1TWGI

Rna polymerase ii complexed with ctp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twgI02
2JR6A 2E2HI 5C3EI 4A3BI 1WCMI 1TWFI 1PFTA 3S16I 3HOXI 1LQLA 4NBHA 4A3II 4A3DI 4NB9A 1K83I 4BY7I 2JNYA 1TFIA 2JA5I 2VUMI 4NOZA 3S14I 2R93I 2NVTI 4A3FI 4NBDA 2JA6I 3GTMI 2R92I 5IP9I 1NUIA 4NB8A 3GTPI 1WW9A 4NBAA 2YU9I 4A3JI 3GTGI 3GTQI 4A3EI 1QYPA 3I4NI 3Q87A 2NVXI 1USPB 3H0GI 4MH4A 2JA8I 2HF1A 3GTLI 1TWAI 3GKQA 5IP7I 1I3QI 1RO4A 3HOZI 1TWHI 4NBCA 4NBGA 1USPA 4BY1I 4X6AI 1ML8A 5CM2M 2NVQI 2R7ZI 4NBEA 2KPIA 1RLYA 2RBLA 3S1MI 3VMGA 3U50C 3LUSA 3CQZI 4A3KI 3VMHA 1TWCI 3RZOI 4A3LI 1N2FA 3M3YI 1X3ZA 4XX2A 1I50I 3PO3S 3PO2I 2JS4A 3I07A 4QTUA 2E2II 3EERA 3GTJI 4BBSI 3GCFA 3S2HI 2P3YA 3M4OI 2F4MA 5FLMI 2PK7A 3H3VJ 1YUAA 3HOWI 1ZB8A 3S1RI 3S15I 4A3MI 5C4JI 4A93I 3S1QI 3S1NI 4Y52I 3I4MI 2NVYI 3RZDI 5C4XI 3D6WA 2DE5A 3K7AI 1Y1VS 1Y1WI 1X3WA 1DL6A 1VLAA 1SFOI 2E2JI 3PO3I 3S2DI 2BJOA 3HOVI 3S17I 5C44I 3FKII 4A3GI 3VMIA 1R9TI 3HOYI 2AKLA 4QTTA 4NBFA 2K5RA 1TWGI 2JA7I 4BBRI 2B63I 2J6AA 1L1OC 3GTMS 4Y7NI 2F4OA 3GTOI 4BXXI 2DE6A 3ESWA 2DE7A 3HOUI 4NBBA 1I6HI 4A3CI 3VB9A 1Y1VI 3GTKI 1ZB9A
chains in the Genus database with same CATH superfamily
3CMEZ 1N8R2 1YIJZ 2E2HI 2VUGA 1WCMI 1PFTA 2QEX1 1YJW1 2W04A 3G4S1 3CCU1 2K3RA 2QRCB 2JNYA 3CME1 1X0TA 4A3FI 1YIJ1 3J81b 2QRDB 1NUIA 3MONA 2V45A 2QA4Z 3CCJZ 1JJ2Z 1KRLA 2JIQA 2YU9I 1VQMZ 3GTQI 1QYPA 1YITZ 3I4NI 3H0GI 4MD9A 5IP7I 1K9M1 3HOZI 1USPA 5D1OA 1YHQZ 3CCVZ 2NVQI 1VQM1 3CXCZ 2RBLA 1YIT1 2LIYA 3FQQA 4A3KI 3VMHA 3G6E1 1N2FA 1YHQ1 3CCV1 2RHBA 4CL1A 2E2II 3EERA 3M4OI 2F4MA 4A3MI 4A93I 3S1NI 4E33A 2WB1A 1RQFA 2GTIA 5C4XI 1QVFZ 3D9XA 1NJI1 1VLAA 3HOVI 3S17I 4A3GI 2G2KA 3CCQZ 2AKLA 2P28A 4E2XA 1K731 4MONA 1TWGI 4BBRI 3GTOI 1FDIA 2DE6A 5IT9b 3ESWA 4DK1A 5AN9F 5T6BA 1I6HI 2WAQA 4DQYB 4NH1C 3CCRZ 3MZKB 2JR6A 3S16I 3NFZA 2RIQA 3CPWY 1WJ2A 1P9NA 5IT9f 3TDHB 1VQ7Z 1W2BZ 4NB9A 3HKZA 1KC81 4BY7I 2JA5I 2R93I 3S14I 3GTMI 1Q821 1KQSY 2OOXB 1QVGZ 1Q7Y1 1VQ71 3NH8A 1VQ6Z 4MRIA 2AYDA 3T4NB 2LEXA 3CD6Z 3KIHA 1USPB 3F3FC 5D1OB 1FDOA 2QLVB 1I3QI 4NBCA 4NBGA 1Q861 1VQ61 1ML8A 5CM2M 1NJI2 3F3PC 1Z02A 2R7ZI 2JIRA 4NBEA 2VPZA 3CD61 2QR1B 3CCLZ 4RS4A 3P5JB 3CPWZ 3CQZI 4HGZA 1ZH1A 3IR7A 2O4HA 1I50I 4MD7A 3J7A4 3CCL1 3GTJI 3J81f 2PK7A 2V3VA 1YUAA 2QA41 1RO0A 1ZB8A 3CCJ1 5C4JI 2OOYB 4Y52I 1Q811 1K8A2 3I4MI 2JIMA 3RZDI 1Y1VS 3BG1B 1Z03A 1X3WA 1VQKZ 3PO3I 2E2JI 3IX0A 1M902 2V8KA 4TNUA 5C44I 1M1K1 1WZNA 1Q7Y2 2K5RA 3NDJA 1RNIA 2W03A 2B63I 3KIFA 3I55Z 3D2LA 1VQ8Z 4A3CI 1Q862 3CC7Z 1VQLZ 2GU2A 5C3EI 4RVGA 3I551 2Y0SA 3HOXI 1LQLA 1QF8A 1VQ9Z 4NBHA 3CCSZ 4A3II 4A3DI 2NAPA 2Q51A 4RVFA 1N8R1 2VUMI 4NOZA 1VQL1 2NVTI 4NBDA 2JA6I 2R92I 3JAMb 5A2Qb 3CCQ1 1WW9A 3NDIA 4NBAA 1K9M2 3GTGI 2RT9A 3VTNA 2JA8I 2HF1A 2GTHA 3CC4Z 3GTLI 3I56Z 3GKQA 1RO4A 5A2Qf 1S72Z 2VPXA 2I3CA 2PMZA 3CCR1 2KPIA 2E9HA 3U50C 3CC41 1VQPZ 1M1K2 1TWCI 3I561 2M6NA 2RPRA 1X3ZA 1S721 3M3YI 4RVDA 2JS4A 3IF8A 3I07A 2VPYA 4QTUA 5T67A 3CCEZ 1S7MA 1VQNZ 1VQP1 2EGTA 2P3YA 5FLMI 1JJ2Y 3H3VJ 3HOWI 3S1RI 3S15I 3S1QI 2JUBA 1YUKA 2OTJZ 2NVYI 4E2ZA 3D6WA 2M48A 2Q4ZA 1K732 1Y1WI 3CXCY 1SFOI 1NP6A 3S2DI 2OTJ1 2JIOA 2BJOA 3FKII 1KQSZ 2IZ3A 1R9TI 2OZKA 4QTTA 4RVHA 3CMAZ 3OW2Y 2JA7I 1L1OC 3GTMS 4Y7NI 2JMOA 4BXXI 2IV2X 2KI7B 4EWCA 3HOUI 3CC2Z 1KD11 3VB9A 4E2WA 3CMA1 3NH4A 1VQOZ 1WIIA 1KC82 2LFUA 4A3BI 1TWFI 1QVFY 2E7ZA 1Q822 4E30A 3G6EZ 2V8JA 3MZLB 3CC21 3J80b 1K83I 4MD8A 1VQO1 1TFIA 5D1PA 1VQ5Z 1VQK1 4DGLA 2ZAEB 5IP9I 4NB8A 2YADA 1RO2A 3GTPI 4HH4A 4E31A 1SIWA 3OW2Z 4A3JI 4A3EI 1VQ51 3J80f 3QWUA 3Q87A 3G71Z 2NVXI 2VF1A 4MH4A 3CCMZ 4E2YA 1TWAI 1VQ81 1TWHI 4BY1I 4X6AI 2V8IA 3IFUA 3CC71 4RV9A 1Y8CA 4NFRA 2OTLZ 1RLYA 1Q16A 3EEDA 3VMGA 3S1MI 4S1TA 5FLXb 3G711 3LUSA 3CCM1 1VQ91 1W2BY 1YJ9Z 3CCS1 2R6MA 3RZOI 4A3LI 1QXFA 4XX2A 3TE5B 5T64A 3PO3S 3PO2I 1Q812 2OTL1 1JWHC 1QVGY 3FQMA 4BBSI 2O53A 3GCFA 3S2HI 5FLXf 1KD12 1YJ91 1YJNZ 3JAMf 2IZ4A 2PM9A 1YI2Z 1VQ4Z 4HGYA 2DE5A 4E32A 1Z01A 3K7AI 1YJN1 1DL6A 2JIPA 2VPWA 1K8A1 1AA6A 1YI21 1VQ41 3BG0B 3VMIA 3HOYI 2HU9A 4NBFA 3NH5A 2J6AA 1M901 2QKDA 4MXUA 5LL6f 2F4OA 2QEXZ 2DE7A 1YJWZ 3G4SZ 4NBBA 3CCE1 3CCUZ 1VQN1 2H85A 2QREB 1Y1VI 3GTKI 1ZB9A 4AYBA
chains in the Genus database with same CATH topology
3CMEZ 1N8R2 1YIJZ 2E2HI 2VUGA 1WCMI 1PFTA 2QEX1 1YJW1 2W04A 3G4S1 3CCU1 2K3RA 2QRCB 2JNYA 3CME1 1X0TA 4A3FI 1YIJ1 3J81b 2QRDB 1NUIA 3MONA 2QA4Z 3CCJZ 1JJ2Z 1KRLA 2YU9I 1VQMZ 3GTQI 1QYPA 1YITZ 3I4NI 3H0GI 4MD9A 5IP7I 1K9M1 3HOZI 1USPA 5D1OA 1YHQZ 3CCVZ 2NVQI 1VQM1 3CXCZ 2RBLA 1YIT1 2LIYA 3FQQA 4A3KI 3VMHA 3G6E1 1N2FA 1YHQ1 3CCV1 2RHBA 4CL1A 2E2II 3EERA 3M4OI 2F4MA 4A3MI 4A93I 3S1NI 4E33A 2WB1A 1RQFA 2GTIA 5C4XI 1QVFZ 3D9XA 1NJI1 1VLAA 3HOVI 3S17I 4A3GI 2G2KA 3CCQZ 2AKLA 2P28A 4E2XA 1K731 4MONA 1TWGI 4BBRI 3GTOI 2DE6A 5IT9b 3ESWA 4DK1A 5AN9F 5T6BA 1I6HI 2WAQA 4DQYB 4NH1C 3CCRZ 3MZKB 2JR6A 3S16I 3NFZA 2RIQA 3CPWY 5IT9f 1P9NA 3TDHB 1VQ7Z 1W2BZ 4NB9A 3HKZA 1KC81 4BY7I 2JA5I 2R93I 3S14I 3GTMI 1Q821 1KQSY 2OOXB 1QVGZ 1Q7Y1 1VQ71 3NH8A 1VQ6Z 4MRIA 3T4NB 3CD6Z 3KIHA 1USPB 3F3FC 5D1OB 2QLVB 1I3QI 4NBCA 4NBGA 1Q861 1VQ61 1ML8A 5CM2M 1NJI2 3F3PC 1Z02A 2R7ZI 4NBEA 3CD61 2QR1B 3CCLZ 4RS4A 3P5JB 3CPWZ 3CQZI 4HGZA 1ZH1A 2O4HA 1I50I 4MD7A 3J7A4 3CCL1 3GTJI 3J81f 2PK7A 1YUAA 2QA41 1RO0A 1ZB8A 3CCJ1 5C4JI 2OOYB 4Y52I 1Q811 1K8A2 3I4MI 3RZDI 1Y1VS 3BG1B 1Z03A 1X3WA 1VQKZ 3PO3I 2E2JI 3IX0A 1M902 2V8KA 4TNUA 5C44I 1M1K1 1Q7Y2 2K5RA 3NDJA 1RNIA 2W03A 2B63I 3KIFA 3I55Z 1VQ8Z 4A3CI 1Q862 3CC7Z 1VQLZ 2GU2A 5C3EI 4RVGA 3I551 2Y0SA 3HOXI 1LQLA 1QF8A 1VQ9Z 4NBHA 3CCSZ 4A3II 4A3DI 2Q51A 4RVFA 1N8R1 2VUMI 4NOZA 1VQL1 2NVTI 4NBDA 2JA6I 2R92I 3JAMb 5A2Qb 3CCQ1 1WW9A 3NDIA 4NBAA 1K9M2 3GTGI 2RT9A 3VTNA 2JA8I 2HF1A 2GTHA 3CC4Z 3GTLI 3I56Z 3GKQA 1RO4A 5A2Qf 1S72Z 2I3CA 2PMZA 3CCR1 2KPIA 2E9HA 3U50C 3CC41 1VQPZ 1M1K2 1TWCI 3I561 2M6NA 2RPRA 1X3ZA 1S721 3M3YI 4RVDA 2JS4A 3IF8A 3I07A 4QTUA 5T67A 3CCEZ 1S7MA 1VQNZ 1VQP1 2EGTA 2P3YA 5FLMI 1JJ2Y 3H3VJ 3HOWI 3S1RI 3S15I 3S1QI 2JUBA 1YUKA 2OTJZ 2NVYI 4E2ZA 3D6WA 2M48A 2Q4ZA 1K732 1Y1WI 3CXCY 1SFOI 1NP6A 3S2DI 2OTJ1 2BJOA 3FKII 1KQSZ 2IZ3A 1R9TI 2OZKA 4QTTA 4RVHA 3CMAZ 3OW2Y 2JA7I 1L1OC 3GTMS 4Y7NI 2JMOA 4BXXI 2KI7B 4EWCA 3HOUI 3CC2Z 1KD11 3VB9A 4E2WA 3CMA1 3NH4A 1VQOZ 1WIIA 1KC82 2LFUA 4A3BI 1TWFI 1QVFY 1Q822 4E30A 3G6EZ 2V8JA 3MZLB 3CC21 3J80b 1K83I 4MD8A 1VQO1 1TFIA 5D1PA 1VQ5Z 1VQK1 4DGLA 2ZAEB 5IP9I 4NB8A 2YADA 1RO2A 3GTPI 4HH4A 4E31A 3OW2Z 4A3JI 4A3EI 1VQ51 3J80f 3QWUA 3Q87A 3G71Z 2NVXI 2VF1A 4MH4A 3CCMZ 4E2YA 1TWAI 1VQ81 1TWHI 4BY1I 4X6AI 2V8IA 3CC71 3IFUA 4RV9A 4NFRA 2OTLZ 1RLYA 3EEDA 3S1MI 3VMGA 4S1TA 5FLXb 3G711 3LUSA 3CCM1 1VQ91 1W2BY 1YJ9Z 3CCS1 2R6MA 3RZOI 4A3LI 4XX2A 3TE5B 5T64A 3PO3S 3PO2I 1Q812 2OTL1 1JWHC 1QVGY 3FQMA 4BBSI 2O53A 3GCFA 3S2HI 5FLXf 1KD12 1YJ91 1YJNZ 3JAMf 2IZ4A 2PM9A 1YI2Z 1VQ4Z 4HGYA 2DE5A 4E32A 1Z01A 3K7AI 1YJN1 1DL6A 1K8A1 1YI21 1VQ41 3BG0B 3VMIA 3HOYI 2HU9A 4NBFA 3NH5A 2J6AA 1M901 2QKDA 4MXUA 5LL6f 2F4OA 2QEXZ 2DE7A 1YJWZ 3G4SZ 4NBBA 3CCE1 3CCUZ 1VQN1 2H85A 2QREB 1Y1VI 3GTKI 1ZB9A 4AYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JR6 A;  2E2H I;  5C3E I;  4A3B I;  1WCM I;  1TWF I;  1PFT A;  3S16 I;  3HOX I;  1LQL A;  4NBH A;  4A3I I;  4A3D I;  4NB9 A;  1K83 I;  4BY7 I;  2JNY A;  1TFI A;  2JA5 I;  2VUM I;  4NOZ A;  3S14 I;  2R93 I;  2NVT I;  4A3F I;  4NBD A;  2JA6 I;  3GTM I;  2R92 I;  5IP9 I;  1NUI A;  4NB8 A;  3GTP I;  1WW9 A;  4NBA A;  2YU9 I;  4A3J I;  3GTG I;  3GTQ I;  4A3E I;  1QYP A;  3I4N I;  3Q87 A;  2NVX I;  1USP B;  3H0G I;  4MH4 A;  2JA8 I;  2HF1 A;  3GTL I;  1TWA I;  3GKQ A;  5IP7 I;  1I3Q I;  1RO4 A;  3HOZ I;  1TWH I;  4NBC A;  4NBG A;  1USP A;  4BY1 I;  4X6A I;  1ML8 A;  5CM2 M;  2NVQ I;  2R7Z I;  4NBE A;  2KPI A;  1RLY A;  2RBL A;  3S1M I;  3VMG A;  3U50 C;  3LUS A;  3CQZ I;  4A3K I;  3VMH A;  1TWC I;  3RZO I;  4A3L I;  1N2F A;  3M3Y I;  1X3Z A;  4XX2 A;  1I50 I;  3PO3 S;  3PO2 I;  2JS4 A;  3I07 A;  4QTU A;  2E2I I;  3EER A;  3GTJ I;  4BBS I;  3GCF A;  3S2H I;  2P3Y A;  3M4O I;  2F4M A;  5FLM I;  2PK7 A;  3H3V J;  1YUA A;  3HOW I;  1ZB8 A;  3S1R I;  3S15 I;  4A3M I;  5C4J I;  4A93 I;  3S1Q I;  3S1N I;  4Y52 I;  3I4M I;  2NVY I;  3RZD I;  5C4X I;  3D6W A;  2DE5 A;  3K7A I;  1Y1V S;  1Y1W I;  1X3W A;  1DL6 A;  1VLA A;  1SFO I;  2E2J I;  3PO3 I;  3S2D I;  2BJO A;  3HOV I;  3S17 I;  5C44 I;  3FKI I;  4A3G I;  3VMI A;  1R9T I;  3HOY I;  2AKL A;  4QTT A;  4NBF A;  2K5R A;  1TWG I;  2JA7 I;  4BBR I;  2B63 I;  2J6A A;  1L1O C;  3GTM S;  4Y7N I;  2F4O A;  3GTO I;  4BXX I;  2DE6 A;  3ESW A;  2DE7 A;  3HOU I;  4NBB A;  1I6H I;  4A3C I;  3VB9 A;  1Y1V I;  3GTK I;  1ZB9 A; 
#chains in the Genus database with same CATH topology
 3CME Z;  1N8R 2;  1YIJ Z;  2E2H I;  2VUG A;  1WCM I;  1PFT A;  2QEX 1;  1YJW 1;  2W04 A;  3G4S 1;  3CCU 1;  2K3R A;  2QRC B;  2JNY A;  3CME 1;  1X0T A;  4A3F I;  1YIJ 1;  3J81 b;  2QRD B;  1NUI A;  3MON A;  2V45 A;  2QA4 Z;  3CCJ Z;  1JJ2 Z;  1KRL A;  2JIQ A;  2YU9 I;  1VQM Z;  3GTQ I;  1QYP A;  1YIT Z;  3I4N I;  3H0G I;  4MD9 A;  5IP7 I;  1K9M 1;  3HOZ I;  1USP A;  5D1O A;  1YHQ Z;  3CCV Z;  2NVQ I;  1VQM 1;  3CXC Z;  2RBL A;  1YIT 1;  2LIY A;  3FQQ A;  4A3K I;  3VMH A;  3G6E 1;  1N2F A;  1YHQ 1;  3CCV 1;  2RHB A;  4CL1 A;  2E2I I;  3EER A;  3M4O I;  2F4M A;  4A3M I;  4A93 I;  3S1N I;  4E33 A;  2WB1 A;  1RQF A;  2GTI A;  5C4X I;  1QVF Z;  3D9X A;  1NJI 1;  1VLA A;  3HOV I;  3S17 I;  4A3G I;  2G2K A;  3CCQ Z;  2AKL A;  2P28 A;  4E2X A;  1K73 1;  4MON A;  1TWG I;  4BBR I;  3GTO I;  1FDI A;  2DE6 A;  5IT9 b;  3ESW A;  4DK1 A;  5AN9 F;  5T6B A;  1I6H I;  2WAQ A;  4DQY B;  4NH1 C;  3CCR Z;  3MZK B;  2JR6 A;  3S16 I;  3NFZ A;  2RIQ A;  3CPW Y;  1WJ2 A;  1P9N A;  5IT9 f;  3TDH B;  1VQ7 Z;  1W2B Z;  4NB9 A;  3HKZ A;  1KC8 1;  4BY7 I;  2JA5 I;  2R93 I;  3S14 I;  3GTM I;  1Q82 1;  1KQS Y;  2OOX B;  1QVG Z;  1Q7Y 1;  1VQ7 1;  3NH8 A;  1VQ6 Z;  4MRI A;  2AYD A;  3T4N B;  2LEX A;  3CD6 Z;  3KIH A;  1USP B;  3F3F C;  5D1O B;  1FDO A;  2QLV B;  1I3Q I;  4NBC A;  4NBG A;  1Q86 1;  1VQ6 1;  1ML8 A;  5CM2 M;  1NJI 2;  3F3P C;  1Z02 A;  2R7Z I;  2JIR A;  4NBE A;  2VPZ A;  3CD6 1;  2QR1 B;  3CCL Z;  4RS4 A;  3P5J B;  3CPW Z;  3CQZ I;  4HGZ A;  1ZH1 A;  3IR7 A;  2O4H A;  1I50 I;  4MD7 A;  3J7A 4;  3CCL 1;  3GTJ I;  3J81 f;  2PK7 A;  2V3V A;  1YUA A;  2QA4 1;  1RO0 A;  1ZB8 A;  3CCJ 1;  5C4J I;  2OOY B;  4Y52 I;  1Q81 1;  1K8A 2;  3I4M I;  2JIM A;  3RZD I;  1Y1V S;  3BG1 B;  1Z03 A;  1X3W A;  1VQK Z;  3PO3 I;  2E2J I;  3IX0 A;  1M90 2;  2V8K A;  4TNU A;  5C44 I;  1M1K 1;  1WZN A;  1Q7Y 2;  2K5R A;  3NDJ A;  1RNI A;  2W03 A;  2B63 I;  3KIF A;  3I55 Z;  3D2L A;  1VQ8 Z;  4A3C I;  1Q86 2;  3CC7 Z;  1VQL Z;  2GU2 A;  5C3E I;  4RVG A;  3I55 1;  2Y0S A;  3HOX I;  1LQL A;  1QF8 A;  1VQ9 Z;  4NBH A;  3CCS Z;  4A3I I;  4A3D I;  2NAP A;  2Q51 A;  4RVF A;  1N8R 1;  2VUM I;  4NOZ A;  1VQL 1;  2NVT I;  4NBD A;  2JA6 I;  2R92 I;  3JAM b;  5A2Q b;  3CCQ 1;  1WW9 A;  3NDI A;  4NBA A;  1K9M 2;  3GTG I;  2RT9 A;  3VTN A;  2JA8 I;  2HF1 A;  2GTH A;  3CC4 Z;  3GTL I;  3I56 Z;  3GKQ A;  1RO4 A;  5A2Q f;  1S72 Z;  2VPX A;  2I3C A;  2PMZ A;  3CCR 1;  2KPI A;  2E9H A;  3U50 C;  3CC4 1;  1VQP Z;  1M1K 2;  1TWC I;  3I56 1;  2M6N A;  2RPR A;  1X3Z A;  1S72 1;  3M3Y I;  4RVD A;  2JS4 A;  3IF8 A;  3I07 A;  2VPY A;  4QTU A;  5T67 A;  3CCE Z;  1S7M A;  1VQN Z;  1VQP 1;  2EGT A;  2P3Y A;  5FLM I;  1JJ2 Y;  3H3V J;  3HOW I;  3S1R I;  3S15 I;  3S1Q I;  2JUB A;  1YUK A;  2OTJ Z;  2NVY I;  4E2Z A;  3D6W A;  2M48 A;  2Q4Z A;  1K73 2;  1Y1W I;  3CXC Y;  1SFO I;  1NP6 A;  3S2D I;  2OTJ 1;  2JIO A;  2BJO A;  3FKI I;  1KQS Z;  2IZ3 A;  1R9T I;  2OZK A;  4QTT A;  4RVH A;  3CMA Z;  3OW2 Y;  2JA7 I;  1L1O C;  3GTM S;  4Y7N I;  2JMO A;  4BXX I;  2IV2 X;  2KI7 B;  4EWC A;  3HOU I;  3CC2 Z;  1KD1 1;  3VB9 A;  4E2W A;  3CMA 1;  3NH4 A;  1VQO Z;  1WII A;  1KC8 2;  2LFU A;  4A3B I;  1TWF I;  1QVF Y;  2E7Z A;  1Q82 2;  4E30 A;  3G6E Z;  2V8J A;  3MZL B;  3CC2 1;  3J80 b;  1K83 I;  4MD8 A;  1VQO 1;  1TFI A;  5D1P A;  1VQ5 Z;  1VQK 1;  4DGL A;  2ZAE B;  5IP9 I;  4NB8 A;  2YAD A;  1RO2 A;  3GTP I;  4HH4 A;  4E31 A;  1SIW A;  3OW2 Z;  4A3J I;  4A3E I;  1VQ5 1;  3J80 f;  3QWU A;  3Q87 A;  3G71 Z;  2NVX I;  2VF1 A;  4MH4 A;  3CCM Z;  4E2Y A;  1TWA I;  1VQ8 1;  1TWH I;  4BY1 I;  4X6A I;  2V8I A;  3IFU A;  3CC7 1;  4RV9 A;  1Y8C A;  4NFR A;  2OTL Z;  1RLY A;  1Q16 A;  3EED A;  3VMG A;  3S1M I;  4S1T A;  5FLX b;  3G71 1;  3LUS A;  3CCM 1;  1VQ9 1;  1W2B Y;  1YJ9 Z;  3CCS 1;  2R6M A;  3RZO I;  4A3L I;  1QXF A;  4XX2 A;  3TE5 B;  5T64 A;  3PO3 S;  3PO2 I;  1Q81 2;  2OTL 1;  1JWH C;  1QVG Y;  3FQM A;  4BBS I;  2O53 A;  3GCF A;  3S2H I;  5FLX f;  1KD1 2;  1YJ9 1;  1YJN Z;  3JAM f;  2IZ4 A;  2PM9 A;  1YI2 Z;  1VQ4 Z;  4HGY A;  2DE5 A;  4E32 A;  1Z01 A;  3K7A I;  1YJN 1;  1DL6 A;  2JIP A;  2VPW A;  1K8A 1;  1AA6 A;  1YI2 1;  1VQ4 1;  3BG0 B;  3VMI A;  3HOY I;  2HU9 A;  4NBF A;  3NH5 A;  2J6A A;  1M90 1;  2QKD A;  4MXU A;  5LL6 f;  2F4O A;  2QEX Z;  2DE7 A;  1YJW Z;  3G4S Z;  4NBB A;  3CCE 1;  3CCU Z;  1VQN 1;  2H85 A;  2QRE B;  1Y1V I;  3GTK I;  1ZB9 A;  4AYB A; 
#chains in the Genus database with same CATH homology
 3CME Z;  1N8R 2;  1YIJ Z;  2E2H I;  2VUG A;  1WCM I;  1PFT A;  2QEX 1;  1YJW 1;  2W04 A;  3G4S 1;  3CCU 1;  2K3R A;  2QRC B;  2JNY A;  3CME 1;  1X0T A;  4A3F I;  1YIJ 1;  3J81 b;  2QRD B;  1NUI A;  3MON A;  2QA4 Z;  3CCJ Z;  1JJ2 Z;  1KRL A;  2YU9 I;  1VQM Z;  3GTQ I;  1QYP A;  1YIT Z;  3I4N I;  3H0G I;  4MD9 A;  5IP7 I;  1K9M 1;  3HOZ I;  1USP A;  5D1O A;  1YHQ Z;  3CCV Z;  2NVQ I;  1VQM 1;  3CXC Z;  2RBL A;  1YIT 1;  2LIY A;  3FQQ A;  4A3K I;  3VMH A;  3G6E 1;  1N2F A;  1YHQ 1;  3CCV 1;  2RHB A;  4CL1 A;  2E2I I;  3EER A;  3M4O I;  2F4M A;  4A3M I;  4A93 I;  3S1N I;  4E33 A;  2WB1 A;  1RQF A;  2GTI A;  5C4X I;  1QVF Z;  3D9X A;  1NJI 1;  1VLA A;  3HOV I;  3S17 I;  4A3G I;  2G2K A;  3CCQ Z;  2AKL A;  2P28 A;  4E2X A;  1K73 1;  4MON A;  1TWG I;  4BBR I;  3GTO I;  2DE6 A;  5IT9 b;  3ESW A;  4DK1 A;  5AN9 F;  5T6B A;  1I6H I;  2WAQ A;  4DQY B;  4NH1 C;  3CCR Z;  3MZK B;  2JR6 A;  3S16 I;  3NFZ A;  2RIQ A;  3CPW Y;  5IT9 f;  1P9N A;  3TDH B;  1VQ7 Z;  1W2B Z;  4NB9 A;  3HKZ A;  1KC8 1;  4BY7 I;  2JA5 I;  2R93 I;  3S14 I;  3GTM I;  1Q82 1;  1KQS Y;  2OOX B;  1QVG Z;  1Q7Y 1;  1VQ7 1;  3NH8 A;  1VQ6 Z;  4MRI A;  3T4N B;  3CD6 Z;  3KIH A;  1USP B;  3F3F C;  5D1O B;  2QLV B;  1I3Q I;  4NBC A;  4NBG A;  1Q86 1;  1VQ6 1;  1ML8 A;  5CM2 M;  1NJI 2;  3F3P C;  1Z02 A;  2R7Z I;  4NBE A;  3CD6 1;  2QR1 B;  3CCL Z;  4RS4 A;  3P5J B;  3CPW Z;  3CQZ I;  4HGZ A;  1ZH1 A;  2O4H A;  1I50 I;  4MD7 A;  3J7A 4;  3CCL 1;  3GTJ I;  3J81 f;  2PK7 A;  1YUA A;  2QA4 1;  1RO0 A;  1ZB8 A;  3CCJ 1;  5C4J I;  2OOY B;  4Y52 I;  1Q81 1;  1K8A 2;  3I4M I;  3RZD I;  1Y1V S;  3BG1 B;  1Z03 A;  1X3W A;  1VQK Z;  3PO3 I;  2E2J I;  3IX0 A;  1M90 2;  2V8K A;  4TNU A;  5C44 I;  1M1K 1;  1Q7Y 2;  2K5R A;  3NDJ A;  1RNI A;  2W03 A;  2B63 I;  3KIF A;  3I55 Z;  1VQ8 Z;  4A3C I;  1Q86 2;  3CC7 Z;  1VQL Z;  2GU2 A;  5C3E I;  4RVG A;  3I55 1;  2Y0S A;  3HOX I;  1LQL A;  1QF8 A;  1VQ9 Z;  4NBH A;  3CCS Z;  4A3I I;  4A3D I;  2Q51 A;  4RVF A;  1N8R 1;  2VUM I;  4NOZ A;  1VQL 1;  2NVT I;  4NBD A;  2JA6 I;  2R92 I;  3JAM b;  5A2Q b;  3CCQ 1;  1WW9 A;  3NDI A;  4NBA A;  1K9M 2;  3GTG I;  2RT9 A;  3VTN A;  2JA8 I;  2HF1 A;  2GTH A;  3CC4 Z;  3GTL I;  3I56 Z;  3GKQ A;  1RO4 A;  5A2Q f;  1S72 Z;  2I3C A;  2PMZ A;  3CCR 1;  2KPI A;  2E9H A;  3U50 C;  3CC4 1;  1VQP Z;  1M1K 2;  1TWC I;  3I56 1;  2M6N A;  2RPR A;  1X3Z A;  1S72 1;  3M3Y I;  4RVD A;  2JS4 A;  3IF8 A;  3I07 A;  4QTU A;  5T67 A;  3CCE Z;  1S7M A;  1VQN Z;  1VQP 1;  2EGT A;  2P3Y A;  5FLM I;  1JJ2 Y;  3H3V J;  3HOW I;  3S1R I;  3S15 I;  3S1Q I;  2JUB A;  1YUK A;  2OTJ Z;  2NVY I;  4E2Z A;  3D6W A;  2M48 A;  2Q4Z A;  1K73 2;  1Y1W I;  3CXC Y;  1SFO I;  1NP6 A;  3S2D I;  2OTJ 1;  2BJO A;  3FKI I;  1KQS Z;  2IZ3 A;  1R9T I;  2OZK A;  4QTT A;  4RVH A;  3CMA Z;  3OW2 Y;  2JA7 I;  1L1O C;  3GTM S;  4Y7N I;  2JMO A;  4BXX I;  2KI7 B;  4EWC A;  3HOU I;  3CC2 Z;  1KD1 1;  3VB9 A;  4E2W A;  3CMA 1;  3NH4 A;  1VQO Z;  1WII A;  1KC8 2;  2LFU A;  4A3B I;  1TWF I;  1QVF Y;  1Q82 2;  4E30 A;  3G6E Z;  2V8J A;  3MZL B;  3CC2 1;  3J80 b;  1K83 I;  4MD8 A;  1VQO 1;  1TFI A;  5D1P A;  1VQ5 Z;  1VQK 1;  4DGL A;  2ZAE B;  5IP9 I;  4NB8 A;  2YAD A;  1RO2 A;  3GTP I;  4HH4 A;  4E31 A;  3OW2 Z;  4A3J I;  4A3E I;  1VQ5 1;  3J80 f;  3QWU A;  3Q87 A;  3G71 Z;  2NVX I;  2VF1 A;  4MH4 A;  3CCM Z;  4E2Y A;  1TWA I;  1VQ8 1;  1TWH I;  4BY1 I;  4X6A I;  2V8I A;  3CC7 1;  3IFU A;  4RV9 A;  4NFR A;  2OTL Z;  1RLY A;  3EED A;  3S1M I;  3VMG A;  4S1T A;  5FLX b;  3G71 1;  3LUS A;  3CCM 1;  1VQ9 1;  1W2B Y;  1YJ9 Z;  3CCS 1;  2R6M A;  3RZO I;  4A3L I;  4XX2 A;  3TE5 B;  5T64 A;  3PO3 S;  3PO2 I;  1Q81 2;  2OTL 1;  1JWH C;  1QVG Y;  3FQM A;  4BBS I;  2O53 A;  3GCF A;  3S2H I;  5FLX f;  1KD1 2;  1YJ9 1;  1YJN Z;  3JAM f;  2IZ4 A;  2PM9 A;  1YI2 Z;  1VQ4 Z;  4HGY A;  2DE5 A;  4E32 A;  1Z01 A;  3K7A I;  1YJN 1;  1DL6 A;  1K8A 1;  1YI2 1;  1VQ4 1;  3BG0 B;  3VMI A;  3HOY I;  2HU9 A;  4NBF A;  3NH5 A;  2J6A A;  1M90 1;  2QKD A;  4MXU A;  5LL6 f;  2F4O A;  2QEX Z;  2DE7 A;  1YJW Z;  3G4S Z;  4NBB A;  3CCE 1;  3CCU Z;  1VQN 1;  2H85 A;  2QRE B;  1Y1V I;  3GTK I;  1ZB9 A;  4AYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...