1W2BZ

Trigger factor ribosome binding domain in complex with 50s
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bZ00
3CC4Z 1N8R2 1VQL1 3CCUZ 1QVFZ 1Q862 2QEX1 1YJ9Z 1JJ2Z 1YJWZ 1VQ6Z 1JJ2Y 1VQ4Z 1VQ7Z 3G6EZ 3OW2Z 3CCQ1 1M1K1 1YHQZ 3OW2Y 1YIJZ 3CMAZ 2QA4Z 3CCL1 1M902 1KC82 3CCJZ 3I56Z 3CXCZ 1M901 1VQLZ 3CXCY 2QEXZ 1K732 1NJI1 1YI21 2OTL1 1YJNZ 1K731 3CCV1 1QVFY 1VQ5Z 1K9M1 1W2BZ 3CCM1 1VQ91 3I55Z 1VQN1 3CCS1 1M1K2 3CC21 1Q822 1KQSZ 1Q812 1VQ81 3CCEZ 1KQSY 1Q821 1Q811 3CD61 1KD11 1NJI2 1YIT1 2OTLZ 1K8A1 1VQO1 1VQM1 3CCVZ 3CCU1 1YJ91 1K9M2 1VQ61 3CCMZ 2OTJ1 3G711 1VQ9Z 1QVGZ 1VQNZ 3CC2Z 3CCR1 1QVGY 3G4S1 3CME1 3CCQZ 1W2BY 3CC71 1Q7Y2 3CCLZ 1S721 1VQP1 1VQK1 3CMA1 1Q7Y1 1KD12 1YITZ 3I561 1K8A2 1VQOZ 1YI2Z 1VQMZ 1N8R1 3CC41 1YJN1 1Q861 2OTJZ 3G71Z 1YJW1 1VQ51 3CCRZ 3G4SZ 3CMEZ 3CCSZ 3CC7Z 1VQ41 1VQ71 3I551 3G6E1 1VQ8Z 1S72Z 1VQPZ 1VQKZ 1YHQ1 3CCE1 1YIJ1 3CD6Z 3CPWZ 2QA41 1KC81 3CCJ1 3CPWY
chains in the Genus database with same CATH superfamily
3VB9A 2OOYB 2JMOA 3FKII 3PO2I 1SIWA 3CCUZ 3M3YI 1Q862 4NBAA 3NH4A 1LQLA 4QTTA 1JJ2Z 2KI7B 1YJWZ 2IZ3A 1JJ2Y 2R93I 2V8IA 5D1OA 3G6EZ 3OW2Z 1M1K1 3TE5B 1YHQZ 4A3FI 3OW2Y 1YIJZ 4A3GI 3CMAZ 2QA4Z 4BXXI 1NP6A 5A2Qf 4E30A 4A3KI 1NUIA 2W03A 1K732 1TWHI 1YJNZ 1WZNA 3KIHA 4MH4A 4RVHA 3CCV1 2DE7A 1QVFY 1I50I 1RQFA 1W2BZ 1VQ91 2HU9A 1KQSZ 1Q812 2JA7I 2F4OA 1KQSY 4RV9A 2LFUA 3S2HI 1TWFI 1KD11 3GTGI 1NJI2 1P9NA 3HKZA 2OTLZ 4A3CI 2M6NA 1ML8A 1DL6A 3EERA 4NB9A 1Z02A 3S15I 3G711 5AN9F 2RT9A 1RLYA 3HOYI 3D9XA 3CME1 3CCQZ 4X6AI 2K5RA 1Q7Y2 3CCLZ 1S721 2JIOA 2V8KA 2QREB 2VPYA 3S14I 3GTMS 2I3CA 1YI2Z 1N8R1 2PK7A 4MD9A 1Q16A 4NBCA 3G4SZ 3IR7A 1VQ41 2YU9I 3I551 1VQ8Z 1VQPZ 3GTOI 3VMHA 3CCE1 3CD6Z 3CPWZ 3GCFA 1KC81 3CPWY 5T64A 1Y1VI 4RVFA 3D6WA 1VQL1 2QEX1 1YJ9Z 2O4HA 2VPWA 1VLAA 3IX0A 3HOXI 4A3BI 2LIYA 1VQ7Z 1X3WA 4DGLA 4MD7A 2ZAEB 4MRIA 3F3FC 2OOXB 2NAPA 4NBEA 1RO4A 1X3ZA 3I56Z 3S1MI 5CM2M 1M901 2GTIA 2JIQA 4Y52I 2JS4A 2NVQI 4DQYB 3I4NI 3NH5A 2EGTA 1QF8A 1VQ5Z 3IF8A 3PO3S 2VPXA 3TDHB 4E33A 4NH1C 4HH4A 3J7A4 3P5JB 1L1OC 1Q821 3JAMb 2H85A 1WW9A 1ZB9A 1TFIA 4MONA 3NDIA 5LL6f 1YIT1 2R6MA 1K8A1 1VQO1 1VQM1 3CCVZ 3CCU1 2E9HA 1K9M2 2JUBA 1USPB 2OTJ1 1VQ9Z 1RO0A 2GTHA 3CCR1 1W2BY 1QXFA 3CMA1 2V45A 1I6HI 1KRLA 2K3RA 3J80f 1PFTA 4E2ZA 3ESWA 3JAMf 4BBSI 4E31A 2VUMI 3KIFA 3CC41 1YJN1 2B63I 1Q861 3G71Z 4A3MI 2JR6A 4EWCA 3CMEZ 4A3II 3MZLB 3CCSZ 3MONA 3FQMA 2E2JI 3F3PC 4S1TA 1S72Z 3GTMI 2NVTI 2QR1B 2OZKA 1USPA 2G2KA 3I07A 2PM9A 1WCMI 2W04A 2LEXA 3IFUA 3QWUA 2V3VA 3CCJ1 1JWHC 2Y0SA 3NH8A 3NFZA 4QTUA 1X0TA 4E2YA 5IP7I 1VQ6Z 1ZH1A 2IV2X 1VQ4Z 3GTJI 2AKLA 4CL1A 2PMZA 3MZKB 2E2HI 3CCQ1 4RVGA 3S1QI 2IZ4A 3CCL1 1M902 4Y7NI 3I4MI 2JA5I 1VQLZ 2QEXZ 1NJI1 1YI21 2V8JA 2F4MA 2YADA 4NOZA 2P3YA 2J6AA 3CCM1 5T67A 1VQN1 3GTPI 1Z01A 2HF1A 1M1K2 3FQQA 3CC21 1Q822 4MD8A 1VQ81 2M48A 4MXUA 2QRCB 4HGYA 2JA6I 3CD61 5FLXb 5D1OB 1YUKA 3PO3I 1YJ91 2RHBA 3Q87A 3VMGA 3S1NI 2QRDB 1K83I 3GTLI 1FDIA 3K7AI 5C3EI 4E2XA 4A3DI 2VF1A 1S7MA 3GTQI 3CC71 1VQK1 1TWAI 1KD12 3J80b 3S1RI 1YITZ 3GKQA 3I561 4A3JI 1VQOZ 1VQMZ 1WJ2A 5FLXf 4A3EI 5T6BA 2WAQA 2OTJZ 4DK1A 5IT9b 1YJW1 1VQ51 3CCRZ 1N2FA 2GU2A 2R92I 3G6E1 2KPIA 1YHQ1 1TWCI 4TNUA 1YIJ1 2QA41 4AYBA 4NBBA 3CC4Z 4NBHA 1N8R2 3NDJA 4E2WA 3H0GI 5C4JI 1QVFZ 4A93I 4BY7I 5C4XI 1Y1WI 4XX2A 1ZB8A 2DE6A 2E2II 4NFRA 2E7ZA 3D2LA 3VMIA 3S17I 5IT9f 2JIRA 2NVYI 2JIMA 3GTKI 1FDOA 2RIQA 1KC82 1QYPA 1RO2A 3CCJZ 2VPZA 3CXCZ 1Y8CA 4NBDA 1R9TI 3CXCY 3RZOI 4NB8A 2OTL1 2P28A 1K731 2NVXI 2RBLA 1K9M1 4BY1I 2AYDA 3I55Z 1YUAA 3U50C 3CCS1 4NBFA 1AA6A 2QKDA 3RZDI 3CQZI 3CCEZ 1RNIA 1Q811 1I3QI 1Z03A 5FLMI 1WIIA 4E32A 4A3LI 2RPRA 3H3VJ 3BG1B 4NBGA 1VQ61 5IP9I 3CCMZ 3M4OI 2Q51A 2JNYA 1QVGZ 1VQNZ 1TWGI 5D1PA 3CC2Z 1QVGY 3G4S1 3J81b 2BJOA 1VQP1 1Q7Y1 2JA8I 3HOVI 1K8A2 4HGZA 2R7ZI 4BBRI 2VUGA 3LUSA 5C44I 1SFOI 1Y1VS 2DE5A 3HOZI 3HOUI 3EEDA 3HOWI 3S16I 3VTNA 3CC7Z 2JIPA 1VQ71 3S2DI 1VQKZ 5A2Qb 3T4NB 2QLVB 4RS4A 2WB1A 4RVDA 3J81f 2O53A 2Q4ZA 3BG0B
chains in the Genus database with same CATH topology
3VB9A 2OOYB 2JMOA 3FKII 3PO2I 3M3YI 3CCUZ 1Q862 4NBAA 3NH4A 1LQLA 4QTTA 1JJ2Z 2KI7B 1YJWZ 2IZ3A 1JJ2Y 2R93I 2V8IA 5D1OA 3G6EZ 3OW2Z 1M1K1 3TE5B 1YHQZ 4A3FI 3OW2Y 1YIJZ 4A3GI 3CMAZ 2QA4Z 4BXXI 1NP6A 5A2Qf 4E30A 4A3KI 1NUIA 2W03A 1K732 1TWHI 1YJNZ 3KIHA 4MH4A 4RVHA 3CCV1 2DE7A 1QVFY 1I50I 1RQFA 1W2BZ 1VQ91 2HU9A 1KQSZ 1Q812 2JA7I 2F4OA 1KQSY 4RV9A 2LFUA 3S2HI 1TWFI 1KD11 3GTGI 1NJI2 1P9NA 3HKZA 2OTLZ 4A3CI 2M6NA 1ML8A 1DL6A 3EERA 4NB9A 1Z02A 3S15I 3G711 5AN9F 2RT9A 1RLYA 3HOYI 3D9XA 3CME1 3CCQZ 4X6AI 2K5RA 1Q7Y2 3CCLZ 1S721 2V8KA 2QREB 3S14I 3GTMS 2I3CA 1YI2Z 1N8R1 2PK7A 4MD9A 4NBCA 3G4SZ 1VQ41 2YU9I 3I551 1VQ8Z 1VQPZ 3GTOI 3VMHA 3CCE1 3CD6Z 3CPWZ 3GCFA 1KC81 3CPWY 5T64A 1Y1VI 4RVFA 3D6WA 1VQL1 2QEX1 1YJ9Z 2O4HA 1VLAA 3IX0A 3HOXI 4A3BI 2LIYA 1VQ7Z 1X3WA 4DGLA 4MD7A 2ZAEB 4MRIA 3F3FC 2OOXB 4NBEA 1RO4A 1X3ZA 3I56Z 3S1MI 5CM2M 1M901 2GTIA 4Y52I 2JS4A 2NVQI 4DQYB 3I4NI 3NH5A 2EGTA 1QF8A 1VQ5Z 3IF8A 3PO3S 3TDHB 4E33A 4NH1C 4HH4A 3J7A4 3P5JB 1L1OC 1Q821 3JAMb 2H85A 1WW9A 1ZB9A 1TFIA 4MONA 3NDIA 5LL6f 1YIT1 2R6MA 1K8A1 1VQO1 1VQM1 3CCVZ 3CCU1 2E9HA 1K9M2 2JUBA 1USPB 2OTJ1 1VQ9Z 1RO0A 2GTHA 3CCR1 1W2BY 3CMA1 1I6HI 1KRLA 2K3RA 3J80f 1PFTA 4E2ZA 3ESWA 3JAMf 4BBSI 4E31A 2VUMI 3KIFA 3CC41 1YJN1 2B63I 1Q861 3G71Z 4A3MI 2JR6A 4EWCA 3CMEZ 4A3II 3MZLB 3CCSZ 3MONA 3FQMA 2E2JI 3F3PC 4S1TA 1S72Z 3GTMI 2NVTI 2QR1B 2OZKA 1USPA 2G2KA 3I07A 2PM9A 1WCMI 2W04A 3IFUA 3QWUA 3CCJ1 1JWHC 2Y0SA 3NH8A 3NFZA 4QTUA 1X0TA 4E2YA 5IP7I 1VQ6Z 1ZH1A 1VQ4Z 3GTJI 2AKLA 4CL1A 2PMZA 3MZKB 2E2HI 3CCQ1 4RVGA 3S1QI 2IZ4A 3CCL1 1M902 4Y7NI 3I4MI 2JA5I 1VQLZ 2QEXZ 1NJI1 1YI21 2V8JA 2F4MA 2YADA 4NOZA 2P3YA 2J6AA 3CCM1 5T67A 1VQN1 3GTPI 1Z01A 2HF1A 1M1K2 3FQQA 3CC21 1Q822 4MD8A 1VQ81 2M48A 4MXUA 2QRCB 4HGYA 2JA6I 3CD61 5FLXb 5D1OB 1YUKA 3PO3I 1YJ91 2RHBA 3Q87A 3VMGA 3S1NI 2QRDB 1K83I 3GTLI 3K7AI 5C3EI 4E2XA 4A3DI 2VF1A 1S7MA 3GTQI 3CC71 1VQK1 1TWAI 1KD12 3J80b 3S1RI 1YITZ 3GKQA 3I561 4A3JI 1VQOZ 1VQMZ 5FLXf 4A3EI 5T6BA 2WAQA 2OTJZ 4DK1A 5IT9b 1YJW1 1VQ51 3CCRZ 1N2FA 2GU2A 2R92I 3G6E1 2KPIA 1YHQ1 1TWCI 4TNUA 1YIJ1 2QA41 4AYBA 4NBBA 3CC4Z 4NBHA 1N8R2 3NDJA 4E2WA 3H0GI 5C4JI 1QVFZ 4A93I 4BY7I 5C4XI 1Y1WI 4XX2A 1ZB8A 2DE6A 2E2II 4NFRA 3VMIA 3S17I 5IT9f 2NVYI 3GTKI 2RIQA 1KC82 1QYPA 1RO2A 3CCJZ 3CXCZ 4NBDA 1R9TI 3CXCY 3RZOI 4NB8A 2OTL1 2P28A 1K731 2NVXI 2RBLA 1K9M1 4BY1I 3I55Z 1YUAA 3U50C 3CCS1 4NBFA 2QKDA 3RZDI 3CQZI 3CCEZ 1RNIA 1Q811 1I3QI 1Z03A 5FLMI 1WIIA 4E32A 4A3LI 2RPRA 3H3VJ 3BG1B 4NBGA 1VQ61 5IP9I 3CCMZ 3M4OI 2Q51A 2JNYA 1QVGZ 1VQNZ 1TWGI 5D1PA 3CC2Z 1QVGY 3G4S1 3J81b 2BJOA 1VQP1 1Q7Y1 2JA8I 3HOVI 1K8A2 4HGZA 2R7ZI 4BBRI 2VUGA 3LUSA 5C44I 1SFOI 1Y1VS 2DE5A 3HOZI 3HOUI 3EEDA 3HOWI 3S16I 3VTNA 3CC7Z 1VQ71 3S2DI 1VQKZ 5A2Qb 3T4NB 2QLVB 4RS4A 2WB1A 4RVDA 3J81f 2O53A 2Q4ZA 3BG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC4 Z;  1N8R 2;  1VQL 1;  3CCU Z;  1QVF Z;  1Q86 2;  2QEX 1;  1YJ9 Z;  1JJ2 Z;  1YJW Z;  1VQ6 Z;  1JJ2 Y;  1VQ4 Z;  1VQ7 Z;  3G6E Z;  3OW2 Z;  3CCQ 1;  1M1K 1;  1YHQ Z;  3OW2 Y;  1YIJ Z;  3CMA Z;  2QA4 Z;  3CCL 1;  1M90 2;  1KC8 2;  3CCJ Z;  3I56 Z;  3CXC Z;  1M90 1;  1VQL Z;  3CXC Y;  2QEX Z;  1K73 2;  1NJI 1;  1YI2 1;  2OTL 1;  1YJN Z;  1K73 1;  3CCV 1;  1QVF Y;  1VQ5 Z;  1K9M 1;  1W2B Z;  3CCM 1;  1VQ9 1;  3I55 Z;  1VQN 1;  3CCS 1;  1M1K 2;  3CC2 1;  1Q82 2;  1KQS Z;  1Q81 2;  1VQ8 1;  3CCE Z;  1KQS Y;  1Q82 1;  1Q81 1;  3CD6 1;  1KD1 1;  1NJI 2;  1YIT 1;  2OTL Z;  1K8A 1;  1VQO 1;  1VQM 1;  3CCV Z;  3CCU 1;  1YJ9 1;  1K9M 2;  1VQ6 1;  3CCM Z;  2OTJ 1;  3G71 1;  1VQ9 Z;  1QVG Z;  1VQN Z;  3CC2 Z;  3CCR 1;  1QVG Y;  3G4S 1;  3CME 1;  3CCQ Z;  1W2B Y;  3CC7 1;  1Q7Y 2;  3CCL Z;  1S72 1;  1VQP 1;  1VQK 1;  3CMA 1;  1Q7Y 1;  1KD1 2;  1YIT Z;  3I56 1;  1K8A 2;  1VQO Z;  1YI2 Z;  1VQM Z;  1N8R 1;  3CC4 1;  1YJN 1;  1Q86 1;  2OTJ Z;  3G71 Z;  1YJW 1;  1VQ5 1;  3CCR Z;  3G4S Z;  3CME Z;  3CCS Z;  3CC7 Z;  1VQ4 1;  1VQ7 1;  3I55 1;  3G6E 1;  1VQ8 Z;  1S72 Z;  1VQP Z;  1VQK Z;  1YHQ 1;  3CCE 1;  1YIJ 1;  3CD6 Z;  3CPW Z;  2QA4 1;  1KC8 1;  3CCJ 1;  3CPW Y; 
#chains in the Genus database with same CATH topology
 3VB9 A;  2OOY B;  2JMO A;  3FKI I;  3PO2 I;  1SIW A;  3CCU Z;  3M3Y I;  1Q86 2;  4NBA A;  3NH4 A;  1LQL A;  4QTT A;  1JJ2 Z;  2KI7 B;  1YJW Z;  2IZ3 A;  1JJ2 Y;  2R93 I;  2V8I A;  5D1O A;  3G6E Z;  3OW2 Z;  1M1K 1;  3TE5 B;  1YHQ Z;  4A3F I;  3OW2 Y;  1YIJ Z;  4A3G I;  3CMA Z;  2QA4 Z;  4BXX I;  1NP6 A;  5A2Q f;  4E30 A;  4A3K I;  1NUI A;  2W03 A;  1K73 2;  1TWH I;  1YJN Z;  1WZN A;  3KIH A;  4MH4 A;  4RVH A;  3CCV 1;  2DE7 A;  1QVF Y;  1I50 I;  1RQF A;  1W2B Z;  1VQ9 1;  2HU9 A;  1KQS Z;  1Q81 2;  2JA7 I;  2F4O A;  1KQS Y;  4RV9 A;  2LFU A;  3S2H I;  1TWF I;  1KD1 1;  3GTG I;  1NJI 2;  1P9N A;  3HKZ A;  2OTL Z;  4A3C I;  2M6N A;  1ML8 A;  1DL6 A;  3EER A;  4NB9 A;  1Z02 A;  3S15 I;  3G71 1;  5AN9 F;  2RT9 A;  1RLY A;  3HOY I;  3D9X A;  3CME 1;  3CCQ Z;  4X6A I;  2K5R A;  1Q7Y 2;  3CCL Z;  1S72 1;  2JIO A;  2V8K A;  2QRE B;  2VPY A;  3S14 I;  3GTM S;  2I3C A;  1YI2 Z;  1N8R 1;  2PK7 A;  4MD9 A;  1Q16 A;  4NBC A;  3G4S Z;  3IR7 A;  1VQ4 1;  2YU9 I;  3I55 1;  1VQ8 Z;  1VQP Z;  3GTO I;  3VMH A;  3CCE 1;  3CD6 Z;  3CPW Z;  3GCF A;  1KC8 1;  3CPW Y;  5T64 A;  1Y1V I;  4RVF A;  3D6W A;  1VQL 1;  2QEX 1;  1YJ9 Z;  2O4H A;  2VPW A;  1VLA A;  3IX0 A;  3HOX I;  4A3B I;  2LIY A;  1VQ7 Z;  1X3W A;  4DGL A;  4MD7 A;  2ZAE B;  4MRI A;  3F3F C;  2OOX B;  2NAP A;  4NBE A;  1RO4 A;  1X3Z A;  3I56 Z;  3S1M I;  5CM2 M;  1M90 1;  2GTI A;  2JIQ A;  4Y52 I;  2JS4 A;  2NVQ I;  4DQY B;  3I4N I;  3NH5 A;  2EGT A;  1QF8 A;  1VQ5 Z;  3IF8 A;  3PO3 S;  2VPX A;  3TDH B;  4E33 A;  4NH1 C;  4HH4 A;  3J7A 4;  3P5J B;  1L1O C;  1Q82 1;  3JAM b;  2H85 A;  1WW9 A;  1ZB9 A;  1TFI A;  4MON A;  3NDI A;  5LL6 f;  1YIT 1;  2R6M A;  1K8A 1;  1VQO 1;  1VQM 1;  3CCV Z;  3CCU 1;  2E9H A;  1K9M 2;  2JUB A;  1USP B;  2OTJ 1;  1VQ9 Z;  1RO0 A;  2GTH A;  3CCR 1;  1W2B Y;  1QXF A;  3CMA 1;  2V45 A;  1I6H I;  1KRL A;  2K3R A;  3J80 f;  1PFT A;  4E2Z A;  3ESW A;  3JAM f;  4BBS I;  4E31 A;  2VUM I;  3KIF A;  3CC4 1;  1YJN 1;  2B63 I;  1Q86 1;  3G71 Z;  4A3M I;  2JR6 A;  4EWC A;  3CME Z;  4A3I I;  3MZL B;  3CCS Z;  3MON A;  3FQM A;  2E2J I;  3F3P C;  4S1T A;  1S72 Z;  3GTM I;  2NVT I;  2QR1 B;  2OZK A;  1USP A;  2G2K A;  3I07 A;  2PM9 A;  1WCM I;  2W04 A;  2LEX A;  3IFU A;  3QWU A;  2V3V A;  3CCJ 1;  1JWH C;  2Y0S A;  3NH8 A;  3NFZ A;  4QTU A;  1X0T A;  4E2Y A;  5IP7 I;  1VQ6 Z;  1ZH1 A;  2IV2 X;  1VQ4 Z;  3GTJ I;  2AKL A;  4CL1 A;  2PMZ A;  3MZK B;  2E2H I;  3CCQ 1;  4RVG A;  3S1Q I;  2IZ4 A;  3CCL 1;  1M90 2;  4Y7N I;  3I4M I;  2JA5 I;  1VQL Z;  2QEX Z;  1NJI 1;  1YI2 1;  2V8J A;  2F4M A;  2YAD A;  4NOZ A;  2P3Y A;  2J6A A;  3CCM 1;  5T67 A;  1VQN 1;  3GTP I;  1Z01 A;  2HF1 A;  1M1K 2;  3FQQ A;  3CC2 1;  1Q82 2;  4MD8 A;  1VQ8 1;  2M48 A;  4MXU A;  2QRC B;  4HGY A;  2JA6 I;  3CD6 1;  5FLX b;  5D1O B;  1YUK A;  3PO3 I;  1YJ9 1;  2RHB A;  3Q87 A;  3VMG A;  3S1N I;  2QRD B;  1K83 I;  3GTL I;  1FDI A;  3K7A I;  5C3E I;  4E2X A;  4A3D I;  2VF1 A;  1S7M A;  3GTQ I;  3CC7 1;  1VQK 1;  1TWA I;  1KD1 2;  3J80 b;  3S1R I;  1YIT Z;  3GKQ A;  3I56 1;  4A3J I;  1VQO Z;  1VQM Z;  1WJ2 A;  5FLX f;  4A3E I;  5T6B A;  2WAQ A;  2OTJ Z;  4DK1 A;  5IT9 b;  1YJW 1;  1VQ5 1;  3CCR Z;  1N2F A;  2GU2 A;  2R92 I;  3G6E 1;  2KPI A;  1YHQ 1;  1TWC I;  4TNU A;  1YIJ 1;  2QA4 1;  4AYB A;  4NBB A;  3CC4 Z;  4NBH A;  1N8R 2;  3NDJ A;  4E2W A;  3H0G I;  5C4J I;  1QVF Z;  4A93 I;  4BY7 I;  5C4X I;  1Y1W I;  4XX2 A;  1ZB8 A;  2DE6 A;  2E2I I;  4NFR A;  2E7Z A;  3D2L A;  3VMI A;  3S17 I;  5IT9 f;  2JIR A;  2NVY I;  2JIM A;  3GTK I;  1FDO A;  2RIQ A;  1KC8 2;  1QYP A;  1RO2 A;  3CCJ Z;  2VPZ A;  3CXC Z;  1Y8C A;  4NBD A;  1R9T I;  3CXC Y;  3RZO I;  4NB8 A;  2OTL 1;  2P28 A;  1K73 1;  2NVX I;  2RBL A;  1K9M 1;  4BY1 I;  2AYD A;  3I55 Z;  1YUA A;  3U50 C;  3CCS 1;  4NBF A;  1AA6 A;  2QKD A;  3RZD I;  3CQZ I;  3CCE Z;  1RNI A;  1Q81 1;  1I3Q I;  1Z03 A;  5FLM I;  1WII A;  4E32 A;  4A3L I;  2RPR A;  3H3V J;  3BG1 B;  4NBG A;  1VQ6 1;  5IP9 I;  3CCM Z;  3M4O I;  2Q51 A;  2JNY A;  1QVG Z;  1VQN Z;  1TWG I;  5D1P A;  3CC2 Z;  1QVG Y;  3G4S 1;  3J81 b;  2BJO A;  1VQP 1;  1Q7Y 1;  2JA8 I;  3HOV I;  1K8A 2;  4HGZ A;  2R7Z I;  4BBR I;  2VUG A;  3LUS A;  5C44 I;  1SFO I;  1Y1V S;  2DE5 A;  3HOZ I;  3HOU I;  3EED A;  3HOW I;  3S16 I;  3VTN A;  3CC7 Z;  2JIP A;  1VQ7 1;  3S2D I;  1VQK Z;  5A2Q b;  3T4N B;  2QLV B;  4RS4 A;  2WB1 A;  4RVD A;  3J81 f;  2O53 A;  2Q4Z A;  3BG0 B; 
#chains in the Genus database with same CATH homology
 3VB9 A;  2OOY B;  2JMO A;  3FKI I;  3PO2 I;  3M3Y I;  3CCU Z;  1Q86 2;  4NBA A;  3NH4 A;  1LQL A;  4QTT A;  1JJ2 Z;  2KI7 B;  1YJW Z;  2IZ3 A;  1JJ2 Y;  2R93 I;  2V8I A;  5D1O A;  3G6E Z;  3OW2 Z;  1M1K 1;  3TE5 B;  1YHQ Z;  4A3F I;  3OW2 Y;  1YIJ Z;  4A3G I;  3CMA Z;  2QA4 Z;  4BXX I;  1NP6 A;  5A2Q f;  4E30 A;  4A3K I;  1NUI A;  2W03 A;  1K73 2;  1TWH I;  1YJN Z;  3KIH A;  4MH4 A;  4RVH A;  3CCV 1;  2DE7 A;  1QVF Y;  1I50 I;  1RQF A;  1W2B Z;  1VQ9 1;  2HU9 A;  1KQS Z;  1Q81 2;  2JA7 I;  2F4O A;  1KQS Y;  4RV9 A;  2LFU A;  3S2H I;  1TWF I;  1KD1 1;  3GTG I;  1NJI 2;  1P9N A;  3HKZ A;  2OTL Z;  4A3C I;  2M6N A;  1ML8 A;  1DL6 A;  3EER A;  4NB9 A;  1Z02 A;  3S15 I;  3G71 1;  5AN9 F;  2RT9 A;  1RLY A;  3HOY I;  3D9X A;  3CME 1;  3CCQ Z;  4X6A I;  2K5R A;  1Q7Y 2;  3CCL Z;  1S72 1;  2V8K A;  2QRE B;  3S14 I;  3GTM S;  2I3C A;  1YI2 Z;  1N8R 1;  2PK7 A;  4MD9 A;  4NBC A;  3G4S Z;  1VQ4 1;  2YU9 I;  3I55 1;  1VQ8 Z;  1VQP Z;  3GTO I;  3VMH A;  3CCE 1;  3CD6 Z;  3CPW Z;  3GCF A;  1KC8 1;  3CPW Y;  5T64 A;  1Y1V I;  4RVF A;  3D6W A;  1VQL 1;  2QEX 1;  1YJ9 Z;  2O4H A;  1VLA A;  3IX0 A;  3HOX I;  4A3B I;  2LIY A;  1VQ7 Z;  1X3W A;  4DGL A;  4MD7 A;  2ZAE B;  4MRI A;  3F3F C;  2OOX B;  4NBE A;  1RO4 A;  1X3Z A;  3I56 Z;  3S1M I;  5CM2 M;  1M90 1;  2GTI A;  4Y52 I;  2JS4 A;  2NVQ I;  4DQY B;  3I4N I;  3NH5 A;  2EGT A;  1QF8 A;  1VQ5 Z;  3IF8 A;  3PO3 S;  3TDH B;  4E33 A;  4NH1 C;  4HH4 A;  3J7A 4;  3P5J B;  1L1O C;  1Q82 1;  3JAM b;  2H85 A;  1WW9 A;  1ZB9 A;  1TFI A;  4MON A;  3NDI A;  5LL6 f;  1YIT 1;  2R6M A;  1K8A 1;  1VQO 1;  1VQM 1;  3CCV Z;  3CCU 1;  2E9H A;  1K9M 2;  2JUB A;  1USP B;  2OTJ 1;  1VQ9 Z;  1RO0 A;  2GTH A;  3CCR 1;  1W2B Y;  3CMA 1;  1I6H I;  1KRL A;  2K3R A;  3J80 f;  1PFT A;  4E2Z A;  3ESW A;  3JAM f;  4BBS I;  4E31 A;  2VUM I;  3KIF A;  3CC4 1;  1YJN 1;  2B63 I;  1Q86 1;  3G71 Z;  4A3M I;  2JR6 A;  4EWC A;  3CME Z;  4A3I I;  3MZL B;  3CCS Z;  3MON A;  3FQM A;  2E2J I;  3F3P C;  4S1T A;  1S72 Z;  3GTM I;  2NVT I;  2QR1 B;  2OZK A;  1USP A;  2G2K A;  3I07 A;  2PM9 A;  1WCM I;  2W04 A;  3IFU A;  3QWU A;  3CCJ 1;  1JWH C;  2Y0S A;  3NH8 A;  3NFZ A;  4QTU A;  1X0T A;  4E2Y A;  5IP7 I;  1VQ6 Z;  1ZH1 A;  1VQ4 Z;  3GTJ I;  2AKL A;  4CL1 A;  2PMZ A;  3MZK B;  2E2H I;  3CCQ 1;  4RVG A;  3S1Q I;  2IZ4 A;  3CCL 1;  1M90 2;  4Y7N I;  3I4M I;  2JA5 I;  1VQL Z;  2QEX Z;  1NJI 1;  1YI2 1;  2V8J A;  2F4M A;  2YAD A;  4NOZ A;  2P3Y A;  2J6A A;  3CCM 1;  5T67 A;  1VQN 1;  3GTP I;  1Z01 A;  2HF1 A;  1M1K 2;  3FQQ A;  3CC2 1;  1Q82 2;  4MD8 A;  1VQ8 1;  2M48 A;  4MXU A;  2QRC B;  4HGY A;  2JA6 I;  3CD6 1;  5FLX b;  5D1O B;  1YUK A;  3PO3 I;  1YJ9 1;  2RHB A;  3Q87 A;  3VMG A;  3S1N I;  2QRD B;  1K83 I;  3GTL I;  3K7A I;  5C3E I;  4E2X A;  4A3D I;  2VF1 A;  1S7M A;  3GTQ I;  3CC7 1;  1VQK 1;  1TWA I;  1KD1 2;  3J80 b;  3S1R I;  1YIT Z;  3GKQ A;  3I56 1;  4A3J I;  1VQO Z;  1VQM Z;  5FLX f;  4A3E I;  5T6B A;  2WAQ A;  2OTJ Z;  4DK1 A;  5IT9 b;  1YJW 1;  1VQ5 1;  3CCR Z;  1N2F A;  2GU2 A;  2R92 I;  3G6E 1;  2KPI A;  1YHQ 1;  1TWC I;  4TNU A;  1YIJ 1;  2QA4 1;  4AYB A;  4NBB A;  3CC4 Z;  4NBH A;  1N8R 2;  3NDJ A;  4E2W A;  3H0G I;  5C4J I;  1QVF Z;  4A93 I;  4BY7 I;  5C4X I;  1Y1W I;  4XX2 A;  1ZB8 A;  2DE6 A;  2E2I I;  4NFR A;  3VMI A;  3S17 I;  5IT9 f;  2NVY I;  3GTK I;  2RIQ A;  1KC8 2;  1QYP A;  1RO2 A;  3CCJ Z;  3CXC Z;  4NBD A;  1R9T I;  3CXC Y;  3RZO I;  4NB8 A;  2OTL 1;  2P28 A;  1K73 1;  2NVX I;  2RBL A;  1K9M 1;  4BY1 I;  3I55 Z;  1YUA A;  3U50 C;  3CCS 1;  4NBF A;  2QKD A;  3RZD I;  3CQZ I;  3CCE Z;  1RNI A;  1Q81 1;  1I3Q I;  1Z03 A;  5FLM I;  1WII A;  4E32 A;  4A3L I;  2RPR A;  3H3V J;  3BG1 B;  4NBG A;  1VQ6 1;  5IP9 I;  3CCM Z;  3M4O I;  2Q51 A;  2JNY A;  1QVG Z;  1VQN Z;  1TWG I;  5D1P A;  3CC2 Z;  1QVG Y;  3G4S 1;  3J81 b;  2BJO A;  1VQP 1;  1Q7Y 1;  2JA8 I;  3HOV I;  1K8A 2;  4HGZ A;  2R7Z I;  4BBR I;  2VUG A;  3LUS A;  5C44 I;  1SFO I;  1Y1V S;  2DE5 A;  3HOZ I;  3HOU I;  3EED A;  3HOW I;  3S16 I;  3VTN A;  3CC7 Z;  1VQ7 1;  3S2D I;  1VQK Z;  5A2Q b;  3T4N B;  2QLV B;  4RS4 A;  2WB1 A;  4RVD A;  3J81 f;  2O53 A;  2Q4Z A;  3BG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...