1W2BZ

Trigger factor ribosome binding domain in complex with 50s
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1w2bZ00
3I55Z 3CMEZ 3CCS1 3G4S1 1VQ51 1VQ41 1KC82 1M902 2QA41 3CCMZ 1VQ81 3CME1 1Q7Y1 1YIJZ 3CPWY 3CCM1 1YHQZ 3CCJZ 1VQNZ 3CPWZ 3CCSZ 3G4SZ 1VQ4Z 1YHQ1 3CCJ1 2OTL1 3CMAZ 1Q7Y2 1YI2Z 1NJI1 1VQ61 3CMA1 2OTJZ 1KQSY 1YJ91 1YJNZ 1K731 1K8A1 1Q821 3CC2Z 1YI21 3CCEZ 1KQSZ 1N8R1 2OTJ1 1K9M1 1Q812 1JJ2Y 1YJN1 2OTLZ 3CC4Z 1M1K1 3CCLZ 2QEXZ 3OW2Y 1VQOZ 3CC21 3CCE1 1JJ2Z 1NJI2 3OW2Z 3CC41 1VQ6Z 3CCL1 2QEX1 1VQO1 1K732 1K8A2 3CC71 1Q861 1YJ9Z 1Q822 1VQ9Z 1N8R2 1K9M2 3G6EZ 1VQKZ 1W2BY 1M1K2 1VQPZ 1VQ91 1QVFY 1VQL1 1M901 1W2BZ 3CCVZ 1QVGZ 3G6E1 3CXCY 1VQK1 1S72Z 1QVFZ 3CCR1 1VQP1 3CCQ1 3CXCZ 3CCU1 3CC7Z 3CCV1 1KD11 1S721 1YITZ 3CD61 1VQ71 1YIT1 3I551 1YJWZ 1VQLZ 3G71Z 1VQMZ 3CCRZ 1KC81 3CCQZ 1KD12 1YJW1 3CCUZ 3G711 1YIJ1 3I56Z 1VQM1 1QVGY 1Q862 1VQ5Z 3CD6Z 1VQN1 1Q811 1VQ7Z 3I561 2QA4Z 1VQ8Z
chains in the Genus database with same CATH superfamily
3I55Z 2JS4A 3IX0A 2M6NA 1VQ41 1M902 3S1MI 1VQ81 1SFOI 3CME1 1YIJZ 4NBCA 2VPWA 2K3RA 4S1TA 2E2JI 2VF1A 1P9NA 2E9HA 2V8JA 2NVXI 4A3MI 2PMZA 5IT9b 5D1OB 1YHQ1 2R6MA 3NH8A 3CCJ1 1ZH1A 2JA8I 3D6WA 1VQ61 3CMA1 2O53A 5C44I 1YJNZ 1K731 3MZKB 2NVTI 4BXXI 3J81f 1Y1VS 1Q812 3MZLB 1M1K1 1KRLA 3QWUA 3CC21 3GTPI 1DL6A 2F4MA 2JMOA 4NBAA 3CCL1 2QR1B 3HKZA 2R92I 4E2YA 2YADA 1YJ9Z 4NBFA 1Q861 4Y52I 1VQ9Z 4AYBA 3KIFA 1VQKZ 1TFIA 1VQPZ 2DE6A 3GCFA 4A3II 3G6E1 1S72Z 3CCR1 2QKDA 3CC7Z 3CCV1 2Q4ZA 4A3CI 3F3FC 2W03A 2QLVB 2JIOA 3PO2I 1VQ71 1S7MA 3T4NB 4NOZA 1YJWZ 4MRIA 3H0GI 4DQYB 1TWHI 4DGLA 1Z03A 1KC81 3M4OI 3CCUZ 3G711 2BJOA 3HOVI 4NBGA 1N2FA 1QVGY 3CD6Z 1I6HI 1VQN1 3NFZA 3S1NI 1VQ8Z 1QVGZ 4MD8A 3CMEZ 3TE5B 5D1PA 1QYPA 1Q7Y1 4BY1I 2RBLA 1Y1VI 5AN9F 4E2WA 3CPWY 2JR6A 3CCM1 3K7AI 5T6BA 1YHQZ 3CCJZ 4A3LI 5D1OA 3CPWZ 3J80b 3IF8A 2R93I 3CCSZ 3G4SZ 2VPZA 2OTL1 1I3QI 2EGTA 3FQMA 3CMAZ 2DE7A 4EWCA 1ZB9A 1LQLA 4A3KI 4QTUA 4RVHA 2F4OA 1NJI1 3IFUA 3S14I 1VLAA 3P5JB 4A3GI 2QRCB 1KQSY 3CQZI 1Q821 3CC2Z 3NDJA 1KQSZ 2OTJ1 2DE5A 1K9M1 2R7ZI 3CCLZ 1Q16A 1SIWA 3VTNA 3CCE1 2LFUA 5T67A 2LIYA 4NBDA 3GTOI 3CC41 4XX2A 3PO3I 2QEX1 1K732 1ZB8A 3KIHA 2E2II 4E2ZA 2P28A 3S2DI 1NUIA 3JAMf 3F3PC 3G6EZ 4NB8A 1M1K2 2P3YA 2JA6I 2V45A 1RNIA 1M901 3CCVZ 3S1RI 4RV9A 2O4HA 1K83I 4NBHA 2IV2X 1KD11 1RO4A 4E2XA 1Y1WI 3J80f 2HF1A 4TNUA 5FLMI 4RS4A 2V3VA 1TWFI 1YIT1 4MD9A 3D2LA 3I551 1VQLZ 1WJ2A 3G71Z 5A2Qb 3CCQZ 3S1QI 1YIJ1 3GTMI 1FDOA 1X3WA 1VQM1 3Q87A 3GTLI 3BG0B 2VPYA 1Q811 1TWAI 2K5RA 3I561 2NVYI 2RHBA 1RLYA 3GTJI 1I50I 5IT9f 4MD7A 1VQ51 3VMIA 1KC82 2JA7I 2I3CA 2QA41 3S16I 3CCMZ 2IZ4A 3HOUI 4RVFA 2H85A 2JIPA 1X0TA 1RO2A 5LL6f 2YU9I 4E31A 2OZKA 3FQQA 3I07A 1VQ4Z 1Q7Y2 3S15I 2E7ZA 3HOXI 3VMGA 2OTJZ 1YJ91 1K8A1 2OOYB 3U50C 3NDIA 1YI21 3CCEZ 1L1OC 1N8R1 5A2Qf 4NB9A 3I4MI 3I4NI 2PM9A 3EERA 3CC4Z 2GU2A 2QEXZ 3OW2Y 1NJI2 3J7A4 2VUMI 1WZNA 5IP7I 3OW2Z 1VQ6Z 2JNYA 1VQO1 4NBBA 3CC71 1Q822 2IZ3A 4MONA 1WW9A 4A3FI 4BBRI 1K9M2 3IR7A 1QVFY 4BY7I 3CXCY 2PK7A 1QVFZ 3CXCZ 3CCU1 2B63I 1YITZ 1FDIA 2HU9A 3CD61 1QXFA 3VB9A 2ZAEB 3H3VJ 4A3DI 4A3BI 2JA5I 1VQMZ 3ESWA 3CCRZ 2JIQA 1KD12 4A93I 4HGZA 1YUKA 4NH1C 3I56Z 3S2HI 4E30A 3RZDI 1Q862 1VQ5Z 3GTQI 3LUSA 4HH4A 1VQ7Z 2QA4Z 3MONA 4RVGA 4X6AI 3CCS1 3G4S1 2W04A 4DK1A 1USPB 2WAQA 2QREB 3M3YI 3GTKI 5IP9I 2JUBA 3NH5A 1VQNZ 4BBSI 2OOXB 4E32A 1RO0A 2Q51A 3HOZI 3RZOI 2GTIA 2AKLA 2V8KA 2NAPA 1TWCI 2KPIA 1Y8CA 2VUGA 2E2HI 2WB1A 1YI2Z 2JIRA 2M48A 5C3EI 1Z02A 4E33A 1WCMI 3D9XA 5FLXb 2VPXA 3FKII 4MXUA 4RVDA 5T64A 5C4XI 4NFRA 1QF8A 4A3JI 2QRDB 1JJ2Y 1YJN1 2Y0SA 2OTLZ 1VQOZ 2LEXA 1JJ2Z 5CM2M 3HOWI 4MH4A 1WIIA 4HGYA 1K8A2 3PO3S 3GKQA 1N8R2 2JIMA 1PFTA 3TDHB 1ML8A 1W2BY 2V8IA 1VQ91 1AA6A 1TWGI 1R9TI 1VQL1 5C4JI 1W2BZ 4QTTA 4NBEA 1VQK1 3EEDA 4Y7NI 1VQP1 2KI7B 3CCQ1 3GTGI 2RPRA 4A3EI 1S721 3NH4A 3JAMb 3HOYI 4CL1A 2RT9A 3S17I 3J81b 2AYDA 2NVQI 1JWHC 2J6AA 2RIQA 3BG1B 3VMHA 1RQFA 1X3ZA 1YJW1 1NP6A 5FLXf 1Z01A 3GTMS 2G2KA 1YUAA 2GTHA 1USPA
chains in the Genus database with same CATH topology
3I55Z 2JS4A 3IX0A 2M6NA 1VQ41 1M902 3S1MI 1VQ81 1SFOI 3CME1 1YIJZ 4NBCA 2K3RA 4S1TA 2E2JI 2VF1A 1P9NA 2E9HA 2V8JA 2NVXI 4A3MI 2PMZA 5IT9b 5D1OB 1YHQ1 2R6MA 3NH8A 3CCJ1 1ZH1A 2JA8I 3D6WA 1VQ61 3CMA1 2O53A 5C44I 1YJNZ 1K731 3MZKB 2NVTI 4BXXI 3J81f 1Y1VS 1Q812 3MZLB 1M1K1 1KRLA 3QWUA 3CC21 3GTPI 1DL6A 2F4MA 2JMOA 4NBAA 3CCL1 2QR1B 3HKZA 2R92I 4E2YA 2YADA 1YJ9Z 4NBFA 1Q861 4Y52I 1VQ9Z 4AYBA 3KIFA 1VQKZ 1TFIA 1VQPZ 2DE6A 3GCFA 4A3II 3G6E1 1S72Z 3CCR1 2QKDA 3CC7Z 3CCV1 2Q4ZA 4A3CI 3F3FC 2W03A 2QLVB 3PO2I 1VQ71 1S7MA 3T4NB 4NOZA 1YJWZ 4MRIA 3H0GI 4DQYB 1TWHI 4DGLA 1Z03A 1KC81 3M4OI 3CCUZ 3G711 2BJOA 3HOVI 4NBGA 1N2FA 1QVGY 3CD6Z 1I6HI 1VQN1 3NFZA 3S1NI 1VQ8Z 1QVGZ 4MD8A 3CMEZ 3TE5B 5D1PA 1QYPA 1Q7Y1 4BY1I 2RBLA 1Y1VI 5AN9F 4E2WA 3CPWY 2JR6A 3CCM1 3K7AI 5T6BA 1YHQZ 3CCJZ 4A3LI 5D1OA 3CPWZ 3J80b 3IF8A 2R93I 3CCSZ 3G4SZ 2OTL1 1I3QI 2EGTA 3FQMA 3CMAZ 2DE7A 4EWCA 1ZB9A 1LQLA 4A3KI 4QTUA 4RVHA 2F4OA 1NJI1 3IFUA 3S14I 1VLAA 3P5JB 4A3GI 2QRCB 1KQSY 3CQZI 1Q821 3CC2Z 3NDJA 1KQSZ 2OTJ1 2DE5A 1K9M1 2R7ZI 3CCLZ 3VTNA 3CCE1 2LFUA 5T67A 2LIYA 4NBDA 3GTOI 3CC41 4XX2A 3PO3I 2QEX1 1K732 1ZB8A 3KIHA 2E2II 4E2ZA 2P28A 3S2DI 1NUIA 3JAMf 3F3PC 3G6EZ 4NB8A 1M1K2 2P3YA 2JA6I 1RNIA 1M901 3CCVZ 3S1RI 4RV9A 2O4HA 1K83I 4NBHA 1KD11 1RO4A 4E2XA 1Y1WI 3J80f 2HF1A 4TNUA 5FLMI 4RS4A 1TWFI 1YIT1 4MD9A 3I551 1VQLZ 3G71Z 5A2Qb 3CCQZ 3S1QI 1YIJ1 3GTMI 1X3WA 1VQM1 3Q87A 3GTLI 3BG0B 1Q811 1TWAI 2K5RA 3I561 2NVYI 2RHBA 1RLYA 3GTJI 1I50I 5IT9f 4MD7A 1VQ51 3VMIA 1KC82 2JA7I 2I3CA 2QA41 3S16I 3CCMZ 2IZ4A 3HOUI 4RVFA 2H85A 1X0TA 1RO2A 5LL6f 2YU9I 4E31A 2OZKA 3FQQA 3I07A 1VQ4Z 1Q7Y2 3S15I 3HOXI 3VMGA 2OTJZ 1YJ91 1K8A1 2OOYB 3U50C 3NDIA 1YI21 3CCEZ 1L1OC 1N8R1 5A2Qf 4NB9A 3I4MI 3I4NI 2PM9A 3EERA 3CC4Z 2GU2A 2QEXZ 3OW2Y 1NJI2 3J7A4 2VUMI 3OW2Z 5IP7I 1VQ6Z 2JNYA 1VQO1 4NBBA 3CC71 1Q822 2IZ3A 4MONA 1WW9A 4A3FI 4BBRI 1K9M2 1QVFY 4BY7I 3CXCY 2PK7A 1QVFZ 3CXCZ 3CCU1 2B63I 1YITZ 2HU9A 3CD61 3VB9A 2ZAEB 3H3VJ 4A3DI 4A3BI 2JA5I 1VQMZ 3ESWA 3CCRZ 1KD12 4A93I 4HGZA 1YUKA 4NH1C 3I56Z 3S2HI 4E30A 3RZDI 1Q862 1VQ5Z 3GTQI 3LUSA 4HH4A 1VQ7Z 2QA4Z 3MONA 4RVGA 4X6AI 3CCS1 3G4S1 2W04A 4DK1A 1USPB 2WAQA 2QREB 3M3YI 3GTKI 5IP9I 2JUBA 3NH5A 1VQNZ 4BBSI 2OOXB 4E32A 1RO0A 2Q51A 3HOZI 3RZOI 2GTIA 2AKLA 2V8KA 1TWCI 2KPIA 2VUGA 2E2HI 2WB1A 1YI2Z 2M48A 5C3EI 1Z02A 4E33A 1WCMI 3D9XA 5FLXb 3FKII 4MXUA 4RVDA 5T64A 5C4XI 4NFRA 1QF8A 4A3JI 2QRDB 1JJ2Y 1YJN1 2Y0SA 2OTLZ 1VQOZ 1JJ2Z 5CM2M 3HOWI 4MH4A 1WIIA 4HGYA 1K8A2 3PO3S 3GKQA 1N8R2 1PFTA 3TDHB 1ML8A 1W2BY 2V8IA 1VQ91 1TWGI 1R9TI 1VQL1 5C4JI 1W2BZ 4QTTA 4NBEA 1VQK1 3EEDA 4Y7NI 1VQP1 2KI7B 3CCQ1 3GTGI 2RPRA 4A3EI 1S721 3NH4A 3JAMb 3HOYI 4CL1A 2RT9A 3S17I 3J81b 2NVQI 1JWHC 2J6AA 2RIQA 3BG1B 3VMHA 1RQFA 1X3ZA 1YJW1 1NP6A 5FLXf 1Z01A 3GTMS 2G2KA 1YUAA 2GTHA 1USPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Z;  3CME Z;  3CCS 1;  3G4S 1;  1VQ5 1;  1VQ4 1;  1KC8 2;  1M90 2;  2QA4 1;  3CCM Z;  1VQ8 1;  3CME 1;  1Q7Y 1;  1YIJ Z;  3CPW Y;  3CCM 1;  1YHQ Z;  3CCJ Z;  1VQN Z;  3CPW Z;  3CCS Z;  3G4S Z;  1VQ4 Z;  1YHQ 1;  3CCJ 1;  2OTL 1;  3CMA Z;  1Q7Y 2;  1YI2 Z;  1NJI 1;  1VQ6 1;  3CMA 1;  2OTJ Z;  1KQS Y;  1YJ9 1;  1YJN Z;  1K73 1;  1K8A 1;  1Q82 1;  3CC2 Z;  1YI2 1;  3CCE Z;  1KQS Z;  1N8R 1;  2OTJ 1;  1K9M 1;  1Q81 2;  1JJ2 Y;  1YJN 1;  2OTL Z;  3CC4 Z;  1M1K 1;  3CCL Z;  2QEX Z;  3OW2 Y;  1VQO Z;  3CC2 1;  3CCE 1;  1JJ2 Z;  1NJI 2;  3OW2 Z;  3CC4 1;  1VQ6 Z;  3CCL 1;  2QEX 1;  1VQO 1;  1K73 2;  1K8A 2;  3CC7 1;  1Q86 1;  1YJ9 Z;  1Q82 2;  1VQ9 Z;  1N8R 2;  1K9M 2;  3G6E Z;  1VQK Z;  1W2B Y;  1M1K 2;  1VQP Z;  1VQ9 1;  1QVF Y;  1VQL 1;  1M90 1;  1W2B Z;  3CCV Z;  1QVG Z;  3G6E 1;  3CXC Y;  1VQK 1;  1S72 Z;  1QVF Z;  3CCR 1;  1VQP 1;  3CCQ 1;  3CXC Z;  3CCU 1;  3CC7 Z;  3CCV 1;  1KD1 1;  1S72 1;  1YIT Z;  3CD6 1;  1VQ7 1;  1YIT 1;  3I55 1;  1YJW Z;  1VQL Z;  3G71 Z;  1VQM Z;  3CCR Z;  1KC8 1;  3CCQ Z;  1KD1 2;  1YJW 1;  3CCU Z;  3G71 1;  1YIJ 1;  3I56 Z;  1VQM 1;  1QVG Y;  1Q86 2;  1VQ5 Z;  3CD6 Z;  1VQN 1;  1Q81 1;  1VQ7 Z;  3I56 1;  2QA4 Z;  1VQ8 Z; 
#chains in the Genus database with same CATH topology
 3I55 Z;  2JS4 A;  3IX0 A;  2M6N A;  1VQ4 1;  1M90 2;  3S1M I;  1VQ8 1;  1SFO I;  3CME 1;  1YIJ Z;  4NBC A;  2VPW A;  2K3R A;  4S1T A;  2E2J I;  2VF1 A;  1P9N A;  2E9H A;  2V8J A;  2NVX I;  4A3M I;  2PMZ A;  5IT9 b;  5D1O B;  1YHQ 1;  2R6M A;  3NH8 A;  3CCJ 1;  1ZH1 A;  2JA8 I;  3D6W A;  1VQ6 1;  3CMA 1;  2O53 A;  5C44 I;  1YJN Z;  1K73 1;  3MZK B;  2NVT I;  4BXX I;  3J81 f;  1Y1V S;  1Q81 2;  3MZL B;  1M1K 1;  1KRL A;  3QWU A;  3CC2 1;  3GTP I;  1DL6 A;  2F4M A;  2JMO A;  4NBA A;  3CCL 1;  2QR1 B;  3HKZ A;  2R92 I;  4E2Y A;  2YAD A;  1YJ9 Z;  4NBF A;  1Q86 1;  4Y52 I;  1VQ9 Z;  4AYB A;  3KIF A;  1VQK Z;  1TFI A;  1VQP Z;  2DE6 A;  3GCF A;  4A3I I;  3G6E 1;  1S72 Z;  3CCR 1;  2QKD A;  3CC7 Z;  3CCV 1;  2Q4Z A;  4A3C I;  3F3F C;  2W03 A;  2QLV B;  2JIO A;  3PO2 I;  1VQ7 1;  1S7M A;  3T4N B;  4NOZ A;  1YJW Z;  4MRI A;  3H0G I;  4DQY B;  1TWH I;  4DGL A;  1Z03 A;  1KC8 1;  3M4O I;  3CCU Z;  3G71 1;  2BJO A;  3HOV I;  4NBG A;  1N2F A;  1QVG Y;  3CD6 Z;  1I6H I;  1VQN 1;  3NFZ A;  3S1N I;  1VQ8 Z;  1QVG Z;  4MD8 A;  3CME Z;  3TE5 B;  5D1P A;  1QYP A;  1Q7Y 1;  4BY1 I;  2RBL A;  1Y1V I;  5AN9 F;  4E2W A;  3CPW Y;  2JR6 A;  3CCM 1;  3K7A I;  5T6B A;  1YHQ Z;  3CCJ Z;  4A3L I;  5D1O A;  3CPW Z;  3J80 b;  3IF8 A;  2R93 I;  3CCS Z;  3G4S Z;  2VPZ A;  2OTL 1;  1I3Q I;  2EGT A;  3FQM A;  3CMA Z;  2DE7 A;  4EWC A;  1ZB9 A;  1LQL A;  4A3K I;  4QTU A;  4RVH A;  2F4O A;  1NJI 1;  3IFU A;  3S14 I;  1VLA A;  3P5J B;  4A3G I;  2QRC B;  1KQS Y;  3CQZ I;  1Q82 1;  3CC2 Z;  3NDJ A;  1KQS Z;  2OTJ 1;  2DE5 A;  1K9M 1;  2R7Z I;  3CCL Z;  1Q16 A;  1SIW A;  3VTN A;  3CCE 1;  2LFU A;  5T67 A;  2LIY A;  4NBD A;  3GTO I;  3CC4 1;  4XX2 A;  3PO3 I;  2QEX 1;  1K73 2;  1ZB8 A;  3KIH A;  2E2I I;  4E2Z A;  2P28 A;  3S2D I;  1NUI A;  3JAM f;  3F3P C;  3G6E Z;  4NB8 A;  1M1K 2;  2P3Y A;  2JA6 I;  2V45 A;  1RNI A;  1M90 1;  3CCV Z;  3S1R I;  4RV9 A;  2O4H A;  1K83 I;  4NBH A;  2IV2 X;  1KD1 1;  1RO4 A;  4E2X A;  1Y1W I;  3J80 f;  2HF1 A;  4TNU A;  5FLM I;  4RS4 A;  2V3V A;  1TWF I;  1YIT 1;  4MD9 A;  3D2L A;  3I55 1;  1VQL Z;  1WJ2 A;  3G71 Z;  5A2Q b;  3CCQ Z;  3S1Q I;  1YIJ 1;  3GTM I;  1FDO A;  1X3W A;  1VQM 1;  3Q87 A;  3GTL I;  3BG0 B;  2VPY A;  1Q81 1;  1TWA I;  2K5R A;  3I56 1;  2NVY I;  2RHB A;  1RLY A;  3GTJ I;  1I50 I;  5IT9 f;  4MD7 A;  1VQ5 1;  3VMI A;  1KC8 2;  2JA7 I;  2I3C A;  2QA4 1;  3S16 I;  3CCM Z;  2IZ4 A;  3HOU I;  4RVF A;  2H85 A;  2JIP A;  1X0T A;  1RO2 A;  5LL6 f;  2YU9 I;  4E31 A;  2OZK A;  3FQQ A;  3I07 A;  1VQ4 Z;  1Q7Y 2;  3S15 I;  2E7Z A;  3HOX I;  3VMG A;  2OTJ Z;  1YJ9 1;  1K8A 1;  2OOY B;  3U50 C;  3NDI A;  1YI2 1;  3CCE Z;  1L1O C;  1N8R 1;  5A2Q f;  4NB9 A;  3I4M I;  3I4N I;  2PM9 A;  3EER A;  3CC4 Z;  2GU2 A;  2QEX Z;  3OW2 Y;  1NJI 2;  3J7A 4;  2VUM I;  1WZN A;  5IP7 I;  3OW2 Z;  1VQ6 Z;  2JNY A;  1VQO 1;  4NBB A;  3CC7 1;  1Q82 2;  2IZ3 A;  4MON A;  1WW9 A;  4A3F I;  4BBR I;  1K9M 2;  3IR7 A;  1QVF Y;  4BY7 I;  3CXC Y;  2PK7 A;  1QVF Z;  3CXC Z;  3CCU 1;  2B63 I;  1YIT Z;  1FDI A;  2HU9 A;  3CD6 1;  1QXF A;  3VB9 A;  2ZAE B;  3H3V J;  4A3D I;  4A3B I;  2JA5 I;  1VQM Z;  3ESW A;  3CCR Z;  2JIQ A;  1KD1 2;  4A93 I;  4HGZ A;  1YUK A;  4NH1 C;  3I56 Z;  3S2H I;  4E30 A;  3RZD I;  1Q86 2;  1VQ5 Z;  3GTQ I;  3LUS A;  4HH4 A;  1VQ7 Z;  2QA4 Z;  3MON A;  4RVG A;  4X6A I;  3CCS 1;  3G4S 1;  2W04 A;  4DK1 A;  1USP B;  2WAQ A;  2QRE B;  3M3Y I;  3GTK I;  5IP9 I;  2JUB A;  3NH5 A;  1VQN Z;  4BBS I;  2OOX B;  4E32 A;  1RO0 A;  2Q51 A;  3HOZ I;  3RZO I;  2GTI A;  2AKL A;  2V8K A;  2NAP A;  1TWC I;  2KPI A;  1Y8C A;  2VUG A;  2E2H I;  2WB1 A;  1YI2 Z;  2JIR A;  2M48 A;  5C3E I;  1Z02 A;  4E33 A;  1WCM I;  3D9X A;  5FLX b;  2VPX A;  3FKI I;  4MXU A;  4RVD A;  5T64 A;  5C4X I;  4NFR A;  1QF8 A;  4A3J I;  2QRD B;  1JJ2 Y;  1YJN 1;  2Y0S A;  2OTL Z;  1VQO Z;  2LEX A;  1JJ2 Z;  5CM2 M;  3HOW I;  4MH4 A;  1WII A;  4HGY A;  1K8A 2;  3PO3 S;  3GKQ A;  1N8R 2;  2JIM A;  1PFT A;  3TDH B;  1ML8 A;  1W2B Y;  2V8I A;  1VQ9 1;  1AA6 A;  1TWG I;  1R9T I;  1VQL 1;  5C4J I;  1W2B Z;  4QTT A;  4NBE A;  1VQK 1;  3EED A;  4Y7N I;  1VQP 1;  2KI7 B;  3CCQ 1;  3GTG I;  2RPR A;  4A3E I;  1S72 1;  3NH4 A;  3JAM b;  3HOY I;  4CL1 A;  2RT9 A;  3S17 I;  3J81 b;  2AYD A;  2NVQ I;  1JWH C;  2J6A A;  2RIQ A;  3BG1 B;  3VMH A;  1RQF A;  1X3Z A;  1YJW 1;  1NP6 A;  5FLX f;  1Z01 A;  3GTM S;  2G2K A;  1YUA A;  2GTH A;  1USP A; 
#chains in the Genus database with same CATH homology
 3I55 Z;  2JS4 A;  3IX0 A;  2M6N A;  1VQ4 1;  1M90 2;  3S1M I;  1VQ8 1;  1SFO I;  3CME 1;  1YIJ Z;  4NBC A;  2K3R A;  4S1T A;  2E2J I;  2VF1 A;  1P9N A;  2E9H A;  2V8J A;  2NVX I;  4A3M I;  2PMZ A;  5IT9 b;  5D1O B;  1YHQ 1;  2R6M A;  3NH8 A;  3CCJ 1;  1ZH1 A;  2JA8 I;  3D6W A;  1VQ6 1;  3CMA 1;  2O53 A;  5C44 I;  1YJN Z;  1K73 1;  3MZK B;  2NVT I;  4BXX I;  3J81 f;  1Y1V S;  1Q81 2;  3MZL B;  1M1K 1;  1KRL A;  3QWU A;  3CC2 1;  3GTP I;  1DL6 A;  2F4M A;  2JMO A;  4NBA A;  3CCL 1;  2QR1 B;  3HKZ A;  2R92 I;  4E2Y A;  2YAD A;  1YJ9 Z;  4NBF A;  1Q86 1;  4Y52 I;  1VQ9 Z;  4AYB A;  3KIF A;  1VQK Z;  1TFI A;  1VQP Z;  2DE6 A;  3GCF A;  4A3I I;  3G6E 1;  1S72 Z;  3CCR 1;  2QKD A;  3CC7 Z;  3CCV 1;  2Q4Z A;  4A3C I;  3F3F C;  2W03 A;  2QLV B;  3PO2 I;  1VQ7 1;  1S7M A;  3T4N B;  4NOZ A;  1YJW Z;  4MRI A;  3H0G I;  4DQY B;  1TWH I;  4DGL A;  1Z03 A;  1KC8 1;  3M4O I;  3CCU Z;  3G71 1;  2BJO A;  3HOV I;  4NBG A;  1N2F A;  1QVG Y;  3CD6 Z;  1I6H I;  1VQN 1;  3NFZ A;  3S1N I;  1VQ8 Z;  1QVG Z;  4MD8 A;  3CME Z;  3TE5 B;  5D1P A;  1QYP A;  1Q7Y 1;  4BY1 I;  2RBL A;  1Y1V I;  5AN9 F;  4E2W A;  3CPW Y;  2JR6 A;  3CCM 1;  3K7A I;  5T6B A;  1YHQ Z;  3CCJ Z;  4A3L I;  5D1O A;  3CPW Z;  3J80 b;  3IF8 A;  2R93 I;  3CCS Z;  3G4S Z;  2OTL 1;  1I3Q I;  2EGT A;  3FQM A;  3CMA Z;  2DE7 A;  4EWC A;  1ZB9 A;  1LQL A;  4A3K I;  4QTU A;  4RVH A;  2F4O A;  1NJI 1;  3IFU A;  3S14 I;  1VLA A;  3P5J B;  4A3G I;  2QRC B;  1KQS Y;  3CQZ I;  1Q82 1;  3CC2 Z;  3NDJ A;  1KQS Z;  2OTJ 1;  2DE5 A;  1K9M 1;  2R7Z I;  3CCL Z;  3VTN A;  3CCE 1;  2LFU A;  5T67 A;  2LIY A;  4NBD A;  3GTO I;  3CC4 1;  4XX2 A;  3PO3 I;  2QEX 1;  1K73 2;  1ZB8 A;  3KIH A;  2E2I I;  4E2Z A;  2P28 A;  3S2D I;  1NUI A;  3JAM f;  3F3P C;  3G6E Z;  4NB8 A;  1M1K 2;  2P3Y A;  2JA6 I;  1RNI A;  1M90 1;  3CCV Z;  3S1R I;  4RV9 A;  2O4H A;  1K83 I;  4NBH A;  1KD1 1;  1RO4 A;  4E2X A;  1Y1W I;  3J80 f;  2HF1 A;  4TNU A;  5FLM I;  4RS4 A;  1TWF I;  1YIT 1;  4MD9 A;  3I55 1;  1VQL Z;  3G71 Z;  5A2Q b;  3CCQ Z;  3S1Q I;  1YIJ 1;  3GTM I;  1X3W A;  1VQM 1;  3Q87 A;  3GTL I;  3BG0 B;  1Q81 1;  1TWA I;  2K5R A;  3I56 1;  2NVY I;  2RHB A;  1RLY A;  3GTJ I;  1I50 I;  5IT9 f;  4MD7 A;  1VQ5 1;  3VMI A;  1KC8 2;  2JA7 I;  2I3C A;  2QA4 1;  3S16 I;  3CCM Z;  2IZ4 A;  3HOU I;  4RVF A;  2H85 A;  1X0T A;  1RO2 A;  5LL6 f;  2YU9 I;  4E31 A;  2OZK A;  3FQQ A;  3I07 A;  1VQ4 Z;  1Q7Y 2;  3S15 I;  3HOX I;  3VMG A;  2OTJ Z;  1YJ9 1;  1K8A 1;  2OOY B;  3U50 C;  3NDI A;  1YI2 1;  3CCE Z;  1L1O C;  1N8R 1;  5A2Q f;  4NB9 A;  3I4M I;  3I4N I;  2PM9 A;  3EER A;  3CC4 Z;  2GU2 A;  2QEX Z;  3OW2 Y;  1NJI 2;  3J7A 4;  2VUM I;  3OW2 Z;  5IP7 I;  1VQ6 Z;  2JNY A;  1VQO 1;  4NBB A;  3CC7 1;  1Q82 2;  2IZ3 A;  4MON A;  1WW9 A;  4A3F I;  4BBR I;  1K9M 2;  1QVF Y;  4BY7 I;  3CXC Y;  2PK7 A;  1QVF Z;  3CXC Z;  3CCU 1;  2B63 I;  1YIT Z;  2HU9 A;  3CD6 1;  3VB9 A;  2ZAE B;  3H3V J;  4A3D I;  4A3B I;  2JA5 I;  1VQM Z;  3ESW A;  3CCR Z;  1KD1 2;  4A93 I;  4HGZ A;  1YUK A;  4NH1 C;  3I56 Z;  3S2H I;  4E30 A;  3RZD I;  1Q86 2;  1VQ5 Z;  3GTQ I;  3LUS A;  4HH4 A;  1VQ7 Z;  2QA4 Z;  3MON A;  4RVG A;  4X6A I;  3CCS 1;  3G4S 1;  2W04 A;  4DK1 A;  1USP B;  2WAQ A;  2QRE B;  3M3Y I;  3GTK I;  5IP9 I;  2JUB A;  3NH5 A;  1VQN Z;  4BBS I;  2OOX B;  4E32 A;  1RO0 A;  2Q51 A;  3HOZ I;  3RZO I;  2GTI A;  2AKL A;  2V8K A;  1TWC I;  2KPI A;  2VUG A;  2E2H I;  2WB1 A;  1YI2 Z;  2M48 A;  5C3E I;  1Z02 A;  4E33 A;  1WCM I;  3D9X A;  5FLX b;  3FKI I;  4MXU A;  4RVD A;  5T64 A;  5C4X I;  4NFR A;  1QF8 A;  4A3J I;  2QRD B;  1JJ2 Y;  1YJN 1;  2Y0S A;  2OTL Z;  1VQO Z;  1JJ2 Z;  5CM2 M;  3HOW I;  4MH4 A;  1WII A;  4HGY A;  1K8A 2;  3PO3 S;  3GKQ A;  1N8R 2;  1PFT A;  3TDH B;  1ML8 A;  1W2B Y;  2V8I A;  1VQ9 1;  1TWG I;  1R9T I;  1VQL 1;  5C4J I;  1W2B Z;  4QTT A;  4NBE A;  1VQK 1;  3EED A;  4Y7N I;  1VQP 1;  2KI7 B;  3CCQ 1;  3GTG I;  2RPR A;  4A3E I;  1S72 1;  3NH4 A;  3JAM b;  3HOY I;  4CL1 A;  2RT9 A;  3S17 I;  3J81 b;  2NVQ I;  1JWH C;  2J6A A;  2RIQ A;  3BG1 B;  3VMH A;  1RQF A;  1X3Z A;  1YJW 1;  1NP6 A;  5FLX f;  1Z01 A;  3GTM S;  2G2K A;  1YUA A;  2GTH A;  1USP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...