1W2BZ

Trigger factor ribosome binding domain in complex with 50s
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bZ00
3OW2Y 3I561 2QEX1 1K8A2 1Q821 1Q822 1K731 1VQNZ 2OTJZ 3CCM1 1QVGY 1QVFY 1YJNZ 3G4SZ 3CMEZ 3CCV1 1S721 2QEXZ 1N8R1 1Q862 3CCMZ 1VQ4Z 3CCE1 1VQK1 1KD11 1KD12 2OTL1 3CCVZ 3CCSZ 1M1K1 1YJWZ 1M1K2 3CC7Z 1KQSY 3CD61 1NJI1 1YITZ 2QA4Z 1YJ9Z 3CPWZ 1KC82 1YHQZ 1K8A1 2OTLZ 3CCLZ 1VQPZ 3CCU1 3CCQZ 3G711 1VQMZ 1VQ81 3I56Z 1JJ2Z 1VQL1 3OW2Z 1Q861 3I551 3CC21 3CXCY 1VQ51 1S72Z 1M902 3CCR1 1QVGZ 1QVFZ 1VQ91 3CC41 3CCEZ 1VQKZ 1W2BY 1VQO1 1KC81 3CMA1 1VQ61 3CD6Z 1K9M2 3CCJ1 1YI21 3G6E1 1KQSZ 1VQ71 3CMAZ 1Q7Y1 1Q7Y2 2OTJ1 3CCUZ 3G71Z 1YJN1 1Q812 1VQ8Z 1M901 3G4S1 3CME1 1VQLZ 1K732 3I55Z 3CC2Z 1VQ41 1VQ5Z 3CCRZ 3CCS1 1YJW1 1K9M1 3CC71 1VQ9Z 3CXCZ 1N8R2 3CC4Z 3CPWY 1YIT1 1YIJ1 2QA41 1YJ91 1VQOZ 1YHQ1 1VQ6Z 1VQN1 1W2BZ 3CCJZ 1YI2Z 3G6EZ 1JJ2Y 3CCL1 1VQP1 1NJI2 1Q811 1YIJZ 3CCQ1 1VQ7Z 1VQM1
chains in the Genus database with same CATH superfamily
2QR1B 1QF8A 3OW2Y 2VUMI 3HOXI 3HOVI 1K8A2 1Q821 3J80b 1K731 1VQNZ 2OTJZ 3GKQA 4A3BI 1Y1VS 1QVGY 1QVFY 1I50I 3CQZI 2W03A 2QKDA 1N8R1 4MXUA 3S14I 2P28A 3CCMZ 2E2JI 1X3ZA 1WIIA 3MZLB 1M1K2 3VB9A 1KQSY 3CD61 3U50C 4A3DI 3HOYI 4S1TA 1TFIA 4NBHA 1FDOA 2DE7A 1WW9A 1YHQZ 1K8A1 2OTLZ 1TWHI 3VTNA 2F4OA 5D1OB 4A3II 3HOUI 4NBBA 3GTMI 1RLYA 2JA8I 3GTMS 1M902 3T4NB 3NH8A 1I3QI 2QRDB 3M3YI 3CMA1 4E30A 4RV9A 3NFZA 3CD6Z 5IT9b 1K9M2 3FQMA 3CCJ1 4RVFA 3G6E1 3J7A4 2BJOA 1VQ71 4MH4A 1Q7Y2 2JA5I 4E2XA 4A3FI 1YJN1 1P9NA 1M901 3CME1 1SIWA 3QWUA 2JA7I 4BBRI 3S1NI 3CCS1 1K9M1 3CC71 3S15I 1USPB 1Q16A 5IP7I 3S17I 4HGYA 4CL1A 1VQN1 2E7ZA 2R92I 3CCJZ 3G6EZ 1QYPA 3CCL1 2PM9A 2JA6I 3HOWI 1VQ7Z 3IR7A 3I561 3HOZI 2RIQA 2Q51A 1Q822 4A3CI 5D1OA 2K3RA 3CCM1 1YJNZ 1RNIA 2RBLA 1RO2A 2HU9A 3CMEZ 2P3YA 4DQYB 4MD9A 3TE5B 4DGLA 4E2YA 2RPRA 3H0GI 4A3LI 1NUIA 3CCE1 1VQK1 1KD11 2OTL1 1PFTA 3CCSZ 1WJ2A 1WZNA 2QLVB 3J80f 3CC7Z 3S1RI 5C44I 1X0TA 3GTGI 1Y1VI 1KC82 4NBFA 4NOZA 5C4JI 1JWHC 4RVDA 3CCLZ 3CCU1 4NB9A 5AN9F 3I56Z 4BBSI 1JJ2Z 4NBEA 1Y8CA 1X3WA 1K83I 2AKLA 4X6AI 3I551 3CC21 1DL6A 3J81b 3K7AI 2IV2X 2VPZA 3CCEZ 1VQKZ 2O53A 1KC81 1USPA 2Q4ZA 2M48A 4RVHA 2JIOA 1N2FA 3NH4A 2V8IA 4MONA 3NDIA 1I6HI 3CCUZ 4MD7A 3G4S1 2LEXA 1ZH1A 5IT9f 3I55Z 3CC2Z 3Q87A 1VQ41 4NB8A 3KIHA 2QRCB 1YJW1 3GTJI 1KRLA 5T6BA 4RVGA 2WAQA 2AYDA 4Y7NI 1YIT1 2JIMA 4QTTA 1S7MA 1RO4A 1W2BZ 1JJ2Y 1VQP1 1YIJZ 1Z01A 3P5JB 3D2LA 3HKZA 2NVQI 4A3GI 2LFUA 5A2Qf 3FKII 4NH1C 3EEDA 4NFRA 4DK1A 2JNYA 3G4SZ 1S721 2E9HA 2KI7B 2QEXZ 5FLXf 3JAMb 3MZKB 1Q862 4E2WA 1VQ4Z 5CM2M 1KD12 2R6MA 3PO2I 2F4MA 3CCVZ 1YJWZ 1YUAA 3FQQA 1ML8A 1YITZ 3CPWZ 1TWCI 2NVYI 3S1QI 1SFOI 1YUKA 1VQPZ 1TWFI 4BY7I 3G711 2ZAEB 4RS4A 4NBCA 1VQL1 4A3JI 1Q861 3S1MI 5D1PA 4A93I 1ZB9A 3S2DI 4EWCA 1VQ51 1S72Z 3LUSA 4NBAA 1Z02A 3S16I 2NAPA 1W2BY 3EERA 1VQO1 2VPXA 1TWGI 2V3VA 1YI21 2PK7A 2J6AA 2NVXI 4AYBA 3BG1B 1FDIA 4A3EI 3GTOI 2OOYB 2GU2A 5FLMI 2RT9A 1AA6A 3G71Z 2JIRA 2IZ3A 2K5RA 1VQLZ 2W04A 1ZB8A 1Z03A 1VQ5Z 3F3PC 2HF1A 3CXCZ 3CPWY 3PO3I 1YIJ1 2QA41 1L1OC 1YJ91 4NBGA 3S2HI 1VQOZ 2GTIA 3GTPI 1NP6A 3PO3S 2B63I 1YI2Z 3VMIA 2DE6A 1NJI2 4NBDA 5LL6f 3CCQ1 3IX0A 4MD8A 1VQM1 2R93I 2H85A 2QEX1 5C3EI 2V45A 2EGTA 5C4XI 2R7ZI 4E33A 2O4HA 1R9TI 2LIYA 3CCV1 2OOXB 2JR6A 2RHBA 5T64A 3GTKI 4Y52I 3KIFA 1Y1WI 2GTHA 1M1K1 3BG0B 3I07A 2Y0SA 3ESWA 1NJI1 2QA4Z 1YJ9Z 3NDJA 3RZDI 3GTQI 3JAMf 4E32A 2WB1A 2DE5A 1RQFA 3CCQZ 1VQMZ 1VQ81 2I3CA 3IF8A 2E2II 4A3MI 2JS4A 4TNUA 3I4MI 3OW2Z 2QREB 3CXCY 2VPYA 2VUGA 1TWAI 3F3FC 3CCR1 1QVGZ 3D9XA 1QVFZ 3CC41 1VQ91 2PMZA 4BXXI 4HH4A 3I4NI 1VQ61 4XX2A 2M6NA 3H3VJ 2YADA 5A2Qb 4E2ZA 3MONA 1KQSZ 3CMAZ 5IP9I 2KPIA 2JIQA 4E31A 2G2KA 1LQLA 5FLXb 1Q7Y1 2OTJ1 3D6WA 3NH5A 1Q812 2V8JA 4HGZA 1VQ8Z 1WCMI 2JMOA 3TDHB 2VF1A 1K732 3RZOI 2V8KA 2JUBA 4BY1I 3VMHA 3GCFA 3IFUA 3CCRZ 2OZKA 1VQ9Z 3CC4Z 1VLAA 2VPWA 1N8R2 2NVTI 2YU9I 5T67A 3VMGA 3M4OI 3J81f 1RO0A 1QXFA 2IZ4A 3GTLI 1YHQ1 1VQ6Z 2E2HI 4QTUA 2JIPA 4MRIA 4A3KI 1Q811
chains in the Genus database with same CATH topology
2QR1B 1QF8A 3OW2Y 2VUMI 3HOXI 3HOVI 1K8A2 1Q821 3J80b 1K731 1VQNZ 2OTJZ 3GKQA 4A3BI 1Y1VS 1QVGY 1QVFY 1I50I 3CQZI 2W03A 2QKDA 1N8R1 4MXUA 3S14I 2P28A 3CCMZ 2E2JI 1X3ZA 1WIIA 3MZLB 1M1K2 3VB9A 1KQSY 3CD61 3U50C 4A3DI 3HOYI 4S1TA 1TFIA 4NBHA 2DE7A 1YHQZ 1WW9A 1K8A1 2OTLZ 1TWHI 3VTNA 2F4OA 5D1OB 4A3II 3HOUI 4NBBA 3GTMI 1RLYA 2JA8I 3GTMS 1M902 3T4NB 3NH8A 1I3QI 2QRDB 3M3YI 3CMA1 4E30A 4RV9A 3NFZA 3CD6Z 5IT9b 1K9M2 3FQMA 3CCJ1 4RVFA 3G6E1 3J7A4 2BJOA 1VQ71 4MH4A 1Q7Y2 2JA5I 4E2XA 4A3FI 1YJN1 1P9NA 1M901 3CME1 3QWUA 2JA7I 4BBRI 3S1NI 3CCS1 1K9M1 3CC71 3S15I 1USPB 5IP7I 3S17I 4HGYA 4CL1A 1VQN1 2R92I 3CCJZ 3G6EZ 1QYPA 3CCL1 2PM9A 2JA6I 3HOWI 1VQ7Z 3I561 3HOZI 2RIQA 2Q51A 1Q822 4A3CI 5D1OA 2K3RA 3CCM1 1YJNZ 1RNIA 2RBLA 1RO2A 2HU9A 3CMEZ 2P3YA 4DQYB 4MD9A 3TE5B 4DGLA 4E2YA 2RPRA 3H0GI 4A3LI 1NUIA 3CCE1 1VQK1 1KD11 2OTL1 1PFTA 3CCSZ 2QLVB 3J80f 3CC7Z 3S1RI 5C44I 1X0TA 3GTGI 1Y1VI 1KC82 4NBFA 4NOZA 5C4JI 1JWHC 4RVDA 3CCLZ 3CCU1 4NB9A 5AN9F 3I56Z 4BBSI 1JJ2Z 4NBEA 1X3WA 1K83I 2AKLA 4X6AI 3I551 3CC21 1DL6A 3J81b 3K7AI 3CCEZ 1VQKZ 2O53A 1KC81 1USPA 2Q4ZA 2M48A 4RVHA 1N2FA 3NH4A 2V8IA 4MONA 3NDIA 1I6HI 3CCUZ 4MD7A 3G4S1 1ZH1A 5IT9f 3I55Z 3CC2Z 3Q87A 1VQ41 4NB8A 3KIHA 2QRCB 1YJW1 3GTJI 1KRLA 5T6BA 4RVGA 2WAQA 4Y7NI 1YIT1 4QTTA 1S7MA 1RO4A 1W2BZ 1JJ2Y 1VQP1 1YIJZ 1Z01A 3P5JB 3HKZA 2NVQI 4A3GI 2LFUA 5A2Qf 3FKII 4NH1C 3EEDA 4NFRA 4DK1A 2JNYA 3G4SZ 1S721 2E9HA 2KI7B 2QEXZ 5FLXf 3JAMb 3MZKB 1Q862 4E2WA 1VQ4Z 5CM2M 1KD12 2R6MA 3PO2I 2F4MA 3CCVZ 1YJWZ 1YUAA 3FQQA 1ML8A 1YITZ 3CPWZ 1TWCI 2NVYI 3S1QI 1SFOI 1YUKA 1VQPZ 1TWFI 4BY7I 3G711 2ZAEB 4RS4A 4NBCA 1VQL1 4A3JI 1Q861 3S1MI 5D1PA 4A93I 1ZB9A 3S2DI 4EWCA 1VQ51 1S72Z 3LUSA 4NBAA 1Z02A 3S16I 1W2BY 3EERA 1VQO1 1TWGI 1YI21 2PK7A 2J6AA 2NVXI 4AYBA 3BG1B 4A3EI 3GTOI 2OOYB 2GU2A 5FLMI 2RT9A 3G71Z 2IZ3A 2K5RA 1VQLZ 2W04A 1ZB8A 1Z03A 1VQ5Z 3F3PC 2HF1A 3CXCZ 3CPWY 3PO3I 1YIJ1 2QA41 1L1OC 1YJ91 4NBGA 3S2HI 1VQOZ 2GTIA 3GTPI 1NP6A 3PO3S 2B63I 1YI2Z 3VMIA 2DE6A 1NJI2 4NBDA 5LL6f 3CCQ1 3IX0A 1VQM1 4MD8A 2R93I 2H85A 2QEX1 5C3EI 2EGTA 5C4XI 2R7ZI 4E33A 2O4HA 1R9TI 2LIYA 3CCV1 2OOXB 2JR6A 2RHBA 5T64A 3GTKI 4Y52I 3KIFA 1Y1WI 2GTHA 1M1K1 3BG0B 3I07A 2Y0SA 3ESWA 1NJI1 2QA4Z 1YJ9Z 3NDJA 3RZDI 3GTQI 3JAMf 4E32A 2WB1A 2DE5A 1RQFA 3CCQZ 1VQMZ 1VQ81 2I3CA 3IF8A 2E2II 4A3MI 2JS4A 4TNUA 3I4MI 3OW2Z 2QREB 3CXCY 2VUGA 1TWAI 3F3FC 3CCR1 1QVGZ 3D9XA 1QVFZ 3CC41 1VQ91 2PMZA 4BXXI 4HH4A 3I4NI 1VQ61 4XX2A 2M6NA 3H3VJ 2YADA 5A2Qb 4E2ZA 3MONA 1KQSZ 3CMAZ 5IP9I 2KPIA 4E31A 2G2KA 1LQLA 5FLXb 1Q7Y1 2OTJ1 3D6WA 3NH5A 1Q812 2V8JA 4HGZA 1VQ8Z 1WCMI 2JMOA 3TDHB 2VF1A 1K732 3RZOI 2V8KA 2JUBA 4BY1I 3VMHA 3GCFA 3IFUA 3CCRZ 2OZKA 1VQ9Z 3CC4Z 1VLAA 1N8R2 2NVTI 2YU9I 5T67A 3VMGA 3M4OI 3J81f 1RO0A 2IZ4A 3GTLI 1YHQ1 1VQ6Z 2E2HI 4QTUA 4MRIA 4A3KI 1Q811
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 Y;  3I56 1;  2QEX 1;  1K8A 2;  1Q82 1;  1Q82 2;  1K73 1;  1VQN Z;  2OTJ Z;  3CCM 1;  1QVG Y;  1QVF Y;  1YJN Z;  3G4S Z;  3CME Z;  3CCV 1;  1S72 1;  2QEX Z;  1N8R 1;  1Q86 2;  3CCM Z;  1VQ4 Z;  3CCE 1;  1VQK 1;  1KD1 1;  1KD1 2;  2OTL 1;  3CCV Z;  3CCS Z;  1M1K 1;  1YJW Z;  1M1K 2;  3CC7 Z;  1KQS Y;  3CD6 1;  1NJI 1;  1YIT Z;  2QA4 Z;  1YJ9 Z;  3CPW Z;  1KC8 2;  1YHQ Z;  1K8A 1;  2OTL Z;  3CCL Z;  1VQP Z;  3CCU 1;  3CCQ Z;  3G71 1;  1VQM Z;  1VQ8 1;  3I56 Z;  1JJ2 Z;  1VQL 1;  3OW2 Z;  1Q86 1;  3I55 1;  3CC2 1;  3CXC Y;  1VQ5 1;  1S72 Z;  1M90 2;  3CCR 1;  1QVG Z;  1QVF Z;  1VQ9 1;  3CC4 1;  3CCE Z;  1VQK Z;  1W2B Y;  1VQO 1;  1KC8 1;  3CMA 1;  1VQ6 1;  3CD6 Z;  1K9M 2;  3CCJ 1;  1YI2 1;  3G6E 1;  1KQS Z;  1VQ7 1;  3CMA Z;  1Q7Y 1;  1Q7Y 2;  2OTJ 1;  3CCU Z;  3G71 Z;  1YJN 1;  1Q81 2;  1VQ8 Z;  1M90 1;  3G4S 1;  3CME 1;  1VQL Z;  1K73 2;  3I55 Z;  3CC2 Z;  1VQ4 1;  1VQ5 Z;  3CCR Z;  3CCS 1;  1YJW 1;  1K9M 1;  3CC7 1;  1VQ9 Z;  3CXC Z;  1N8R 2;  3CC4 Z;  3CPW Y;  1YIT 1;  1YIJ 1;  2QA4 1;  1YJ9 1;  1VQO Z;  1YHQ 1;  1VQ6 Z;  1VQN 1;  1W2B Z;  3CCJ Z;  1YI2 Z;  3G6E Z;  1JJ2 Y;  3CCL 1;  1VQP 1;  1NJI 2;  1Q81 1;  1YIJ Z;  3CCQ 1;  1VQ7 Z;  1VQM 1; 
#chains in the Genus database with same CATH topology
 2QR1 B;  1QF8 A;  3OW2 Y;  2VUM I;  3HOX I;  3HOV I;  1K8A 2;  1Q82 1;  3J80 b;  1K73 1;  1VQN Z;  2OTJ Z;  3GKQ A;  4A3B I;  1Y1V S;  1QVG Y;  1QVF Y;  1I50 I;  3CQZ I;  2W03 A;  2QKD A;  1N8R 1;  4MXU A;  3S14 I;  2P28 A;  3CCM Z;  2E2J I;  1X3Z A;  1WII A;  3MZL B;  1M1K 2;  3VB9 A;  1KQS Y;  3CD6 1;  3U50 C;  4A3D I;  3HOY I;  4S1T A;  1TFI A;  4NBH A;  1FDO A;  2DE7 A;  1WW9 A;  1YHQ Z;  1K8A 1;  2OTL Z;  1TWH I;  3VTN A;  2F4O A;  5D1O B;  4A3I I;  3HOU I;  4NBB A;  3GTM I;  1RLY A;  2JA8 I;  3GTM S;  1M90 2;  3T4N B;  3NH8 A;  1I3Q I;  2QRD B;  3M3Y I;  3CMA 1;  4E30 A;  4RV9 A;  3NFZ A;  3CD6 Z;  5IT9 b;  1K9M 2;  3FQM A;  3CCJ 1;  4RVF A;  3G6E 1;  3J7A 4;  2BJO A;  1VQ7 1;  4MH4 A;  1Q7Y 2;  2JA5 I;  4E2X A;  4A3F I;  1YJN 1;  1P9N A;  1M90 1;  3CME 1;  1SIW A;  3QWU A;  2JA7 I;  4BBR I;  3S1N I;  3CCS 1;  1K9M 1;  3CC7 1;  3S15 I;  1USP B;  1Q16 A;  5IP7 I;  3S17 I;  4HGY A;  4CL1 A;  1VQN 1;  2E7Z A;  2R92 I;  3CCJ Z;  3G6E Z;  1QYP A;  3CCL 1;  2PM9 A;  2JA6 I;  3HOW I;  1VQ7 Z;  3IR7 A;  3I56 1;  3HOZ I;  2RIQ A;  2Q51 A;  1Q82 2;  4A3C I;  5D1O A;  2K3R A;  3CCM 1;  1YJN Z;  1RNI A;  2RBL A;  1RO2 A;  2HU9 A;  3CME Z;  2P3Y A;  4DQY B;  4MD9 A;  3TE5 B;  4DGL A;  4E2Y A;  2RPR A;  3H0G I;  4A3L I;  1NUI A;  3CCE 1;  1VQK 1;  1KD1 1;  2OTL 1;  1PFT A;  3CCS Z;  1WJ2 A;  1WZN A;  2QLV B;  3J80 f;  3CC7 Z;  3S1R I;  5C44 I;  1X0T A;  3GTG I;  1Y1V I;  1KC8 2;  4NBF A;  4NOZ A;  5C4J I;  1JWH C;  4RVD A;  3CCL Z;  3CCU 1;  4NB9 A;  5AN9 F;  3I56 Z;  4BBS I;  1JJ2 Z;  4NBE A;  1Y8C A;  1X3W A;  1K83 I;  2AKL A;  4X6A I;  3I55 1;  3CC2 1;  1DL6 A;  3J81 b;  3K7A I;  2IV2 X;  2VPZ A;  3CCE Z;  1VQK Z;  2O53 A;  1KC8 1;  1USP A;  2Q4Z A;  2M48 A;  4RVH A;  2JIO A;  1N2F A;  3NH4 A;  2V8I A;  4MON A;  3NDI A;  1I6H I;  3CCU Z;  4MD7 A;  3G4S 1;  2LEX A;  1ZH1 A;  5IT9 f;  3I55 Z;  3CC2 Z;  3Q87 A;  1VQ4 1;  4NB8 A;  3KIH A;  2QRC B;  1YJW 1;  3GTJ I;  1KRL A;  5T6B A;  4RVG A;  2WAQ A;  2AYD A;  4Y7N I;  1YIT 1;  2JIM A;  4QTT A;  1S7M A;  1RO4 A;  1W2B Z;  1JJ2 Y;  1VQP 1;  1YIJ Z;  1Z01 A;  3P5J B;  3D2L A;  3HKZ A;  2NVQ I;  4A3G I;  2LFU A;  5A2Q f;  3FKI I;  4NH1 C;  3EED A;  4NFR A;  4DK1 A;  2JNY A;  3G4S Z;  1S72 1;  2E9H A;  2KI7 B;  2QEX Z;  5FLX f;  3JAM b;  3MZK B;  1Q86 2;  4E2W A;  1VQ4 Z;  5CM2 M;  1KD1 2;  2R6M A;  3PO2 I;  2F4M A;  3CCV Z;  1YJW Z;  1YUA A;  3FQQ A;  1ML8 A;  1YIT Z;  3CPW Z;  1TWC I;  2NVY I;  3S1Q I;  1SFO I;  1YUK A;  1VQP Z;  1TWF I;  4BY7 I;  3G71 1;  2ZAE B;  4RS4 A;  4NBC A;  1VQL 1;  4A3J I;  1Q86 1;  3S1M I;  5D1P A;  4A93 I;  1ZB9 A;  3S2D I;  4EWC A;  1VQ5 1;  1S72 Z;  3LUS A;  4NBA A;  1Z02 A;  3S16 I;  2NAP A;  1W2B Y;  3EER A;  1VQO 1;  2VPX A;  1TWG I;  2V3V A;  1YI2 1;  2PK7 A;  2J6A A;  2NVX I;  4AYB A;  3BG1 B;  1FDI A;  4A3E I;  3GTO I;  2OOY B;  2GU2 A;  5FLM I;  2RT9 A;  1AA6 A;  3G71 Z;  2JIR A;  2IZ3 A;  2K5R A;  1VQL Z;  2W04 A;  1ZB8 A;  1Z03 A;  1VQ5 Z;  3F3P C;  2HF1 A;  3CXC Z;  3CPW Y;  3PO3 I;  1YIJ 1;  2QA4 1;  1L1O C;  1YJ9 1;  4NBG A;  3S2H I;  1VQO Z;  2GTI A;  3GTP I;  1NP6 A;  3PO3 S;  2B63 I;  1YI2 Z;  3VMI A;  2DE6 A;  1NJI 2;  4NBD A;  5LL6 f;  3CCQ 1;  3IX0 A;  4MD8 A;  1VQM 1;  2R93 I;  2H85 A;  2QEX 1;  5C3E I;  2V45 A;  2EGT A;  5C4X I;  2R7Z I;  4E33 A;  2O4H A;  1R9T I;  2LIY A;  3CCV 1;  2OOX B;  2JR6 A;  2RHB A;  5T64 A;  3GTK I;  4Y52 I;  3KIF A;  1Y1W I;  2GTH A;  1M1K 1;  3BG0 B;  3I07 A;  2Y0S A;  3ESW A;  1NJI 1;  2QA4 Z;  1YJ9 Z;  3NDJ A;  3RZD I;  3GTQ I;  3JAM f;  4E32 A;  2WB1 A;  2DE5 A;  1RQF A;  3CCQ Z;  1VQM Z;  1VQ8 1;  2I3C A;  3IF8 A;  2E2I I;  4A3M I;  2JS4 A;  4TNU A;  3I4M I;  3OW2 Z;  2QRE B;  3CXC Y;  2VPY A;  2VUG A;  1TWA I;  3F3F C;  3CCR 1;  1QVG Z;  3D9X A;  1QVF Z;  3CC4 1;  1VQ9 1;  2PMZ A;  4BXX I;  4HH4 A;  3I4N I;  1VQ6 1;  4XX2 A;  2M6N A;  3H3V J;  2YAD A;  5A2Q b;  4E2Z A;  3MON A;  1KQS Z;  3CMA Z;  5IP9 I;  2KPI A;  2JIQ A;  4E31 A;  2G2K A;  1LQL A;  5FLX b;  1Q7Y 1;  2OTJ 1;  3D6W A;  3NH5 A;  1Q81 2;  2V8J A;  4HGZ A;  1VQ8 Z;  1WCM I;  2JMO A;  3TDH B;  2VF1 A;  1K73 2;  3RZO I;  2V8K A;  2JUB A;  4BY1 I;  3VMH A;  3GCF A;  3IFU A;  3CCR Z;  2OZK A;  1VQ9 Z;  3CC4 Z;  1VLA A;  2VPW A;  1N8R 2;  2NVT I;  2YU9 I;  5T67 A;  3VMG A;  3M4O I;  3J81 f;  1RO0 A;  1QXF A;  2IZ4 A;  3GTL I;  1YHQ 1;  1VQ6 Z;  2E2H I;  4QTU A;  2JIP A;  4MRI A;  4A3K I;  1Q81 1; 
#chains in the Genus database with same CATH homology
 2QR1 B;  1QF8 A;  3OW2 Y;  2VUM I;  3HOX I;  3HOV I;  1K8A 2;  1Q82 1;  3J80 b;  1K73 1;  1VQN Z;  2OTJ Z;  3GKQ A;  4A3B I;  1Y1V S;  1QVG Y;  1QVF Y;  1I50 I;  3CQZ I;  2W03 A;  2QKD A;  1N8R 1;  4MXU A;  3S14 I;  2P28 A;  3CCM Z;  2E2J I;  1X3Z A;  1WII A;  3MZL B;  1M1K 2;  3VB9 A;  1KQS Y;  3CD6 1;  3U50 C;  4A3D I;  3HOY I;  4S1T A;  1TFI A;  4NBH A;  2DE7 A;  1YHQ Z;  1WW9 A;  1K8A 1;  2OTL Z;  1TWH I;  3VTN A;  2F4O A;  5D1O B;  4A3I I;  3HOU I;  4NBB A;  3GTM I;  1RLY A;  2JA8 I;  3GTM S;  1M90 2;  3T4N B;  3NH8 A;  1I3Q I;  2QRD B;  3M3Y I;  3CMA 1;  4E30 A;  4RV9 A;  3NFZ A;  3CD6 Z;  5IT9 b;  1K9M 2;  3FQM A;  3CCJ 1;  4RVF A;  3G6E 1;  3J7A 4;  2BJO A;  1VQ7 1;  4MH4 A;  1Q7Y 2;  2JA5 I;  4E2X A;  4A3F I;  1YJN 1;  1P9N A;  1M90 1;  3CME 1;  3QWU A;  2JA7 I;  4BBR I;  3S1N I;  3CCS 1;  1K9M 1;  3CC7 1;  3S15 I;  1USP B;  5IP7 I;  3S17 I;  4HGY A;  4CL1 A;  1VQN 1;  2R92 I;  3CCJ Z;  3G6E Z;  1QYP A;  3CCL 1;  2PM9 A;  2JA6 I;  3HOW I;  1VQ7 Z;  3I56 1;  3HOZ I;  2RIQ A;  2Q51 A;  1Q82 2;  4A3C I;  5D1O A;  2K3R A;  3CCM 1;  1YJN Z;  1RNI A;  2RBL A;  1RO2 A;  2HU9 A;  3CME Z;  2P3Y A;  4DQY B;  4MD9 A;  3TE5 B;  4DGL A;  4E2Y A;  2RPR A;  3H0G I;  4A3L I;  1NUI A;  3CCE 1;  1VQK 1;  1KD1 1;  2OTL 1;  1PFT A;  3CCS Z;  2QLV B;  3J80 f;  3CC7 Z;  3S1R I;  5C44 I;  1X0T A;  3GTG I;  1Y1V I;  1KC8 2;  4NBF A;  4NOZ A;  5C4J I;  1JWH C;  4RVD A;  3CCL Z;  3CCU 1;  4NB9 A;  5AN9 F;  3I56 Z;  4BBS I;  1JJ2 Z;  4NBE A;  1X3W A;  1K83 I;  2AKL A;  4X6A I;  3I55 1;  3CC2 1;  1DL6 A;  3J81 b;  3K7A I;  3CCE Z;  1VQK Z;  2O53 A;  1KC8 1;  1USP A;  2Q4Z A;  2M48 A;  4RVH A;  1N2F A;  3NH4 A;  2V8I A;  4MON A;  3NDI A;  1I6H I;  3CCU Z;  4MD7 A;  3G4S 1;  1ZH1 A;  5IT9 f;  3I55 Z;  3CC2 Z;  3Q87 A;  1VQ4 1;  4NB8 A;  3KIH A;  2QRC B;  1YJW 1;  3GTJ I;  1KRL A;  5T6B A;  4RVG A;  2WAQ A;  4Y7N I;  1YIT 1;  4QTT A;  1S7M A;  1RO4 A;  1W2B Z;  1JJ2 Y;  1VQP 1;  1YIJ Z;  1Z01 A;  3P5J B;  3HKZ A;  2NVQ I;  4A3G I;  2LFU A;  5A2Q f;  3FKI I;  4NH1 C;  3EED A;  4NFR A;  4DK1 A;  2JNY A;  3G4S Z;  1S72 1;  2E9H A;  2KI7 B;  2QEX Z;  5FLX f;  3JAM b;  3MZK B;  1Q86 2;  4E2W A;  1VQ4 Z;  5CM2 M;  1KD1 2;  2R6M A;  3PO2 I;  2F4M A;  3CCV Z;  1YJW Z;  1YUA A;  3FQQ A;  1ML8 A;  1YIT Z;  3CPW Z;  1TWC I;  2NVY I;  3S1Q I;  1SFO I;  1YUK A;  1VQP Z;  1TWF I;  4BY7 I;  3G71 1;  2ZAE B;  4RS4 A;  4NBC A;  1VQL 1;  4A3J I;  1Q86 1;  3S1M I;  5D1P A;  4A93 I;  1ZB9 A;  3S2D I;  4EWC A;  1VQ5 1;  1S72 Z;  3LUS A;  4NBA A;  1Z02 A;  3S16 I;  1W2B Y;  3EER A;  1VQO 1;  1TWG I;  1YI2 1;  2PK7 A;  2J6A A;  2NVX I;  4AYB A;  3BG1 B;  4A3E I;  3GTO I;  2OOY B;  2GU2 A;  5FLM I;  2RT9 A;  3G71 Z;  2IZ3 A;  2K5R A;  1VQL Z;  2W04 A;  1ZB8 A;  1Z03 A;  1VQ5 Z;  3F3P C;  2HF1 A;  3CXC Z;  3CPW Y;  3PO3 I;  1YIJ 1;  2QA4 1;  1L1O C;  1YJ9 1;  4NBG A;  3S2H I;  1VQO Z;  2GTI A;  3GTP I;  1NP6 A;  3PO3 S;  2B63 I;  1YI2 Z;  3VMI A;  2DE6 A;  1NJI 2;  4NBD A;  5LL6 f;  3CCQ 1;  3IX0 A;  1VQM 1;  4MD8 A;  2R93 I;  2H85 A;  2QEX 1;  5C3E I;  2EGT A;  5C4X I;  2R7Z I;  4E33 A;  2O4H A;  1R9T I;  2LIY A;  3CCV 1;  2OOX B;  2JR6 A;  2RHB A;  5T64 A;  3GTK I;  4Y52 I;  3KIF A;  1Y1W I;  2GTH A;  1M1K 1;  3BG0 B;  3I07 A;  2Y0S A;  3ESW A;  1NJI 1;  2QA4 Z;  1YJ9 Z;  3NDJ A;  3RZD I;  3GTQ I;  3JAM f;  4E32 A;  2WB1 A;  2DE5 A;  1RQF A;  3CCQ Z;  1VQM Z;  1VQ8 1;  2I3C A;  3IF8 A;  2E2I I;  4A3M I;  2JS4 A;  4TNU A;  3I4M I;  3OW2 Z;  2QRE B;  3CXC Y;  2VUG A;  1TWA I;  3F3F C;  3CCR 1;  1QVG Z;  3D9X A;  1QVF Z;  3CC4 1;  1VQ9 1;  2PMZ A;  4BXX I;  4HH4 A;  3I4N I;  1VQ6 1;  4XX2 A;  2M6N A;  3H3V J;  2YAD A;  5A2Q b;  4E2Z A;  3MON A;  1KQS Z;  3CMA Z;  5IP9 I;  2KPI A;  4E31 A;  2G2K A;  1LQL A;  5FLX b;  1Q7Y 1;  2OTJ 1;  3D6W A;  3NH5 A;  1Q81 2;  2V8J A;  4HGZ A;  1VQ8 Z;  1WCM I;  2JMO A;  3TDH B;  2VF1 A;  1K73 2;  3RZO I;  2V8K A;  2JUB A;  4BY1 I;  3VMH A;  3GCF A;  3IFU A;  3CCR Z;  2OZK A;  1VQ9 Z;  3CC4 Z;  1VLA A;  1N8R 2;  2NVT I;  2YU9 I;  5T67 A;  3VMG A;  3M4O I;  3J81 f;  1RO0 A;  2IZ4 A;  3GTL I;  1YHQ 1;  1VQ6 Z;  2E2H I;  4QTU A;  4MRI A;  4A3K I;  1Q81 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...