1TWGI

Rna polymerase ii complexed with ctp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
b'MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
total genus 11
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twgI02
4A3CI 2NVYI 3ESWA 4BXXI 1I50I 3GTLI 4A93I 3S2HI 4QTTA 2DE7A 2JS4A 3I07A 4A3LI 1ZB9A 3GKQA 2R7ZI 2JA5I 4NB9A 3HOWI 1LQLA 3H0GI 1Y1VS 5C4JI 3S1QI 2R92I 4NBHA 1Y1WI 2E2HI 5IP9I 4A3II 2DE5A 4A3FI 3HOVI 3HOZI 3S16I 3LUSA 1I3QI 1Y1VI 3S1RI 3VMIA 4MH4A 4XX2A 3S17I 3PO3S 1VLAA 4NBGA 1N2FA 2PK7A 2JA7I 4NBBA 1TWAI 1K83I 1ZB8A 3PO2I 3S15I 4Y52I 3EERA 1TWHI 2DE6A 3GTQI 3RZDI 4A3KI 3H3VJ 3M4OI 3FKII 4A3DI 2HF1A 3Q87A 3U50C 2AKLA 3I4MI 3S1NI 4NOZA 2E2JI 3GTOI 1WW9A 3D6WA 1SFOI 2JA8I 3GTKI 1PFTA 1TWCI 4NB8A 1RO4A 3GTJI 4NBFA 3GTMS 3M3YI 2JR6A 1USPA 4NBAA 2P3YA 2BJOA 2JNYA 3VB9A 2K5RA 4X6AI 5C44I 2VUMI 5FLMI 3VMGA 2R93I 4A3MI 3GTPI 1X3ZA 1L1OC 5CM2M 2YU9I 4BBSI 3HOYI 4NBEA 3PO3I 3S2DI 1I6HI 1R9TI 2NVTI 3GTGI 5IP7I 3S14I 1USPB 4A3JI 1RLYA 1X3WA 2NVXI 4QTUA 4A3BI 2JA6I 3VMHA 3HOXI 3I4NI 1DL6A 2RBLA 4BY7I 1TWGI 4Y7NI 1TWFI 3K7AI 3S1MI 2B63I 5C3EI 1ML8A 4NBCA 3RZOI 4BY1I 3GTMI 3HOUI 2J6AA 4A3GI 2E2II 1QYPA 4NBDA 2NVQI 5C4XI 3CQZI 1NUIA 2KPIA 4A3EI 1TFIA 4BBRI 1WCMI 2F4MA 2F4OA 3GCFA 1YUAA
chains in the Genus database with same CATH superfamily
1Q811 1WJ2A 3S2HI 1VQO1 3GTLI 3CD6Z 1QVGY 4A3LI 3MZKB 3CC21 1K9M1 3CC41 3CCVZ 1W2BZ 3CCQ1 3HOWI 1LQLA 1Y1VS 3CCUZ 1VQ81 4A3FI 1VQ61 3HOZI 1I3QI 3S1RI 5AN9F 1K731 2VPYA 4NBGA 3NH8A 3CCE1 1FDOA 4NBBA 3IF8A 1K83I 1ZB8A 1TWHI 4RV9A 3GTQI 1RO0A 3FQQA 2I3CA 3CCJZ 4E2YA 2OOXB 1QVGZ 3G6E1 2AKLA 3S1NI 3J80b 2E2JI 1M1K1 5FLXb 2HU9A 1RO4A 3NH4A 3GTMS 5D1OB 1VQMZ 2JR6A 3JAMb 2JIOA 2Y0SA 1USPA 1YITZ 4NBAA 4NFRA 1N8R1 2BJOA 2JNYA 5IT9f 3VB9A 2NAPA 3VMGA 1VQOZ 2R93I 2AYDA 3F3FC 4TNUA 1YJ91 5CM2M 4BBSI 3CC4Z 4E33A 1I6HI 2KI7B 1YJN1 5IP7I 3S14I 1USPB 2VPZA 3CD61 1RLYA 1Q822 4QTUA 1ZH1A 3I4NI 1VQ8Z 1DL6A 3KIFA 3TDHB 1VQKZ 1TWGI 3CMA1 1TWFI 3K7AI 2B63I 4E32A 2OZKA 3CCU1 4BY1I 1K8A2 2W04A 4DQYB 4AYBA 4A3GI 3BG0B 2NVQI 3CPWY 1Q16A 5C4XI 1NUIA 3G4SZ 4E31A 4A3EI 1QVFZ 2JMOA 4BBRI 1S72Z 2F4OA 2K3RA 1AA6A 1VQ9Z 1Q862 2NVYI 3ESWA 1YHQ1 1I50I 4QTTA 3GKQA 1YUKA 3J80f 3OW2Z 3CCJ1 5FLXf 2VPXA 1YJWZ 3D2LA 2R92I 1Y1WI 4A3II 4E2XA 3NFZA 2IZ3A 3LUSA 4MH4A 3VTNA 1QXFA 1TWAI 4Y52I 3PO2I 1QF8A 2Q51A 4HGYA 1VQNZ 4A3KI 1NJI2 3H3VJ 4RVFA 3CMAZ 3FKII 1VQ5Z 4A3DI 4RVHA 3Q87A 1WW9A 2JUBA 3GTKI 1Z02A 1PFTA 3I551 3CCLZ 4NBFA 1VQK1 3FQMA 4RVGA 2M48A 2PMZA 1JWHC 4HGZA 2VF1A 1KD11 2V8IA 5D1OA 2VUMI 4E2ZA 1YHQZ 2PM9A 2R6MA 3G71Z 3KIHA 2WB1A 3G4S1 3HOYI 2V3VA 3PO3I 1S721 3CCR1 4MXUA 1VQ91 5T6BA 1KQSY 4S1TA 2NVXI 2JA6I 3VMHA 3HOXI 2LEXA 2RBLA 1M902 1VQ7Z 3NDJA 1YJW1 1Q812 3QWUA 1ML8A 4NBCA 3RZOI 1KRLA 1FDIA 5A2Qb 3HOUI 1K9M2 2OTL1 1Z03A 3T4NB 1QYPA 2W03A 2KPIA 2F4MA 2LFUA 3GCFA 1Q7Y1 4A93I 2DE7A 2JS4A 3I07A 1VQN1 3I55Z 2R7ZI 1K732 2JA5I 4NB9A 1VQ51 1KD12 3H0GI 3P5JB 5C4JI 2QRCB 3S1QI 2QKDA 4CL1A 3CCL1 1P9NA 4NH1C 5IP9I 3CXCY 3HOVI 2RPRA 3S16I 4MD7A 1Y1VI 2JIQA 3CCRZ 3VMIA 1YIJZ 1M1K2 3MZLB 3PO3S 2RHBA 5T64A 2PK7A 2LIYA 4DGLA 4RS4A 3G711 2YADA 2V45A 2ZAEB 2DE6A 3RZDI 1N8R2 3NH5A 3M4OI 3JAMf 3I4MI 2WAQA 1SIWA 3GTOI 1TWCI 4NB8A 1VQ71 2OTLZ 3M3YI 4MRIA 5A2Qf 2GU2A 1JJ2Y 5LL6f 3IR7A 3CCMZ 3CXCZ 3CPWZ 2K5RA 1YI21 5FLMI 1VQL1 3GTPI 1KC81 2YU9I 2EGTA 3S2DI 1R9TI 2NVTI 3GTGI 2G2KA 2H85A 3EEDA 3CCS1 1RNIA 1X3WA 4A3JI 4EWCA 3IX0A 1Y8CA 4BY7I 1RO2A 2OTJZ 3I56Z 2JIRA 1JJ2Z 1VQ41 2E2II 1Q821 3TE5B 4NBDA 4RVDA 3CQZI 2VPWA 1YIJ1 1TFIA 3CC7Z 1WCMI 3HKZA 2JIPA 3CME1 4A3CI 1VQP1 4BXXI 1K8A1 1ZB9A 2O4HA 5T67A 2V8JA 4MONA 4E2WA 2QA41 4NBHA 2E2HI 1YI2Z 2M6NA 1KC82 2QEX1 5D1PA 1RQFA 2DE5A 1VQLZ 1Q861 3CCM1 3NDIA 4XX2A 3F3PC 3S17I 2IZ4A 1VLAA 1N2FA 3CCSZ 2JA7I 3J81b 1YUAA 3MONA 1QVFY 1KQSZ 2GTHA 3S15I 3EERA 2RIQA 2GTIA 3CC2Z 3J7A4 3BG1B 2HF1A 3CCQZ 3U50C 2O53A 2V8KA 3OW2Y 1X0TA 4NOZA 1S7MA 1WIIA 1SFOI 3D6WA 2JA8I 3IFUA 3GTJI 1NP6A 1VQ4Z 3CCV1 1VQ6Z 2OTJ1 3I561 2QLVB 2P3YA 1NJI1 2Q4ZA 3CMEZ 4X6AI 5C44I 2E7ZA 2P28A 1VQPZ 4MD8A 4E30A 3CCEZ 4A3MI 1X3ZA 2E9HA 1L1OC 4DK1A 4NBEA 4HH4A 3CC71 2QRDB 2QREB 1W2BY 2RT9A 2QA4Z 3G6EZ 2JIMA 4A3BI 2QEXZ 2IV2X 2OOYB 2VUGA 3S1MI 5C3EI 1Q7Y2 4MD9A 2QR1B 3GTMI 2J6AA 3D9XA 1VQM1 1Z01A 1YIT1 3J81f 1YJ9Z 5IT9b 1WZNA 1M901 4Y7NI 1YJNZ
chains in the Genus database with same CATH topology
1Q811 3S2HI 1VQO1 3GTLI 3CD6Z 1QVGY 4A3LI 3MZKB 3CC21 1K9M1 3CC41 3CCVZ 1W2BZ 3CCQ1 3HOWI 1LQLA 1Y1VS 3CCUZ 1VQ81 4A3FI 1VQ61 3HOZI 1I3QI 3S1RI 5AN9F 1K731 4NBGA 3NH8A 3CCE1 4NBBA 3IF8A 1K83I 1ZB8A 1TWHI 4RV9A 3GTQI 1RO0A 3FQQA 2I3CA 3CCJZ 4E2YA 2OOXB 1QVGZ 3G6E1 2AKLA 3S1NI 3J80b 2E2JI 1M1K1 5FLXb 2HU9A 1RO4A 3NH4A 3GTMS 5D1OB 1VQMZ 2JR6A 3JAMb 2Y0SA 1USPA 1YITZ 4NBAA 4NFRA 1N8R1 2BJOA 2JNYA 5IT9f 3VB9A 3VMGA 1VQOZ 2R93I 3F3FC 4TNUA 1YJ91 5CM2M 4BBSI 3CC4Z 4E33A 1I6HI 2KI7B 1YJN1 5IP7I 3S14I 1USPB 3CD61 1RLYA 1Q822 4QTUA 1ZH1A 3I4NI 1VQ8Z 1DL6A 3KIFA 3TDHB 1VQKZ 1TWGI 3CMA1 1TWFI 3K7AI 2B63I 4E32A 2OZKA 3CCU1 4BY1I 1K8A2 2W04A 4DQYB 4AYBA 4A3GI 3BG0B 2NVQI 3CPWY 5C4XI 1NUIA 3G4SZ 4E31A 4A3EI 1QVFZ 2JMOA 4BBRI 1S72Z 2F4OA 2K3RA 1VQ9Z 1Q862 2NVYI 3ESWA 1YHQ1 1I50I 4QTTA 3GKQA 1YUKA 3J80f 3OW2Z 3CCJ1 5FLXf 1YJWZ 2R92I 1Y1WI 4A3II 4E2XA 3NFZA 2IZ3A 3LUSA 4MH4A 3VTNA 1TWAI 4Y52I 3PO2I 1QF8A 2Q51A 4HGYA 1VQNZ 4A3KI 1NJI2 3H3VJ 4RVFA 3CMAZ 3FKII 1VQ5Z 4A3DI 4RVHA 3Q87A 1WW9A 2JUBA 3GTKI 1Z02A 1PFTA 3I551 3CCLZ 4NBFA 1VQK1 3FQMA 4RVGA 2M48A 2PMZA 1JWHC 4HGZA 2VF1A 1KD11 2V8IA 5D1OA 2VUMI 4E2ZA 1YHQZ 2PM9A 2R6MA 3G71Z 3KIHA 2WB1A 3G4S1 3HOYI 3PO3I 1S721 3CCR1 4MXUA 1VQ91 5T6BA 1KQSY 4S1TA 2NVXI 2JA6I 3VMHA 3HOXI 2RBLA 1M902 1VQ7Z 3NDJA 1YJW1 1Q812 3QWUA 1ML8A 4NBCA 3RZOI 1KRLA 5A2Qb 3HOUI 1K9M2 2OTL1 1Z03A 3T4NB 1QYPA 2W03A 2KPIA 2F4MA 2LFUA 3GCFA 1Q7Y1 4A93I 2DE7A 2JS4A 3I07A 1VQN1 3I55Z 2R7ZI 1K732 2JA5I 4NB9A 1VQ51 1KD12 3H0GI 3P5JB 5C4JI 2QRCB 3S1QI 2QKDA 4CL1A 3CCL1 1P9NA 4NH1C 5IP9I 3CXCY 3HOVI 2RPRA 3S16I 4MD7A 1Y1VI 3CCRZ 3VMIA 1YIJZ 1M1K2 3MZLB 3PO3S 2RHBA 5T64A 2PK7A 2LIYA 4DGLA 4RS4A 3G711 2YADA 2ZAEB 2DE6A 3RZDI 1N8R2 3NH5A 3M4OI 3JAMf 3I4MI 2WAQA 3GTOI 1TWCI 4NB8A 1VQ71 2OTLZ 3M3YI 4MRIA 5A2Qf 2GU2A 1JJ2Y 5LL6f 3CCMZ 3CXCZ 3CPWZ 2K5RA 1YI21 5FLMI 1VQL1 3GTPI 1KC81 2YU9I 2EGTA 3S2DI 1R9TI 2NVTI 3GTGI 2G2KA 2H85A 3EEDA 3CCS1 4A3JI 1RNIA 1X3WA 4EWCA 3IX0A 4BY7I 1RO2A 2OTJZ 3I56Z 1JJ2Z 1VQ41 2E2II 1Q821 3TE5B 4NBDA 4RVDA 3CQZI 1YIJ1 1TFIA 3CC7Z 1WCMI 3HKZA 3CME1 4A3CI 1VQP1 4BXXI 1K8A1 1ZB9A 2O4HA 5T67A 2V8JA 4MONA 4E2WA 2QA41 4NBHA 2E2HI 1YI2Z 2M6NA 1KC82 2QEX1 5D1PA 1RQFA 2DE5A 1VQLZ 1Q861 3CCM1 3NDIA 4XX2A 3F3PC 3S17I 2IZ4A 1VLAA 1N2FA 3CCSZ 2JA7I 3J81b 1YUAA 3MONA 1QVFY 1KQSZ 2GTHA 3S15I 3EERA 2RIQA 2GTIA 3CC2Z 3J7A4 3BG1B 2HF1A 3CCQZ 3U50C 2O53A 2V8KA 3OW2Y 1X0TA 4NOZA 1S7MA 1WIIA 1SFOI 3D6WA 2JA8I 3IFUA 3GTJI 1NP6A 1VQ4Z 3CCV1 1VQ6Z 2OTJ1 3I561 2QLVB 2P3YA 1NJI1 2Q4ZA 3CMEZ 4X6AI 5C44I 1VQPZ 2P28A 4MD8A 4E30A 3CCEZ 4A3MI 1X3ZA 2E9HA 1L1OC 4DK1A 4NBEA 4HH4A 3CC71 2QRDB 2QREB 1W2BY 2RT9A 2QA4Z 3G6EZ 4A3BI 2QEXZ 2OOYB 2VUGA 3S1MI 5C3EI 1Q7Y2 4MD9A 2QR1B 3GTMI 2J6AA 3D9XA 1VQM1 1Z01A 1YIT1 3J81f 1YJ9Z 5IT9b 1M901 4Y7NI 1YJNZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C I;  2NVY I;  3ESW A;  4BXX I;  1I50 I;  3GTL I;  4A93 I;  3S2H I;  4QTT A;  2DE7 A;  2JS4 A;  3I07 A;  4A3L I;  1ZB9 A;  3GKQ A;  2R7Z I;  2JA5 I;  4NB9 A;  3HOW I;  1LQL A;  3H0G I;  1Y1V S;  5C4J I;  3S1Q I;  2R92 I;  4NBH A;  1Y1W I;  2E2H I;  5IP9 I;  4A3I I;  2DE5 A;  4A3F I;  3HOV I;  3HOZ I;  3S16 I;  3LUS A;  1I3Q I;  1Y1V I;  3S1R I;  3VMI A;  4MH4 A;  4XX2 A;  3S17 I;  3PO3 S;  1VLA A;  4NBG A;  1N2F A;  2PK7 A;  2JA7 I;  4NBB A;  1TWA I;  1K83 I;  1ZB8 A;  3PO2 I;  3S15 I;  4Y52 I;  3EER A;  1TWH I;  2DE6 A;  3GTQ I;  3RZD I;  4A3K I;  3H3V J;  3M4O I;  3FKI I;  4A3D I;  2HF1 A;  3Q87 A;  3U50 C;  2AKL A;  3I4M I;  3S1N I;  4NOZ A;  2E2J I;  3GTO I;  1WW9 A;  3D6W A;  1SFO I;  2JA8 I;  3GTK I;  1PFT A;  1TWC I;  4NB8 A;  1RO4 A;  3GTJ I;  4NBF A;  3GTM S;  3M3Y I;  2JR6 A;  1USP A;  4NBA A;  2P3Y A;  2BJO A;  2JNY A;  3VB9 A;  2K5R A;  4X6A I;  5C44 I;  2VUM I;  5FLM I;  3VMG A;  2R93 I;  4A3M I;  3GTP I;  1X3Z A;  1L1O C;  5CM2 M;  2YU9 I;  4BBS I;  3HOY I;  4NBE A;  3PO3 I;  3S2D I;  1I6H I;  1R9T I;  2NVT I;  3GTG I;  5IP7 I;  3S14 I;  1USP B;  4A3J I;  1RLY A;  1X3W A;  2NVX I;  4QTU A;  4A3B I;  2JA6 I;  3VMH A;  3HOX I;  3I4N I;  1DL6 A;  2RBL A;  4BY7 I;  1TWG I;  4Y7N I;  1TWF I;  3K7A I;  3S1M I;  2B63 I;  5C3E I;  1ML8 A;  4NBC A;  3RZO I;  4BY1 I;  3GTM I;  3HOU I;  2J6A A;  4A3G I;  2E2I I;  1QYP A;  4NBD A;  2NVQ I;  5C4X I;  3CQZ I;  1NUI A;  2KPI A;  4A3E I;  1TFI A;  4BBR I;  1WCM I;  2F4M A;  2F4O A;  3GCF A;  1YUA A; 
#chains in the Genus database with same CATH topology
 1Q81 1;  1WJ2 A;  3S2H I;  1VQO 1;  3GTL I;  3CD6 Z;  1QVG Y;  4A3L I;  3MZK B;  3CC2 1;  1K9M 1;  3CC4 1;  3CCV Z;  1W2B Z;  3CCQ 1;  3HOW I;  1LQL A;  1Y1V S;  3CCU Z;  1VQ8 1;  4A3F I;  1VQ6 1;  3HOZ I;  1I3Q I;  3S1R I;  5AN9 F;  1K73 1;  2VPY A;  4NBG A;  3NH8 A;  3CCE 1;  1FDO A;  4NBB A;  3IF8 A;  1K83 I;  1ZB8 A;  1TWH I;  4RV9 A;  3GTQ I;  1RO0 A;  3FQQ A;  2I3C A;  3CCJ Z;  4E2Y A;  2OOX B;  1QVG Z;  3G6E 1;  2AKL A;  3S1N I;  3J80 b;  2E2J I;  1M1K 1;  5FLX b;  2HU9 A;  1RO4 A;  3NH4 A;  3GTM S;  5D1O B;  1VQM Z;  2JR6 A;  3JAM b;  2JIO A;  2Y0S A;  1USP A;  1YIT Z;  4NBA A;  4NFR A;  1N8R 1;  2BJO A;  2JNY A;  5IT9 f;  3VB9 A;  2NAP A;  3VMG A;  1VQO Z;  2R93 I;  2AYD A;  3F3F C;  4TNU A;  1YJ9 1;  5CM2 M;  4BBS I;  3CC4 Z;  4E33 A;  1I6H I;  2KI7 B;  1YJN 1;  5IP7 I;  3S14 I;  1USP B;  2VPZ A;  3CD6 1;  1RLY A;  1Q82 2;  4QTU A;  1ZH1 A;  3I4N I;  1VQ8 Z;  1DL6 A;  3KIF A;  3TDH B;  1VQK Z;  1TWG I;  3CMA 1;  1TWF I;  3K7A I;  2B63 I;  4E32 A;  2OZK A;  3CCU 1;  4BY1 I;  1K8A 2;  2W04 A;  4DQY B;  4AYB A;  4A3G I;  3BG0 B;  2NVQ I;  3CPW Y;  1Q16 A;  5C4X I;  1NUI A;  3G4S Z;  4E31 A;  4A3E I;  1QVF Z;  2JMO A;  4BBR I;  1S72 Z;  2F4O A;  2K3R A;  1AA6 A;  1VQ9 Z;  1Q86 2;  2NVY I;  3ESW A;  1YHQ 1;  1I50 I;  4QTT A;  3GKQ A;  1YUK A;  3J80 f;  3OW2 Z;  3CCJ 1;  5FLX f;  2VPX A;  1YJW Z;  3D2L A;  2R92 I;  1Y1W I;  4A3I I;  4E2X A;  3NFZ A;  2IZ3 A;  3LUS A;  4MH4 A;  3VTN A;  1QXF A;  1TWA I;  4Y52 I;  3PO2 I;  1QF8 A;  2Q51 A;  4HGY A;  1VQN Z;  4A3K I;  1NJI 2;  3H3V J;  4RVF A;  3CMA Z;  3FKI I;  1VQ5 Z;  4A3D I;  4RVH A;  3Q87 A;  1WW9 A;  2JUB A;  3GTK I;  1Z02 A;  1PFT A;  3I55 1;  3CCL Z;  4NBF A;  1VQK 1;  3FQM A;  4RVG A;  2M48 A;  2PMZ A;  1JWH C;  4HGZ A;  2VF1 A;  1KD1 1;  2V8I A;  5D1O A;  2VUM I;  4E2Z A;  1YHQ Z;  2PM9 A;  2R6M A;  3G71 Z;  3KIH A;  2WB1 A;  3G4S 1;  3HOY I;  2V3V A;  3PO3 I;  1S72 1;  3CCR 1;  4MXU A;  1VQ9 1;  5T6B A;  1KQS Y;  4S1T A;  2NVX I;  2JA6 I;  3VMH A;  3HOX I;  2LEX A;  2RBL A;  1M90 2;  1VQ7 Z;  3NDJ A;  1YJW 1;  1Q81 2;  3QWU A;  1ML8 A;  4NBC A;  3RZO I;  1KRL A;  1FDI A;  5A2Q b;  3HOU I;  1K9M 2;  2OTL 1;  1Z03 A;  3T4N B;  1QYP A;  2W03 A;  2KPI A;  2F4M A;  2LFU A;  3GCF A;  1Q7Y 1;  4A93 I;  2DE7 A;  2JS4 A;  3I07 A;  1VQN 1;  3I55 Z;  2R7Z I;  1K73 2;  2JA5 I;  4NB9 A;  1VQ5 1;  1KD1 2;  3H0G I;  3P5J B;  5C4J I;  2QRC B;  3S1Q I;  2QKD A;  4CL1 A;  3CCL 1;  1P9N A;  4NH1 C;  5IP9 I;  3CXC Y;  3HOV I;  2RPR A;  3S16 I;  4MD7 A;  1Y1V I;  2JIQ A;  3CCR Z;  3VMI A;  1YIJ Z;  1M1K 2;  3MZL B;  3PO3 S;  2RHB A;  5T64 A;  2PK7 A;  2LIY A;  4DGL A;  4RS4 A;  3G71 1;  2YAD A;  2V45 A;  2ZAE B;  2DE6 A;  3RZD I;  1N8R 2;  3NH5 A;  3M4O I;  3JAM f;  3I4M I;  2WAQ A;  1SIW A;  3GTO I;  1TWC I;  4NB8 A;  1VQ7 1;  2OTL Z;  3M3Y I;  4MRI A;  5A2Q f;  2GU2 A;  1JJ2 Y;  5LL6 f;  3IR7 A;  3CCM Z;  3CXC Z;  3CPW Z;  2K5R A;  1YI2 1;  5FLM I;  1VQL 1;  3GTP I;  1KC8 1;  2YU9 I;  2EGT A;  3S2D I;  1R9T I;  2NVT I;  3GTG I;  2G2K A;  2H85 A;  3EED A;  3CCS 1;  1RNI A;  1X3W A;  4A3J I;  4EWC A;  3IX0 A;  1Y8C A;  4BY7 I;  1RO2 A;  2OTJ Z;  3I56 Z;  2JIR A;  1JJ2 Z;  1VQ4 1;  2E2I I;  1Q82 1;  3TE5 B;  4NBD A;  4RVD A;  3CQZ I;  2VPW A;  1YIJ 1;  1TFI A;  3CC7 Z;  1WCM I;  3HKZ A;  2JIP A;  3CME 1;  4A3C I;  1VQP 1;  4BXX I;  1K8A 1;  1ZB9 A;  2O4H A;  5T67 A;  2V8J A;  4MON A;  4E2W A;  2QA4 1;  4NBH A;  2E2H I;  1YI2 Z;  2M6N A;  1KC8 2;  2QEX 1;  5D1P A;  1RQF A;  2DE5 A;  1VQL Z;  1Q86 1;  3CCM 1;  3NDI A;  4XX2 A;  3F3P C;  3S17 I;  2IZ4 A;  1VLA A;  1N2F A;  3CCS Z;  2JA7 I;  3J81 b;  1YUA A;  3MON A;  1QVF Y;  1KQS Z;  2GTH A;  3S15 I;  3EER A;  2RIQ A;  2GTI A;  3CC2 Z;  3J7A 4;  3BG1 B;  2HF1 A;  3CCQ Z;  3U50 C;  2O53 A;  2V8K A;  3OW2 Y;  1X0T A;  4NOZ A;  1S7M A;  1WII A;  1SFO I;  3D6W A;  2JA8 I;  3IFU A;  3GTJ I;  1NP6 A;  1VQ4 Z;  3CCV 1;  1VQ6 Z;  2OTJ 1;  3I56 1;  2QLV B;  2P3Y A;  1NJI 1;  2Q4Z A;  3CME Z;  4X6A I;  5C44 I;  2E7Z A;  2P28 A;  1VQP Z;  4MD8 A;  4E30 A;  3CCE Z;  4A3M I;  1X3Z A;  2E9H A;  1L1O C;  4DK1 A;  4NBE A;  4HH4 A;  3CC7 1;  2QRD B;  2QRE B;  1W2B Y;  2RT9 A;  2QA4 Z;  3G6E Z;  2JIM A;  4A3B I;  2QEX Z;  2IV2 X;  2OOY B;  2VUG A;  3S1M I;  5C3E I;  1Q7Y 2;  4MD9 A;  2QR1 B;  3GTM I;  2J6A A;  3D9X A;  1VQM 1;  1Z01 A;  1YIT 1;  3J81 f;  1YJ9 Z;  5IT9 b;  1WZN A;  1M90 1;  4Y7N I;  1YJN Z; 
#chains in the Genus database with same CATH homology
 1Q81 1;  3S2H I;  1VQO 1;  3GTL I;  3CD6 Z;  1QVG Y;  4A3L I;  3MZK B;  3CC2 1;  1K9M 1;  3CC4 1;  3CCV Z;  1W2B Z;  3CCQ 1;  3HOW I;  1LQL A;  1Y1V S;  3CCU Z;  1VQ8 1;  4A3F I;  1VQ6 1;  3HOZ I;  1I3Q I;  3S1R I;  5AN9 F;  1K73 1;  4NBG A;  3NH8 A;  3CCE 1;  4NBB A;  3IF8 A;  1K83 I;  1ZB8 A;  1TWH I;  4RV9 A;  3GTQ I;  1RO0 A;  3FQQ A;  2I3C A;  3CCJ Z;  4E2Y A;  2OOX B;  1QVG Z;  3G6E 1;  2AKL A;  3S1N I;  3J80 b;  2E2J I;  1M1K 1;  5FLX b;  2HU9 A;  1RO4 A;  3NH4 A;  3GTM S;  5D1O B;  1VQM Z;  2JR6 A;  3JAM b;  2Y0S A;  1USP A;  1YIT Z;  4NBA A;  4NFR A;  1N8R 1;  2BJO A;  2JNY A;  5IT9 f;  3VB9 A;  3VMG A;  1VQO Z;  2R93 I;  3F3F C;  4TNU A;  1YJ9 1;  5CM2 M;  4BBS I;  3CC4 Z;  4E33 A;  1I6H I;  2KI7 B;  1YJN 1;  5IP7 I;  3S14 I;  1USP B;  3CD6 1;  1RLY A;  1Q82 2;  4QTU A;  1ZH1 A;  3I4N I;  1VQ8 Z;  1DL6 A;  3KIF A;  3TDH B;  1VQK Z;  1TWG I;  3CMA 1;  1TWF I;  3K7A I;  2B63 I;  4E32 A;  2OZK A;  3CCU 1;  4BY1 I;  1K8A 2;  2W04 A;  4DQY B;  4AYB A;  4A3G I;  3BG0 B;  2NVQ I;  3CPW Y;  5C4X I;  1NUI A;  3G4S Z;  4E31 A;  4A3E I;  1QVF Z;  2JMO A;  4BBR I;  1S72 Z;  2F4O A;  2K3R A;  1VQ9 Z;  1Q86 2;  2NVY I;  3ESW A;  1YHQ 1;  1I50 I;  4QTT A;  3GKQ A;  1YUK A;  3J80 f;  3OW2 Z;  3CCJ 1;  5FLX f;  1YJW Z;  2R92 I;  1Y1W I;  4A3I I;  4E2X A;  3NFZ A;  2IZ3 A;  3LUS A;  4MH4 A;  3VTN A;  1TWA I;  4Y52 I;  3PO2 I;  1QF8 A;  2Q51 A;  4HGY A;  1VQN Z;  4A3K I;  1NJI 2;  3H3V J;  4RVF A;  3CMA Z;  3FKI I;  1VQ5 Z;  4A3D I;  4RVH A;  3Q87 A;  1WW9 A;  2JUB A;  3GTK I;  1Z02 A;  1PFT A;  3I55 1;  3CCL Z;  4NBF A;  1VQK 1;  3FQM A;  4RVG A;  2M48 A;  2PMZ A;  1JWH C;  4HGZ A;  2VF1 A;  1KD1 1;  2V8I A;  5D1O A;  2VUM I;  4E2Z A;  1YHQ Z;  2PM9 A;  2R6M A;  3G71 Z;  3KIH A;  2WB1 A;  3G4S 1;  3HOY I;  3PO3 I;  1S72 1;  3CCR 1;  4MXU A;  1VQ9 1;  5T6B A;  1KQS Y;  4S1T A;  2NVX I;  2JA6 I;  3VMH A;  3HOX I;  2RBL A;  1M90 2;  1VQ7 Z;  3NDJ A;  1YJW 1;  1Q81 2;  3QWU A;  1ML8 A;  4NBC A;  3RZO I;  1KRL A;  5A2Q b;  3HOU I;  1K9M 2;  2OTL 1;  1Z03 A;  3T4N B;  1QYP A;  2W03 A;  2KPI A;  2F4M A;  2LFU A;  3GCF A;  1Q7Y 1;  4A93 I;  2DE7 A;  2JS4 A;  3I07 A;  1VQN 1;  3I55 Z;  2R7Z I;  1K73 2;  2JA5 I;  4NB9 A;  1VQ5 1;  1KD1 2;  3H0G I;  3P5J B;  5C4J I;  2QRC B;  3S1Q I;  2QKD A;  4CL1 A;  3CCL 1;  1P9N A;  4NH1 C;  5IP9 I;  3CXC Y;  3HOV I;  2RPR A;  3S16 I;  4MD7 A;  1Y1V I;  3CCR Z;  3VMI A;  1YIJ Z;  1M1K 2;  3MZL B;  3PO3 S;  2RHB A;  5T64 A;  2PK7 A;  2LIY A;  4DGL A;  4RS4 A;  3G71 1;  2YAD A;  2ZAE B;  2DE6 A;  3RZD I;  1N8R 2;  3NH5 A;  3M4O I;  3JAM f;  3I4M I;  2WAQ A;  3GTO I;  1TWC I;  4NB8 A;  1VQ7 1;  2OTL Z;  3M3Y I;  4MRI A;  5A2Q f;  2GU2 A;  1JJ2 Y;  5LL6 f;  3CCM Z;  3CXC Z;  3CPW Z;  2K5R A;  1YI2 1;  5FLM I;  1VQL 1;  3GTP I;  1KC8 1;  2YU9 I;  2EGT A;  3S2D I;  1R9T I;  2NVT I;  3GTG I;  2G2K A;  2H85 A;  3EED A;  3CCS 1;  4A3J I;  1RNI A;  1X3W A;  4EWC A;  3IX0 A;  4BY7 I;  1RO2 A;  2OTJ Z;  3I56 Z;  1JJ2 Z;  1VQ4 1;  2E2I I;  1Q82 1;  3TE5 B;  4NBD A;  4RVD A;  3CQZ I;  1YIJ 1;  1TFI A;  3CC7 Z;  1WCM I;  3HKZ A;  3CME 1;  4A3C I;  1VQP 1;  4BXX I;  1K8A 1;  1ZB9 A;  2O4H A;  5T67 A;  2V8J A;  4MON A;  4E2W A;  2QA4 1;  4NBH A;  2E2H I;  1YI2 Z;  2M6N A;  1KC8 2;  2QEX 1;  5D1P A;  1RQF A;  2DE5 A;  1VQL Z;  1Q86 1;  3CCM 1;  3NDI A;  4XX2 A;  3F3P C;  3S17 I;  2IZ4 A;  1VLA A;  1N2F A;  3CCS Z;  2JA7 I;  3J81 b;  1YUA A;  3MON A;  1QVF Y;  1KQS Z;  2GTH A;  3S15 I;  3EER A;  2RIQ A;  2GTI A;  3CC2 Z;  3J7A 4;  3BG1 B;  2HF1 A;  3CCQ Z;  3U50 C;  2O53 A;  2V8K A;  3OW2 Y;  1X0T A;  4NOZ A;  1S7M A;  1WII A;  1SFO I;  3D6W A;  2JA8 I;  3IFU A;  3GTJ I;  1NP6 A;  1VQ4 Z;  3CCV 1;  1VQ6 Z;  2OTJ 1;  3I56 1;  2QLV B;  2P3Y A;  1NJI 1;  2Q4Z A;  3CME Z;  4X6A I;  5C44 I;  1VQP Z;  2P28 A;  4MD8 A;  4E30 A;  3CCE Z;  4A3M I;  1X3Z A;  2E9H A;  1L1O C;  4DK1 A;  4NBE A;  4HH4 A;  3CC7 1;  2QRD B;  2QRE B;  1W2B Y;  2RT9 A;  2QA4 Z;  3G6E Z;  4A3B I;  2QEX Z;  2OOY B;  2VUG A;  3S1M I;  5C3E I;  1Q7Y 2;  4MD9 A;  2QR1 B;  3GTM I;  2J6A A;  3D9X A;  1VQM 1;  1Z01 A;  1YIT 1;  3J81 f;  1YJ9 Z;  5IT9 b;  1M90 1;  4Y7N I;  1YJN Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...