA6 A;  2OOY B;  3I56 Z;  2GU2 A;  5LL6 f;  3HOU I;  3HOY I;  1K73 1;  1TWH I;  2AYD A;  2JMO A;  4E2Z A;  1NP6 A;  3S15 I;  4QTU A;  4QTT A;  2JA8 I;  3CD6 1;  4NB8 A;  2DE6 A;  1JWH C;  3H3V J;  2NVX I;  2BJO A;  5C4X I;  3G4S 1;  2NVY I;  2QA4 1;  1N8R 1;  2JIP A;  3NH4 A;  1VQ6 Z;  2NVQ I;  1USP B;  5IP7 I;  1VQO 1;  3MZL B;  1X3Z A;  3FQM A;  2PM9 A;  4A3D I;  1DL6 A;  3S2H I;  3MZK B;  1X3W A;  1VQM 1;  4NB9 A;  2F4M A;  1TWC I;  3CD6 Z;  3OW2 Z;  3CQZ I;  2J6A A;  2VPZ A;  2E2I I;  3CC2 1;  3JAM b;  2JS4 A;  3KIF A;  3G4S Z;  2QA4 Z;  1YUK A;  4NH1 C;  1I6H I;  1TWG I;  3LUS A;  1VQO Z;  1FDI A;  3CCJ 1;  4E2X A;  3M4O I;  3I4N I;  1SFO I;  1VQM Z;  3QWU A;  2GTI A; 
#chains in the Genus database with same CATH homology
 3VB9 A;  4NBF A;  3HKZ A;  1NJI 1;  2QRE B;  4NBG A;  1K9M 2;  4DK1 A;  5D1O B;  3CCQ 1;  3CC2 Z;  3M3Y I;  5T6B A;  5A2Q f;  2KI7 B;  3VMI A;  2F4O A;  4NFR A;  3RZO I;  2R6M A;  4A3M I;  3GTQ I;  3OW2 Y;  1VQK Z;  3CCJ Z;  4RS4 A;  4RVF A;  3I4M I;  2QR1 B;  3D6W A;  3BG1 B;  1PFT A;  1N2F A;  4BBR I;  3S1N I;  2WAQ A;  2Y0S A;  3NDJ A;  3GTJ I;  3CCQ Z;  2RIQ A;  1Y1V S;  2EGT A;  5FLX f;  3K7A I;  1YIT 1;  1KRL A;  3S16 I;  2R93 I;  3I55 1;  3ESW A;  1K73 2;  1K83 I;  1VLA A;  4RVG A;  1W2B Z;  3IX0 A;  5T67 A;  2Q4Z A;  3S1M I;  2YAD A;  3NH8 A;  4E2W A;  4E33 A;  1VQ5 1;  1KC8 1;  1N8R 2;  2PK7 A;  3U50 C;  1YIT Z;  3I55 Z;  1RNI A;  2P28 A;  1ML8 A;  1S72 1;  2JUB A;  4E32 A;  3F3F C;  3J80 f;  1Z02 A;  2M48 A;  3J7A 4;  1VQ7 1;  5A2Q b;  4DGL A;  4A3L I;  1RO2 A;  1JJ2 Y;  1VQ5 Z;  2DE5 A;  4MD7 A;  1W2B Y;  3J81 f;  4E30 A;  4BY1 I;  4A3F I;  4TNU A;  2QRD B;  1K8A 1;  1USP A;  4E31 A;  1I3Q I;  2V8K A;  2B63 I;  2R7Z I;  4RV9 A;  3GTM S;  2K3R A;  3PO3 S;  3GTO I;  2QEX 1;  5IT9 f;  1RLY A;  1S72 Z;  1Z03 A;  1NJI 2;  2M6N A;  3HOW I;  4HGZ A;  1VQN 1;  1R9T I;  1Q86 1;  1VQ7 Z;  4MXU A;  1Z01 A;  1YJN 1;  2OTL 1;  2P3Y A;  2OZK A;  4S1T A;  3CCE 1;  3GTK I;  1Q82 1;  2V8J A;  1VQ8 1;  1YUA A;  2QEX Z;  3CCL 1;  1VQL 1;  5D1P A;  2JNY A;  3G6E 1;  1RO0 A;  1VQN Z;  2YU9 I;  2K5R A;  3CPW Y;  1RQF A;  3GTG I;  1X0T A;  1YJN Z;  2OTL Z;  2Q51 A;  5D1O A;  5CM2 M;  3PO2 I;  3CCE Z;  4NBA A;  3I07 A;  2VUM I;  3S1Q I;  2RBL A;  1VQ8 Z;  1VQ4 1;  5IP9 I;  3J80 b;  2RT9 A;  5C3E I;  3CCL Z;  4NBD A;  1Q81 1;  1WII A;  2ZAE B;  3IF8 A;  1QVF Y;  1KC8 2;  5AN9 F;  3J81 b;  3T4N B;  3CCU 1;  2QRC B;  4A3G I;  2JA6 I;  3IFU A;  1JJ2 Z;  1KD1 2;  4NBC A;  2QKD A;  4XX2 A;  1YJW 1;  4A3E I;  2OOX B;  3CCV 1;  1YIJ 1;  1Q7Y 2;  5IT9 b;  3S17 I;  3EER A;  2IZ3 A;  4NBB A;  2LFU A;  1VQ4 Z;  3CCR 1;  3CME 1;  1ZB9 A;  1ZH1 A;  1ZB8 A;  2JR6 A;  2HF1 A;  2JA7 I;  3S2D I;  4A93 I;  5FLM I;  1KD1 1;  4BY7 I;  3CCU Z;  3S1R I;  3CMA 1;  1L1O C;  1K8A 2;  1RO4 A;  1Q7Y 1;  1YJW Z;  1TWA I;  3S14 I;  3CCV Z;  1YIJ Z;  3GKQ A;  2E2J I;  1QVG Z;  4RVH A;  3F3P C;  3CCR Z;  2VUG A;  4A3J I;  3CME Z;  4A3K I;  4AYB A;  1Q86 2;  1KQS Y;  1TFI A;  3EED A;  2AKL A;  3CPW Z;  1VQP 1;  3HOV I;  4DQY B;  3CMA Z;  3VMG A;  1P9N A;  1NUI A;  1LQL A;  3CXC Y;  1Q82 2;  3GTP I;  2PMZ A;  3CC4 1;  1YJ9 1;  3FQQ A;  4EWC A;  1M1K 2;  2RHB A;  2IZ4 A;  4MD9 A;  5FLX b;  4BXX I;  3KIH A;  2G2K A;  4NBH A;  1YHQ 1;  1QVF Z;  2HU9 A;  3NDI A;  1VQP Z;  1QF8 A;  3P5J B;  3FKI I;  1QVG Y;  4HH4 A;  5T64 A;  2VF1 A;  1YI2 1;  2E9H A;  3CC4 Z;  1M1K 1;  1YJ9 Z;  2OTJ 1;  3MON A;  1WCM I;  4X6A I;  1WW9 A;  3BG0 B;  2WB1 A;  3VTN A;  4NBE A;  4Y7N I;  1Q81 2;  1Y1V I;  4NOZ A;  4MON A;  1VQK 1;  3CC7 1;  2LIY A;  4E2Y A;  1I50 I;  2I3C A;  1YHQ Z;  3HOX I;  3D9X A;  3Q87 A;  4CL1 A;  3CCS 1;  1VQ9 1;  2JA5 I;  3TDH B;  3RZD I;  1YI2 Z;  3TE5 B;  1VQL Z;  1QYP A;  2NVT I;  2OTJ Z;  2R92 I;  3G6E Z;  2KPI A;  3G71 1;  4HGY A;  2RPR A;  2W04 A;  3CC7 Z;  2DE7 A;  2O53 A;  3NFZ A;  2E2H I;  1K9M 1;  3NH5 A;  3CCM 1;  1KQS Z;  3CCS Z;  3HOZ I;  1S7M A;  1Y1W I;  3GTL I;  3JAM f;  5C4J I;  1VQ9 Z;  4MRI A;  2V8I A;  4Y52 I;  1M90 2;  2H85 A;  3CXC Z;  3I56 1;  2QLV B;  3GCF A;  3H0G I;  2W03 A;  4MH4 A;  3G71 Z;  3VMH A;  2GTH A;  4MD8 A;  4A3B I;  4A3I I;  5C44 I;  4A3C I;  3CCM Z;  4BBS I;  1TWF I;  3GTM I;  4RVD A;  2O4H A;  1M90 1;  1VQ6 1;  3PO3 I;  2OOY B;  3I56 Z;  2GU2 A;  5LL6 f;  3HOU I;  3HOY I;  1K73 1;  1TWH I;  2JMO A;  4E2Z A;  1NP6 A;  3S15 I;  4QTU A;  4QTT A;  2JA8 I;  3CD6 1;  4NB8 A;  2DE6 A;  1JWH C;  3H3V J;  2NVX I;  2BJO A;  5C4X I;  3G4S 1;  2NVY I;  2QA4 1;  1N8R 1;  3NH4 A;  1VQ6 Z;  2NVQ I;  1USP B;  5IP7 I;  1VQO 1;  3MZL B;  1X3Z A;  3FQM A;  2PM9 A;  4A3D I;  1DL6 A;  3S2H I;  3MZK B;  1X3W A;  1VQM 1;  4NB9 A;  2F4M A;  1TWC I;  3CD6 Z;  3OW2 Z;  3CQZ I;  2J6A A;  2E2I I;  3CC2 1;  3JAM b;  2JS4 A;  3KIF A;  3G4S Z;  2QA4 Z;  1YUK A;  4NH1 C;  1I6H I;  1TWG I;  3LUS A;  1VQO Z;  3CCJ 1;  4E2X A;  3M4O I;  3I4N I;  1SFO I;  1VQM Z;  3QWU A;  2GTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...