1VQ81

The structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 7
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vq8100
3CCSZ 3I561 1YJWZ 3CCU1 1VQL1 3OW2Z 1VQN1 3CPWY 3G6EZ 3CMAZ 1KD12 1VQO1 1YJ9Z 3CCQ1 1Q811 1Q7Y1 3CCL1 1VQ81 3CCEZ 1QVGY 2QA41 3CCRZ 1VQ9Z 3OW2Y 1Q812 1S721 1M901 1Q7Y2 1YI2Z 1W2BZ 1QVFZ 3G711 2OTLZ 3CC21 1VQM1 1VQ41 1Q821 1M902 3CCJZ 3CCMZ 1VQ51 1N8R2 1KQSZ 3CCS1 1YJW1 1K9M2 3CD6Z 3CC7Z 3G6E1 3CMA1 1Q822 1M1K1 1W2BY 3CCVZ 1QVFY 1YJ91 1JJ2Z 1VQ6Z 1YITZ 3CCE1 1KQSY 3CCR1 1VQ91 1VQ7Z 1YIJZ 3I55Z 1VQPZ 1YHQZ 1YI21 1K731 3CXCZ 1KC81 2OTL1 1JJ2Y 1VQKZ 3CCJ1 3CCM1 1Q861 1K732 1K8A1 3G4SZ 3CMEZ 1YJNZ 1KC82 3CD61 3CC71 2OTJZ 3CC4Z 2QEXZ 1Q862 3CCV1 3I56Z 1VQLZ 3CXCY 3CCUZ 1VQNZ 1K8A2 1KD11 1QVGZ 1M1K2 1VQ61 1YIT1 1VQOZ 3CCQZ 1VQ71 1YIJ1 3I551 3CCLZ 1VQ8Z 1VQP1 1YHQ1 2QA4Z 1NJI1 1S72Z 3CPWZ 1VQK1 3G71Z 1NJI2 3G4S1 3CC2Z 1N8R1 1VQMZ 3CME1 1YJN1 1VQ4Z 2OTJ1 1K9M1 3CC41 2QEX1 1VQ5Z
chains in the Genus database with same CATH superfamily
3I561 2AYDA 3G6EZ 4A3II 3F3FC 1KD12 2B63I 1YJ9Z 4DK1A 3NH5A 3M4OI 2OOXB 2LIYA 4HGZA 3CCEZ 3K7AI 3KIHA 1RNIA 2JUBA 1ZB9A 4E2ZA 3OW2Y 3S1QI 2V8IA 2NVQI 4NBAA 3MONA 1X3ZA 2ZAEB 4NBGA 3I4NI 1QVFZ 1KRLA 2OTLZ 3H0GI 3EERA 1M902 1KQSZ 2K3RA 4A3LI 2G2KA 4RVGA 4BBRI 4MRIA 4RVFA 1JJ2Z 5IT9f 1VQ6Z 3HKZA 4NBFA 2IV2X 3MZLB 3CCR1 1YIJZ 3I55Z 1YI21 2F4MA 2NVXI 3GTKI 3CXCZ 5AN9F 1WZNA 2P3YA 2E9HA 3GTQI 1Q861 4RS4A 1K732 2PK7A 2VPZA 3NFZA 1K8A1 3TE5B 4E30A 3NDIA 4NBHA 1KC82 2JNYA 1RO4A 3CC71 3J81b 2RHBA 2V8JA 3HOZI 4NBEA 4E2WA 3I56Z 1RO0A 2WB1A 3HOYI 3EEDA 3BG0B 3RZDI 3CQZI 4TNUA 4E33A 2PMZA 2Q4ZA 4A3MI 3HOUI 2VUMI 1YHQ1 2JIOA 3HOXI 3CPWZ 1VQK1 4EWCA 2OOYB 3LUSA 1TWCI 3G4S1 3TDHB 4A3EI 3CME1 4A3FI 2OTJ1 2QR1B 2KPIA 1TWAI 3J81f 1VQL1 2R92I 4HH4A 4A3KI 4NH1C 5C4XI 2Q51A 1VQO1 3CCQ1 2RIQA 1RLYA 2J6AA 2JR6A 3CCRZ 1M901 3HOVI 5C4JI 1Q7Y2 1YI2Z 4A3CI 1W2BZ 4RV9A 2RT9A 3VMHA 3J80b 1VQM1 2F4OA 3GTMS 3BG1B 5C3EI 1X3WA 5IT9b 3PO3S 2LEXA 3CC7Z 3CMA1 1Q822 4NBBA 1M1K1 3D2LA 1X0TA 1WJ2A 2HF1A 3S14I 2RPRA 3D9XA 1S7MA 4DGLA 4BY1I 1QF8A 1YHQZ 3VTNA 3PO2I 1K731 2I3CA 3GTOI 1KC81 3S1MI 4MONA 4HGYA 3IF8A 4MD9A 1VQKZ 5IP7I 2R93I 3CCJ1 3S2HI 3IR7A 3J80f 2JA7I 3G4SZ 3KIFA 3CMEZ 1YUAA 3J7A4 1Y1VS 4A3DI 2OTJZ 2P28A 1ML8A 4Y7NI 1VQLZ 4A3BI 1TWHI 1M1K2 3NDJA 1L1OC 2M48A 2RBLA 3VMIA 1VQOZ 3CCQZ 3Q87A 1PFTA 1Z03A 2JA8I 2VPXA 3NH8A 1FDIA 1N8R1 2GTIA 5D1OA 1VQMZ 1YJN1 2DE6A 3S15I 5D1OB 2QKDA 1K9M1 3CC41 2QEX1 1NUIA 1N2FA 1RO2A 4NBCA 4RVDA 3F3PC 3CCU1 3OW2Z 3CMAZ 2V8KA 1Y8CA 3S2DI 5FLMI 3RZOI 2QLVB 1Q7Y1 1QVGY 2QA41 1AA6A 2AKLA 2HU9A 4A93I 1Q812 1S721 1NP6A 2PM9A 1ZH1A 1DL6A 1P9NA 4BXXI 2JIPA 2JIMA 2GU2A 5D1PA 1Y1WI 3GTLI 3S16I 3MZKB 3JAMb 3CC21 3FKII 1Q821 3GTJI 3CCJZ 1VQ51 1N8R2 3CCS1 1YJW1 2VF1A 1K9M2 3S17I 4RVHA 2OZKA 1QVFY 4Y52I 3T4NB 1Q16A 5FLXb 4DQYB 1KQSY 1I50I 1VQ91 4BBSI 5A2Qb 2E2HI 4E31A 3S1NI 3PO3I 4MH4A 3P5JB 4QTUA 1JJ2Y 2QRCB 1USPB 3FQMA 3QWUA 3CCM1 3JAMf 3GTGI 3VB9A 1VLAA 1YJNZ 3CD61 2JS4A 3CC4Z 2QEXZ 4MD8A 3I4MI 5T64A 4AYBA 3CCV1 3CXCY 3CCUZ 1WIIA 1K83I 1QVGZ 3FQQA 1YIT1 1Z01A 4NB9A 3IFUA 5FLXf 5T6BA 3GKQA 3IX0A 2V3VA 1VQ71 4NFRA 1VQP1 5LL6f 4BY7I 2QREB 2WAQA 2QA4Z 3H3VJ 1Y1VI 5A2Qf 3S1RI 2VPYA 1RQFA 1S72Z 2QRDB 1R9TI 1TWGI 1NJI2 3CC2Z 2IZ4A 3I07A 1VQ5Z 2NAPA 2JIQA 3CCSZ 1YJWZ 1VQN1 5CM2M 3CPWY 3HOWI 1Q811 4E32A 3ESWA 3CCL1 1VQ81 2DE5A 2R6MA 2VPWA 1VQ9Z 2EGTA 2E2JI 4E2YA 2V45A 4S1TA 3G711 4NOZA 1VQ41 1TFIA 3U50C 1I6HI 2W04A 5T67A 3CCMZ 4MXUA 3VMGA 3CD6Z 2JIRA 4QTTA 3G6E1 2YADA 1W2BY 3CCVZ 1YJ91 2LFUA 4CL1A 1YUKA 5C44I 3CCE1 1YITZ 2O53A 1VQ7Z 1SIWA 2VUGA 4X6AI 1VQPZ 4A3GI 3NH4A 1Z02A 1SFOI 2O4HA 1QXFA 1FDOA 3GTPI 2OTL1 2W03A 1TWFI 4NBDA 1I3QI 2H85A 2IZ3A 2BJOA 2E2II 4E2XA 1Q862 2JA6I 4XX2A 1VQNZ 1K8A2 1KD11 2M6NA 2JA5I 1VQ61 4NB8A 3GTMI 5IP9I 4MD7A 2NVYI 1ZB8A 1YIJ1 3I551 2GTHA 2K5RA 3CCLZ 1VQ8Z 3GCFA 2Y0SA 1USPA 1LQLA 1NJI1 3M3YI 1JWHC 3D6WA 1WW9A 1QYPA 2JMOA 3G71Z 2YU9I 2DE7A 2R7ZI 1VQ4Z 4A3JI 2NVTI 2E7ZA 2KI7B 1WCMI
chains in the Genus database with same CATH topology
3I561 3G6EZ 4A3II 3F3FC 1KD12 2B63I 1YJ9Z 4DK1A 3NH5A 3M4OI 2OOXB 2LIYA 4HGZA 3CCEZ 3K7AI 3KIHA 1RNIA 2JUBA 1ZB9A 4E2ZA 3OW2Y 3S1QI 2V8IA 2NVQI 4NBAA 3MONA 1X3ZA 2ZAEB 4NBGA 3I4NI 1QVFZ 1KRLA 2OTLZ 3H0GI 3EERA 1M902 1KQSZ 2K3RA 4A3LI 2G2KA 4RVGA 4BBRI 4MRIA 4RVFA 1JJ2Z 5IT9f 1VQ6Z 3HKZA 4NBFA 3MZLB 3CCR1 1YIJZ 3I55Z 1YI21 2F4MA 2NVXI 3GTKI 3CXCZ 5AN9F 2P3YA 2E9HA 3GTQI 1Q861 4RS4A 1K732 2PK7A 3NFZA 1K8A1 3TE5B 4E30A 3NDIA 4NBHA 1KC82 2JNYA 1RO4A 3CC71 3J81b 2RHBA 2V8JA 3HOZI 4NBEA 4E2WA 3I56Z 1RO0A 2WB1A 3HOYI 3EEDA 3BG0B 3RZDI 3CQZI 4TNUA 4E33A 2PMZA 2Q4ZA 4A3MI 3HOUI 2VUMI 1YHQ1 3HOXI 3CPWZ 1VQK1 4EWCA 2OOYB 3LUSA 1TWCI 3G4S1 3TDHB 4A3EI 3CME1 4A3FI 2OTJ1 2QR1B 2KPIA 1TWAI 3J81f 1VQL1 2R92I 4HH4A 4A3KI 4NH1C 5C4XI 2Q51A 1VQO1 3CCQ1 2RIQA 1RLYA 2J6AA 2JR6A 3CCRZ 1M901 3HOVI 5C4JI 1Q7Y2 1YI2Z 4A3CI 1W2BZ 4RV9A 2RT9A 3VMHA 3J80b 1VQM1 2F4OA 3GTMS 3BG1B 5C3EI 1X3WA 5IT9b 3PO3S 3CC7Z 3CMA1 1Q822 4NBBA 1M1K1 1X0TA 2HF1A 3S14I 2RPRA 3D9XA 1S7MA 4DGLA 4BY1I 1QF8A 1YHQZ 3VTNA 3PO2I 1K731 2I3CA 3GTOI 1KC81 3S1MI 4MONA 4HGYA 3IF8A 4MD9A 1VQKZ 5IP7I 2R93I 3CCJ1 3S2HI 3J80f 2JA7I 3G4SZ 3KIFA 3CMEZ 1YUAA 3J7A4 1Y1VS 4A3DI 2OTJZ 2P28A 1ML8A 4Y7NI 1VQLZ 4A3BI 1TWHI 1M1K2 3NDJA 1L1OC 2M48A 2RBLA 3VMIA 1VQOZ 3CCQZ 3Q87A 1PFTA 1Z03A 2JA8I 3NH8A 1N8R1 2GTIA 5D1OA 1VQMZ 1YJN1 2DE6A 3S15I 5D1OB 2QKDA 1K9M1 3CC41 2QEX1 1NUIA 1N2FA 1RO2A 4NBCA 4RVDA 3F3PC 3CCU1 3OW2Z 3CMAZ 2V8KA 3S2DI 5FLMI 3RZOI 2QLVB 1Q7Y1 1QVGY 2QA41 2AKLA 2HU9A 4A93I 1Q812 1S721 1NP6A 2PM9A 1ZH1A 1DL6A 1P9NA 4BXXI 5D1PA 2GU2A 1Y1WI 3GTLI 3S16I 3MZKB 3JAMb 3CC21 3FKII 1Q821 3GTJI 3CCJZ 1VQ51 1N8R2 3CCS1 1YJW1 2VF1A 1K9M2 3S17I 4RVHA 2OZKA 1QVFY 4Y52I 3T4NB 5FLXb 4DQYB 1KQSY 1I50I 1VQ91 4BBSI 5A2Qb 2E2HI 4E31A 3S1NI 3PO3I 4MH4A 3P5JB 4QTUA 1JJ2Y 2QRCB 1USPB 3FQMA 3QWUA 3CCM1 3JAMf 3GTGI 3VB9A 1VLAA 1YJNZ 3CD61 2JS4A 3CC4Z 2QEXZ 4MD8A 3I4MI 5T64A 4AYBA 3CCV1 3CXCY 3CCUZ 1WIIA 1K83I 1QVGZ 3FQQA 1YIT1 1Z01A 4NB9A 3IFUA 5FLXf 5T6BA 3GKQA 3IX0A 1VQ71 1VQP1 4NFRA 5LL6f 4BY7I 2QREB 2WAQA 2QA4Z 3H3VJ 1Y1VI 5A2Qf 3S1RI 1RQFA 1S72Z 2QRDB 1R9TI 1TWGI 1NJI2 3CC2Z 2IZ4A 3I07A 1VQ5Z 3CCSZ 1YJWZ 1VQN1 5CM2M 3CPWY 3HOWI 1Q811 4E32A 3ESWA 3CCL1 1VQ81 2DE5A 2R6MA 1VQ9Z 2EGTA 2E2JI 4E2YA 4S1TA 3G711 4NOZA 1VQ41 1TFIA 3U50C 1I6HI 2W04A 5T67A 3CCMZ 4MXUA 3VMGA 3CD6Z 4QTTA 3G6E1 2YADA 1W2BY 3CCVZ 1YJ91 2LFUA 4CL1A 1YUKA 5C44I 3CCE1 1YITZ 2O53A 1VQ7Z 4X6AI 2VUGA 1VQPZ 4A3GI 3NH4A 1Z02A 1SFOI 2O4HA 3GTPI 2OTL1 2W03A 1TWFI 4NBDA 1I3QI 2H85A 2IZ3A 2BJOA 2E2II 4E2XA 1Q862 2JA6I 4XX2A 1VQNZ 1K8A2 1KD11 2M6NA 2JA5I 1VQ61 4NB8A 3GTMI 5IP9I 4MD7A 2NVYI 1ZB8A 1YIJ1 3I551 2GTHA 2K5RA 3CCLZ 1VQ8Z 3GCFA 2Y0SA 1USPA 1LQLA 1NJI1 3M3YI 1JWHC 3D6WA 1WW9A 1QYPA 2JMOA 3G71Z 2YU9I 2DE7A 2R7ZI 1VQ4Z 4A3JI 2NVTI 2KI7B 1WCMI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Z;  3I56 1;  1YJW Z;  3CCU 1;  1VQL 1;  3OW2 Z;  1VQN 1;  3CPW Y;  3G6E Z;  3CMA Z;  1KD1 2;  1VQO 1;  1YJ9 Z;  3CCQ 1;  1Q81 1;  1Q7Y 1;  3CCL 1;  1VQ8 1;  3CCE Z;  1QVG Y;  2QA4 1;  3CCR Z;  1VQ9 Z;  3OW2 Y;  1Q81 2;  1S72 1;  1M90 1;  1Q7Y 2;  1YI2 Z;  1W2B Z;  1QVF Z;  3G71 1;  2OTL Z;  3CC2 1;  1VQM 1;  1VQ4 1;  1Q82 1;  1M90 2;  3CCJ Z;  3CCM Z;  1VQ5 1;  1N8R 2;  1KQS Z;  3CCS 1;  1YJW 1;  1K9M 2;  3CD6 Z;  3CC7 Z;  3G6E 1;  3CMA 1;  1Q82 2;  1M1K 1;  1W2B Y;  3CCV Z;  1QVF Y;  1YJ9 1;  1JJ2 Z;  1VQ6 Z;  1YIT Z;  3CCE 1;  1KQS Y;  3CCR 1;  1VQ9 1;  1VQ7 Z;  1YIJ Z;  3I55 Z;  1VQP Z;  1YHQ Z;  1YI2 1;  1K73 1;  3CXC Z;  1KC8 1;  2OTL 1;  1JJ2 Y;  1VQK Z;  3CCJ 1;  3CCM 1;  1Q86 1;  1K73 2;  1K8A 1;  3G4S Z;  3CME Z;  1YJN Z;  1KC8 2;  3CD6 1;  3CC7 1;  2OTJ Z;  3CC4 Z;  2QEX Z;  1Q86 2;  3CCV 1;  3I56 Z;  1VQL Z;  3CXC Y;  3CCU Z;  1VQN Z;  1K8A 2;  1KD1 1;  1QVG Z;  1M1K 2;  1VQ6 1;  1YIT 1;  1VQO Z;  3CCQ Z;  1VQ7 1;  1YIJ 1;  3I55 1;  3CCL Z;  1VQ8 Z;  1VQP 1;  1YHQ 1;  2QA4 Z;  1NJI 1;  1S72 Z;  3CPW Z;  1VQK 1;  3G71 Z;  1NJI 2;  3G4S 1;  3CC2 Z;  1N8R 1;  1VQM Z;  3CME 1;  1YJN 1;  1VQ4 Z;  2OTJ 1;  1K9M 1;  3CC4 1;  2QEX 1;  1VQ5 Z; 
#chains in the Genus database with same CATH topology
 3I56 1;  2AYD A;  3G6E Z;  4A3I I;  3F3F C;  1KD1 2;  2B63 I;  1YJ9 Z;  4DK1 A;  3NH5 A;  3M4O I;  2OOX B;  2LIY A;  4HGZ A;  3CCE Z;  3K7A I;  3KIH A;  1RNI A;  2JUB A;  1ZB9 A;  4E2Z A;  3OW2 Y;  3S1Q I;  2V8I A;  2NVQ I;  4NBA A;  3MON A;  1X3Z A;  2ZAE B;  4NBG A;  3I4N I;  1QVF Z;  1KRL A;  2OTL Z;  3H0G I;  3EER A;  1M90 2;  1KQS Z;  2K3R A;  4A3L I;  2G2K A;  4RVG A;  4BBR I;  4MRI A;  4RVF A;  1JJ2 Z;  5IT9 f;  1VQ6 Z;  3HKZ A;  4NBF A;  2IV2 X;  3MZL B;  3CCR 1;  1YIJ Z;  3I55 Z;  1YI2 1;  2F4M A;  2NVX I;  3GTK I;  3CXC Z;  5AN9 F;  1WZN A;  2P3Y A;  2E9H A;  3GTQ I;  1Q86 1;  4RS4 A;  1K73 2;  2PK7 A;  2VPZ A;  3NFZ A;  1K8A 1;  3TE5 B;  4E30 A;  3NDI A;  4NBH A;  1KC8 2;  2JNY A;  1RO4 A;  3CC7 1;  3J81 b;  2RHB A;  2V8J A;  3HOZ I;  4NBE A;  4E2W A;  3I56 Z;  1RO0 A;  2WB1 A;  3HOY I;  3EED A;  3BG0 B;  3RZD I;  3CQZ I;  4TNU A;  4E33 A;  2PMZ A;  2Q4Z A;  4A3M I;  3HOU I;  2VUM I;  1YHQ 1;  2JIO A;  3HOX I;  3CPW Z;  1VQK 1;  4EWC A;  2OOY B;  3LUS A;  1TWC I;  3G4S 1;  3TDH B;  4A3E I;  3CME 1;  4A3F I;  2OTJ 1;  2QR1 B;  2KPI A;  1TWA I;  3J81 f;  1VQL 1;  2R92 I;  4HH4 A;  4A3K I;  4NH1 C;  5C4X I;  2Q51 A;  1VQO 1;  3CCQ 1;  2RIQ A;  1RLY A;  2J6A A;  2JR6 A;  3CCR Z;  1M90 1;  3HOV I;  5C4J I;  1Q7Y 2;  1YI2 Z;  4A3C I;  1W2B Z;  4RV9 A;  2RT9 A;  3VMH A;  3J80 b;  1VQM 1;  2F4O A;  3GTM S;  3BG1 B;  5C3E I;  1X3W A;  5IT9 b;  3PO3 S;  2LEX A;  3CC7 Z;  3CMA 1;  1Q82 2;  4NBB A;  1M1K 1;  3D2L A;  1X0T A;  1WJ2 A;  2HF1 A;  3S14 I;  2RPR A;  3D9X A;  1S7M A;  4DGL A;  4BY1 I;  1QF8 A;  1YHQ Z;  3VTN A;  3PO2 I;  1K73 1;  2I3C A;  3GTO I;  1KC8 1;  3S1M I;  4MON A;  4HGY A;  3IF8 A;  4MD9 A;  1VQK Z;  5IP7 I;  2R93 I;  3CCJ 1;  3S2H I;  3IR7 A;  3J80 f;  2JA7 I;  3G4S Z;  3KIF A;  3CME Z;  1YUA A;  3J7A 4;  1Y1V S;  4A3D I;  2OTJ Z;  2P28 A;  1ML8 A;  4Y7N I;  1VQL Z;  4A3B I;  1TWH I;  1M1K 2;  3NDJ A;  1L1O C;  2M48 A;  2RBL A;  3VMI A;  1VQO Z;  3CCQ Z;  3Q87 A;  1PFT A;  1Z03 A;  2JA8 I;  2VPX A;  3NH8 A;  1FDI A;  1N8R 1;  2GTI A;  5D1O A;  1VQM Z;  1YJN 1;  2DE6 A;  3S15 I;  5D1O B;  2QKD A;  1K9M 1;  3CC4 1;  2QEX 1;  1NUI A;  1N2F A;  1RO2 A;  4NBC A;  4RVD A;  3F3P C;  3CCU 1;  3OW2 Z;  3CMA Z;  2V8K A;  1Y8C A;  3S2D I;  5FLM I;  3RZO I;  2QLV B;  1Q7Y 1;  1QVG Y;  2QA4 1;  1AA6 A;  2AKL A;  2HU9 A;  4A93 I;  1Q81 2;  1S72 1;  1NP6 A;  2PM9 A;  1ZH1 A;  1DL6 A;  1P9N A;  4BXX I;  2JIP A;  2JIM A;  2GU2 A;  5D1P A;  1Y1W I;  3GTL I;  3S16 I;  3MZK B;  3JAM b;  3CC2 1;  3FKI I;  1Q82 1;  3GTJ I;  3CCJ Z;  1VQ5 1;  1N8R 2;  3CCS 1;  1YJW 1;  2VF1 A;  1K9M 2;  3S17 I;  4RVH A;  2OZK A;  1QVF Y;  4Y52 I;  3T4N B;  1Q16 A;  5FLX b;  4DQY B;  1KQS Y;  1I50 I;  1VQ9 1;  4BBS I;  5A2Q b;  2E2H I;  4E31 A;  3S1N I;  3PO3 I;  4MH4 A;  3P5J B;  4QTU A;  1JJ2 Y;  2QRC B;  1USP B;  3FQM A;  3QWU A;  3CCM 1;  3JAM f;  3GTG I;  3VB9 A;  1VLA A;  1YJN Z;  3CD6 1;  2JS4 A;  3CC4 Z;  2QEX Z;  4MD8 A;  3I4M I;  5T64 A;  4AYB A;  3CCV 1;  3CXC Y;  3CCU Z;  1WII A;  1K83 I;  1QVG Z;  3FQQ A;  1YIT 1;  1Z01 A;  4NB9 A;  3IFU A;  5FLX f;  5T6B A;  3GKQ A;  3IX0 A;  2V3V A;  1VQ7 1;  4NFR A;  1VQP 1;  5LL6 f;  4BY7 I;  2QRE B;  2WAQ A;  2QA4 Z;  3H3V J;  1Y1V I;  5A2Q f;  3S1R I;  2VPY A;  1RQF A;  1S72 Z;  2QRD B;  1R9T I;  1TWG I;  1NJI 2;  3CC2 Z;  2IZ4 A;  3I07 A;  1VQ5 Z;  2NAP A;  2JIQ A;  3CCS Z;  1YJW Z;  1VQN 1;  5CM2 M;  3CPW Y;  3HOW I;  1Q81 1;  4E32 A;  3ESW A;  3CCL 1;  1VQ8 1;  2DE5 A;  2R6M A;  2VPW A;  1VQ9 Z;  2EGT A;  2E2J I;  4E2Y A;  2V45 A;  4S1T A;  3G71 1;  4NOZ A;  1VQ4 1;  1TFI A;  3U50 C;  1I6H I;  2W04 A;  5T67 A;  3CCM Z;  4MXU A;  3VMG A;  3CD6 Z;  2JIR A;  4QTT A;  3G6E 1;  2YAD A;  1W2B Y;  3CCV Z;  1YJ9 1;  2LFU A;  4CL1 A;  1YUK A;  5C44 I;  3CCE 1;  1YIT Z;  2O53 A;  1VQ7 Z;  1SIW A;  2VUG A;  4X6A I;  1VQP Z;  4A3G I;  3NH4 A;  1Z02 A;  1SFO I;  2O4H A;  1QXF A;  1FDO A;  3GTP I;  2OTL 1;  2W03 A;  1TWF I;  4NBD A;  1I3Q I;  2H85 A;  2IZ3 A;  2BJO A;  2E2I I;  4E2X A;  1Q86 2;  2JA6 I;  4XX2 A;  1VQN Z;  1K8A 2;  1KD1 1;  2M6N A;  2JA5 I;  1VQ6 1;  4NB8 A;  3GTM I;  5IP9 I;  4MD7 A;  2NVY I;  1ZB8 A;  1YIJ 1;  3I55 1;  2GTH A;  2K5R A;  3CCL Z;  1VQ8 Z;  3GCF A;  2Y0S A;  1USP A;  1LQL A;  1NJI 1;  3M3Y I;  1JWH C;  3D6W A;  1WW9 A;  1QYP A;  2JMO A;  3G71 Z;  2YU9 I;  2DE7 A;  2R7Z I;  1VQ4 Z;  4A3J I;  2NVT I;  2E7Z A;  2KI7 B;  1WCM I; 
#chains in the Genus database with same CATH homology
 3I56 1;  3G6E Z;  4A3I I;  3F3F C;  1KD1 2;  2B63 I;  1YJ9 Z;  4DK1 A;  3NH5 A;  3M4O I;  2OOX B;  2LIY A;  4HGZ A;  3CCE Z;  3K7A I;  3KIH A;  1RNI A;  2JUB A;  1ZB9 A;  4E2Z A;  3OW2 Y;  3S1Q I;  2V8I A;  2NVQ I;  4NBA A;  3MON A;  1X3Z A;  2ZAE B;  4NBG A;  3I4N I;  1QVF Z;  1KRL A;  2OTL Z;  3H0G I;  3EER A;  1M90 2;  1KQS Z;  2K3R A;  4A3L I;  2G2K A;  4RVG A;  4BBR I;  4MRI A;  4RVF A;  1JJ2 Z;  5IT9 f;  1VQ6 Z;  3HKZ A;  4NBF A;  3MZL B;  3CCR 1;  1YIJ Z;  3I55 Z;  1YI2 1;  2F4M A;  2NVX I;  3GTK I;  3CXC Z;  5AN9 F;  2P3Y A;  2E9H A;  3GTQ I;  1Q86 1;  4RS4 A;  1K73 2;  2PK7 A;  3NFZ A;  1K8A 1;  3TE5 B;  4E30 A;  3NDI A;  4NBH A;  1KC8 2;  2JNY A;  1RO4 A;  3CC7 1;  3J81 b;  2RHB A;  2V8J A;  3HOZ I;  4NBE A;  4E2W A;  3I56 Z;  1RO0 A;  2WB1 A;  3HOY I;  3EED A;  3BG0 B;  3RZD I;  3CQZ I;  4TNU A;  4E33 A;  2PMZ A;  2Q4Z A;  4A3M I;  3HOU I;  2VUM I;  1YHQ 1;  3HOX I;  3CPW Z;  1VQK 1;  4EWC A;  2OOY B;  3LUS A;  1TWC I;  3G4S 1;  3TDH B;  4A3E I;  3CME 1;  4A3F I;  2OTJ 1;  2QR1 B;  2KPI A;  1TWA I;  3J81 f;  1VQL 1;  2R92 I;  4HH4 A;  4A3K I;  4NH1 C;  5C4X I;  2Q51 A;  1VQO 1;  3CCQ 1;  2RIQ A;  1RLY A;  2J6A A;  2JR6 A;  3CCR Z;  1M90 1;  3HOV I;  5C4J I;  1Q7Y 2;  1YI2 Z;  4A3C I;  1W2B Z;  4RV9 A;  2RT9 A;  3VMH A;  3J80 b;  1VQM 1;  2F4O A;  3GTM S;  3BG1 B;  5C3E I;  1X3W A;  5IT9 b;  3PO3 S;  3CC7 Z;  3CMA 1;  1Q82 2;  4NBB A;  1M1K 1;  1X0T A;  2HF1 A;  3S14 I;  2RPR A;  3D9X A;  1S7M A;  4DGL A;  4BY1 I;  1QF8 A;  1YHQ Z;  3VTN A;  3PO2 I;  1K73 1;  2I3C A;  3GTO I;  1KC8 1;  3S1M I;  4MON A;  4HGY A;  3IF8 A;  4MD9 A;  1VQK Z;  5IP7 I;  2R93 I;  3CCJ 1;  3S2H I;  3J80 f;  2JA7 I;  3G4S Z;  3KIF A;  3CME Z;  1YUA A;  3J7A 4;  1Y1V S;  4A3D I;  2OTJ Z;  2P28 A;  1ML8 A;  4Y7N I;  1VQL Z;  4A3B I;  1TWH I;  1M1K 2;  3NDJ A;  1L1O C;  2M48 A;  2RBL A;  3VMI A;  1VQO Z;  3CCQ Z;  3Q87 A;  1PFT A;  1Z03 A;  2JA8 I;  3NH8 A;  1N8R 1;  2GTI A;  5D1O A;  1VQM Z;  1YJN 1;  2DE6 A;  3S15 I;  5D1O B;  2QKD A;  1K9M 1;  3CC4 1;  2QEX 1;  1NUI A;  1N2F A;  1RO2 A;  4NBC A;  4RVD A;  3F3P C;  3CCU 1;  3OW2 Z;  3CMA Z;  2V8K A;  3S2D I;  5FLM I;  3RZO I;  2QLV B;  1Q7Y 1;  1QVG Y;  2QA4 1;  2AKL A;  2HU9 A;  4A93 I;  1Q81 2;  1S72 1;  1NP6 A;  2PM9 A;  1ZH1 A;  1DL6 A;  1P9N A;  4BXX I;  5D1P A;  2GU2 A;  1Y1W I;  3GTL I;  3S16 I;  3MZK B;  3JAM b;  3CC2 1;  3FKI I;  1Q82 1;  3GTJ I;  3CCJ Z;  1VQ5 1;  1N8R 2;  3CCS 1;  1YJW 1;  2VF1 A;  1K9M 2;  3S17 I;  4RVH A;  2OZK A;  1QVF Y;  4Y52 I;  3T4N B;  5FLX b;  4DQY B;  1KQS Y;  1I50 I;  1VQ9 1;  4BBS I;  5A2Q b;  2E2H I;  4E31 A;  3S1N I;  3PO3 I;  4MH4 A;  3P5J B;  4QTU A;  1JJ2 Y;  2QRC B;  1USP B;  3FQM A;  3QWU A;  3CCM 1;  3JAM f;  3GTG I;  3VB9 A;  1VLA A;  1YJN Z;  3CD6 1;  2JS4 A;  3CC4 Z;  2QEX Z;  4MD8 A;  3I4M I;  5T64 A;  4AYB A;  3CCV 1;  3CXC Y;  3CCU Z;  1WII A;  1K83 I;  1QVG Z;  3FQQ A;  1YIT 1;  1Z01 A;  4NB9 A;  3IFU A;  5FLX f;  5T6B A;  3GKQ A;  3IX0 A;  1VQ7 1;  1VQP 1;  4NFR A;  5LL6 f;  4BY7 I;  2QRE B;  2WAQ A;  2QA4 Z;  3H3V J;  1Y1V I;  5A2Q f;  3S1R I;  1RQF A;  1S72 Z;  2QRD B;  1R9T I;  1TWG I;  1NJI 2;  3CC2 Z;  2IZ4 A;  3I07 A;  1VQ5 Z;  3CCS Z;  1YJW Z;  1VQN 1;  5CM2 M;  3CPW Y;  3HOW I;  1Q81 1;  4E32 A;  3ESW A;  3CCL 1;  1VQ8 1;  2DE5 A;  2R6M A;  1VQ9 Z;  2EGT A;  2E2J I;  4E2Y A;  4S1T A;  3G71 1;  4NOZ A;  1VQ4 1;  1TFI A;  3U50 C;  1I6H I;  2W04 A;  5T67 A;  3CCM Z;  4MXU A;  3VMG A;  3CD6 Z;  4QTT A;  3G6E 1;  2YAD A;  1W2B Y;  3CCV Z;  1YJ9 1;  2LFU A;  4CL1 A;  1YUK A;  5C44 I;  3CCE 1;  1YIT Z;  2O53 A;  1VQ7 Z;  4X6A I;  2VUG A;  1VQP Z;  4A3G I;  3NH4 A;  1Z02 A;  1SFO I;  2O4H A;  3GTP I;  2OTL 1;  2W03 A;  1TWF I;  4NBD A;  1I3Q I;  2H85 A;  2IZ3 A;  2BJO A;  2E2I I;  4E2X A;  1Q86 2;  2JA6 I;  4XX2 A;  1VQN Z;  1K8A 2;  1KD1 1;  2M6N A;  2JA5 I;  1VQ6 1;  4NB8 A;  3GTM I;  5IP9 I;  4MD7 A;  2NVY I;  1ZB8 A;  1YIJ 1;  3I55 1;  2GTH A;  2K5R A;  3CCL Z;  1VQ8 Z;  3GCF A;  2Y0S A;  1USP A;  1LQL A;  1NJI 1;  3M3Y I;  1JWH C;  3D6W A;  1WW9 A;  1QYP A;  2JMO A;  3G71 Z;  2YU9 I;  2DE7 A;  2R7Z I;  1VQ4 Z;  4A3J I;  2NVT I;  2KI7 B;  1WCM I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...