1TWGI

Rna polymerase ii complexed with ctp
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
121
structure length
121
Chain Sequence
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 11
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twgI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1twgI02
3HOYI 5CM2M 3S2HI 4A93I 1RO4A 3GTMI 3VMGA 3HOVI 4A3II 2E2II 2E2JI 2R93I 3Q87A 4NBDA 3K7AI 4QTTA 4NBBA 4A3JI 3GTQI 3ESWA 4NBCA 4A3EI 1TWCI 2J6AA 1TWGI 1R9TI 3RZOI 5FLMI 3GTOI 5C44I 4A3MI 1VLAA 2NVYI 4X6AI 3VB9A 2E2HI 2JA5I 1WCMI 3H0GI 2JS4A 1ML8A 3M3YI 1USPA 2NVTI 4A3CI 1QYPA 3GTPI 1WW9A 1LQLA 4BBRI 4NBEA 4BY1I 3HOWI 3EERA 2DE6A 4BY7I 2P3YA 4A3DI 1DL6A 4QTUA 4A3KI 1Y1VS 3CQZI 5C3EI 4NBAA 4XX2A 4Y52I 3H3VJ 2JA7I 1N2FA 1RLYA 4BXXI 1NUIA 3PO3S 1YUAA 4A3LI 1TFIA 2NVQI 1SFOI 3S15I 2PK7A 3VMIA 4A3BI 3U50C 2VUMI 2HF1A 3HOUI 1ZB9A 4BBSI 1TWFI 1Y1WI 3S14I 3RZDI 1X3ZA 1TWHI 1ZB8A 3GTKI 4NB8A 2DE5A 2B63I 1Y1VI 3I4NI 5IP7I 3PO2I 3I4MI 2F4MA 4NBHA 1I6HI 3S1MI 4NB9A 4A3GI 3S1NI 1X3WA 3HOZI 3GTLI 3PO3I 4NBFA 3S1QI 3I07A 3GTGI 2AKLA 1L1OC 1PFTA 3GKQA 5IP9I 2F4OA 3LUSA 2RBLA 2K5RA 1TWAI 3FKII 2JA8I 1I3QI 4MH4A 1USPB 2JR6A 3S17I 2KPIA 2YU9I 3M4OI 3GTMS 3D6WA 4NBGA 2DE7A 1I50I 4Y7NI 3HOXI 3VMHA 3S2DI 5C4XI 4NOZA 2JA6I 4A3FI 2BJOA 2NVXI 3S16I 3GCFA 2R92I 2R7ZI 1K83I 2JNYA 3S1RI 5C4JI 3GTJI
chains in the Genus database with same CATH superfamily
3HOYI 3T4NB 1K8A2 2PM9A 3G71Z 3G4SZ 2ZAEB 3CC41 1JJ2Z 2GTHA 1VQ61 4NBDA 3K7AI 1ZH1A 3OW2Z 3BG0B 4NBCA 3CCQZ 1TWGI 3VTNA 3CC21 1JJ2Y 2NVYI 1YIT1 2E2HI 2QLVB 1VQLZ 2QRDB 2W04A 2LEXA 1VQOZ 1VQN1 1YIJZ 1KD11 2QRCB 2GU2A 3OW2Y 2RHBA 5IT9f 2NVTI 1YJW1 4EWCA 3GTPI 1QVFZ 3CCL1 4BBRI 1NP6A 1Z03A 5D1OB 3HOWI 2QA41 3CCUZ 4BY7I 1M901 3IF8A 1QVFY 4DK1A 5IT9b 1VQP1 1Q811 2V45A 5FLXf 1RLYA 2PMZA 3G6E1 4NFRA 3U50C 1FDOA 2G2KA 3HOUI 4BBSI 2Q51A 3IR7A 3RZDI 4RVDA 1K8A1 1TWHI 3GTKI 1VQMZ 5FLXb 4MD7A 1K732 5IP7I 1YI21 2QKDA 3I4MI 2YADA 3S1MI 4NB9A 4E32A 1YJ9Z 2V8JA 5A2Qf 2JMOA 1Z02A 3IFUA 4MRIA 3JAMb 3CCM1 2JIMA 5LL6f 3CCE1 3CCJZ 3CCVZ 2E9HA 5D1OA 3GKQA 2F4OA 2RBLA 2H85A 3FKII 2OOXB 4DGLA 5A2Qb 1USPB 2QEX1 1VQK1 3S17I 2KPIA 3CCSZ 3D6WA 2OTLZ 3S2DI 1QXFA 2GTIA 2M6NA 4RVFA 3CXCZ 2OTJ1 3GCFA 1RO0A 4NH1C 2R7ZI 1VQ4Z 2NAPA 3J7A4 5CM2M 3S2HI 1VQ71 3CXCY 2IZ4A 3NH4A 1Q822 3VMGA 1K731 2E2II 2E2JI 3Q87A 3CC2Z 1M1K2 4QTTA 4NBBA 1S7MA 2JIRA 2J6AA 1R9TI 2RPRA 1VLAA 3CCLZ 1WCMI 3H0GI 2RT9A 1ML8A 2R6MA 3M3YI 1USPA 2O4HA 3NH5A 3CCR1 4BY1I 1RNIA 1VQPZ 3FQQA 2P28A 3I561 3NDIA 2I3CA 2IV2X 3G6EZ 3KIFA 4XX2A 4Y52I 3H3VJ 2JIPA 1YJNZ 2JA7I 3TE5B 4CL1A 3PO3S 1YUKA 1TFIA 3EEDA 2EGTA 1Q7Y1 3VMIA 2M48A 2HF1A 4RV9A 1ZB9A 3J80f 1Y1WI 1YHQ1 4MD8A 2IZ3A 1X3ZA 2K3RA 1Q821 1Q862 4E33A 1M1K1 3CME1 1I6HI 4A3GI 3CCEZ 3HOZI 3PO3I 4NBFA 3S1QI 4MONA 3J80b 1Q16A 3GTGI 2AKLA 2O53A 2RIQA 3D2LA 3J81b 3LUSA 2JIOA 2K5RA 3JAMf 1I3QI 2JR6A 3M4OI 3GTMS 3G711 3MZLB 1VQ9Z 2OTJZ 1Z01A 3S16I 3I551 2R92I 1K83I 1RQFA 4E2WA 3S14I 2VF1A 3GTJI 5AN9F 1YIJ1 4A93I 2HU9A 1RO4A 3CMAZ 1Y8CA 3GTMI 1P9NA 3CD61 1Q861 4RVGA 2R93I 3NH8A 4A3JI 1TWCI 3CCU1 5T67A 5FLMI 3GTOI 5C44I 4A3MI 1X0TA 3QWUA 4X6AI 4RS4A 2VPWA 3F3FC 2JS4A 2Q4ZA 4A3CI 3CC4Z 1K9M2 3KIHA 3CC71 1FDIA 1VQ6Z 3I56Z 3EERA 4DQYB 2P3YA 4QTUA 1VQM1 1YITZ 3TDHB 1VQNZ 4RVHA 2VPYA 4A3LI 1YUAA 1YJWZ 1SFOI 2PK7A 2VUMI 2QA4Z 3CPWZ 3MONA 4HGZA 3CCV1 5T64A 1ZB8A 3D9XA 2DE5A 2B63I 3FQMA 3I4NI 4HH4A 1KQSZ 2JIQA 3CPWY 2F4MA 4S1TA 1NJI2 2KI7B 2QR1B 3NFZA 3I07A 2VPXA 1WIIA 1KQSY 1L1OC 1PFTA 3BG1B 2WB1A 5IP9I 1K9M1 1YI2Z 4MH4A 1SIWA 1VQ81 1VQ41 3J81f 3CCMZ 4HGYA 2VUGA 3VMHA 4E2XA 3I55Z 1S721 3MZKB 2JA6I 4A3FI 4TNUA 3S1RI 2NVXI 2JNYA 3CD6Z 2QEXZ 1W2BZ 1VQKZ 2V8KA 2WAQA 2E7ZA 5T6BA 4E2YA 1VQ51 3HOVI 4A3II 3NDJA 1W2BY 3GTQI 3G4S1 3ESWA 4A3EI 1NJI1 3RZOI 4MD9A 3CC7Z 2Y0SA 3VB9A 2JA5I 3IX0A 1YJN1 3CCQ1 2JUBA 1VQ7Z 1QYPA 2LFUA 1WW9A 1VQL1 1LQLA 1VQO1 4NBEA 2DE6A 3HKZA 4A3DI 1KC82 1DL6A 4A3KI 1Y1VS 3CQZI 5C3EI 4NBAA 1N2FA 4BXXI 1NUIA 1N8R2 2NVQI 3S15I 3CCRZ 4A3BI 1KRLA 1TWFI 1Q7Y2 1QVGZ 2QREB 4E2ZA 4NB8A 1WJ2A 5D1PA 1AA6A 1RO2A 1Y1VI 3P5JB 3PO2I 4NBHA 1QVGY 3S1NI 1X3WA 3GTLI 4AYBA 4MXUA 2AYDA 4E31A 1VQ91 4E30A 2OOYB 1YJ91 1YHQZ 1VQ8Z 1KD12 1TWAI 2JA8I 3CCJ1 3CMEZ 2OZKA 1S72Z 2YU9I 1M902 1KC81 2V8IA 4NBGA 2DE7A 1I50I 4Y7NI 3HOXI 3CMA1 2VPZA 3CCS1 1Q812 5C4XI 1JWHC 1QF8A 4NOZA 2LIYA 1N8R1 2BJOA 2OTL1 3F3PC 2V3VA 1VQ5Z 2W03A 1WZNA 5C4JI
chains in the Genus database with same CATH topology
3HOYI 3T4NB 1K8A2 2PM9A 3G71Z 3G4SZ 2ZAEB 3CC41 1JJ2Z 2GTHA 1VQ61 4NBDA 3K7AI 1ZH1A 3OW2Z 3BG0B 4NBCA 3CCQZ 1TWGI 3VTNA 3CC21 1JJ2Y 2NVYI 1YIT1 2E2HI 2QLVB 1VQLZ 2QRDB 2W04A 1VQOZ 1VQN1 1YIJZ 1KD11 2QRCB 2GU2A 3OW2Y 2RHBA 5IT9f 2NVTI 1YJW1 4EWCA 3GTPI 1QVFZ 3CCL1 4BBRI 1NP6A 1Z03A 5D1OB 3HOWI 2QA41 3CCUZ 4BY7I 1M901 3IF8A 1QVFY 4DK1A 5IT9b 1VQP1 1Q811 5FLXf 1RLYA 2PMZA 3G6E1 4NFRA 3U50C 2G2KA 3HOUI 4BBSI 2Q51A 3RZDI 4RVDA 1K8A1 1TWHI 3GTKI 1VQMZ 5FLXb 4MD7A 1K732 5IP7I 1YI21 2QKDA 3I4MI 2YADA 3S1MI 4NB9A 4E32A 1YJ9Z 2V8JA 2JMOA 1Z02A 5A2Qf 3IFUA 4MRIA 3JAMb 3CCM1 5LL6f 3CCE1 3CCJZ 3CCVZ 2E9HA 5D1OA 3GKQA 2F4OA 2RBLA 2H85A 3FKII 2OOXB 4DGLA 5A2Qb 1USPB 2QEX1 1VQK1 3S17I 2KPIA 3CCSZ 3D6WA 2OTLZ 3S2DI 2GTIA 2M6NA 4RVFA 3CXCZ 2OTJ1 3GCFA 1RO0A 4NH1C 2R7ZI 1VQ4Z 3J7A4 5CM2M 3S2HI 1VQ71 3CXCY 2IZ4A 3NH4A 1Q822 3VMGA 1K731 2E2II 2E2JI 3Q87A 3CC2Z 1M1K2 4QTTA 4NBBA 1S7MA 2J6AA 1R9TI 2RPRA 1VLAA 3CCLZ 1WCMI 3H0GI 2RT9A 1ML8A 2R6MA 3M3YI 1USPA 2O4HA 3NH5A 3CCR1 4BY1I 1RNIA 1VQPZ 3FQQA 2P28A 3I561 3NDIA 2I3CA 3G6EZ 3KIFA 4XX2A 4Y52I 3H3VJ 1YJNZ 2JA7I 3TE5B 4CL1A 3PO3S 1YUKA 1TFIA 3EEDA 2EGTA 1Q7Y1 3VMIA 2M48A 2HF1A 4RV9A 1ZB9A 3J80f 1Y1WI 1YHQ1 4MD8A 2IZ3A 1X3ZA 2K3RA 1Q821 1Q862 4E33A 1M1K1 3CME1 1I6HI 4A3GI 3CCEZ 3HOZI 3PO3I 4NBFA 3S1QI 4MONA 3J80b 3GTGI 2AKLA 2O53A 2RIQA 3J81b 3LUSA 2K5RA 3JAMf 1I3QI 2JR6A 3M4OI 3GTMS 3G711 3MZLB 1VQ9Z 2OTJZ 1Z01A 3S16I 3I551 2R92I 1K83I 1RQFA 4E2WA 3S14I 2VF1A 3GTJI 5AN9F 1YIJ1 4A93I 2HU9A 1RO4A 3CMAZ 3GTMI 1P9NA 3CD61 1Q861 4RVGA 2R93I 3NH8A 4A3JI 1TWCI 3CCU1 5T67A 5FLMI 3GTOI 5C44I 4A3MI 1X0TA 3QWUA 4X6AI 4RS4A 3F3FC 2JS4A 2Q4ZA 4A3CI 3CC4Z 1K9M2 3KIHA 3CC71 1VQ6Z 3I56Z 3EERA 4DQYB 2P3YA 4QTUA 1VQM1 1YITZ 3TDHB 1VQNZ 4RVHA 4A3LI 1YUAA 1YJWZ 1SFOI 2PK7A 2VUMI 2QA4Z 3CPWZ 3MONA 4HGZA 3CCV1 5T64A 1ZB8A 3D9XA 2DE5A 2B63I 3FQMA 3I4NI 4HH4A 1KQSZ 3CPWY 2F4MA 4S1TA 1NJI2 2KI7B 2QR1B 3NFZA 3I07A 1WIIA 1KQSY 1L1OC 1PFTA 3BG1B 2WB1A 5IP9I 1K9M1 1YI2Z 4MH4A 1VQ81 1VQ41 3J81f 3CCMZ 4HGYA 2VUGA 3VMHA 4E2XA 3I55Z 1S721 3MZKB 2JA6I 4A3FI 4TNUA 2NVXI 2JNYA 3CD6Z 2QEXZ 1W2BZ 1VQKZ 2V8KA 2WAQA 5T6BA 4E2YA 1VQ51 3HOVI 4A3II 3NDJA 1W2BY 3GTQI 3G4S1 3ESWA 4A3EI 1NJI1 3RZOI 4MD9A 3CC7Z 2Y0SA 3VB9A 2JA5I 3IX0A 1YJN1 3CCQ1 2JUBA 1VQ7Z 1QYPA 2LFUA 1WW9A 1VQL1 1LQLA 1VQO1 4NBEA 2DE6A 3HKZA 4A3DI 1KC82 1DL6A 4A3KI 1Y1VS 3CQZI 5C3EI 4NBAA 1N2FA 4BXXI 1NUIA 1N8R2 2NVQI 3S15I 3CCRZ 4A3BI 1KRLA 1TWFI 1Q7Y2 1QVGZ 2QREB 4E2ZA 4NB8A 5D1PA 1RO2A 1Y1VI 3P5JB 3PO2I 4NBHA 1QVGY 3S1NI 1X3WA 3GTLI 4AYBA 4MXUA 4E31A 1VQ91 4E30A 2OOYB 1YJ91 1YHQZ 1VQ8Z 1KD12 1TWAI 2JA8I 3CCJ1 3CMEZ 2OZKA 1S72Z 2YU9I 1M902 1KC81 2V8IA 4NBGA 2DE7A 1I50I 4Y7NI 3HOXI 3CMA1 3CCS1 1Q812 5C4XI 1JWHC 1QF8A 4NOZA 2LIYA 1N8R1 2BJOA 2OTL1 3F3PC 1VQ5Z 2W03A 3S1RI 5C4JI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY I;  5CM2 M;  3S2H I;  4A93 I;  1RO4 A;  3GTM I;  3VMG A;  3HOV I;  4A3I I;  2E2I I;  2E2J I;  2R93 I;  3Q87 A;  4NBD A;  3K7A I;  4QTT A;  4NBB A;  4A3J I;  3GTQ I;  3ESW A;  4NBC A;  4A3E I;  1TWC I;  2J6A A;  1TWG I;  1R9T I;  3RZO I;  5FLM I;  3GTO I;  5C44 I;  4A3M I;  1VLA A;  2NVY I;  4X6A I;  3VB9 A;  2E2H I;  2JA5 I;  1WCM I;  3H0G I;  2JS4 A;  1ML8 A;  3M3Y I;  1USP A;  2NVT I;  4A3C I;  1QYP A;  3GTP I;  1WW9 A;  1LQL A;  4BBR I;  4NBE A;  4BY1 I;  3HOW I;  3EER A;  2DE6 A;  4BY7 I;  2P3Y A;  4A3D I;  1DL6 A;  4QTU A;  4A3K I;  1Y1V S;  3CQZ I;  5C3E I;  4NBA A;  4XX2 A;  4Y52 I;  3H3V J;  2JA7 I;  1N2F A;  1RLY A;  4BXX I;  1NUI A;  3PO3 S;  1YUA A;  4A3L I;  1TFI A;  2NVQ I;  1SFO I;  3S15 I;  2PK7 A;  3VMI A;  4A3B I;  3U50 C;  2VUM I;  2HF1 A;  3HOU I;  1ZB9 A;  4BBS I;  1TWF I;  1Y1W I;  3S14 I;  3RZD I;  1X3Z A;  1TWH I;  1ZB8 A;  3GTK I;  4NB8 A;  2DE5 A;  2B63 I;  1Y1V I;  3I4N I;  5IP7 I;  3PO2 I;  3I4M I;  2F4M A;  4NBH A;  1I6H I;  3S1M I;  4NB9 A;  4A3G I;  3S1N I;  1X3W A;  3HOZ I;  3GTL I;  3PO3 I;  4NBF A;  3S1Q I;  3I07 A;  3GTG I;  2AKL A;  1L1O C;  1PFT A;  3GKQ A;  5IP9 I;  2F4O A;  3LUS A;  2RBL A;  2K5R A;  1TWA I;  3FKI I;  2JA8 I;  1I3Q I;  4MH4 A;  1USP B;  2JR6 A;  3S17 I;  2KPI A;  2YU9 I;  3M4O I;  3GTM S;  3D6W A;  4NBG A;  2DE7 A;  1I50 I;  4Y7N I;  3HOX I;  3VMH A;  3S2D I;  5C4X I;  4NOZ A;  2JA6 I;  4A3F I;  2BJO A;  2NVX I;  3S16 I;  3GCF A;  2R92 I;  2R7Z I;  1K83 I;  2JNY A;  3S1R I;  5C4J I;  3GTJ I; 
#chains in the Genus database with same CATH topology
 3HOY I;  3T4N B;  1K8A 2;  2PM9 A;  3G71 Z;  3G4S Z;  2ZAE B;  3CC4 1;  1JJ2 Z;  2GTH A;  1VQ6 1;  4NBD A;  3K7A I;  1ZH1 A;  3OW2 Z;  3BG0 B;  4NBC A;  3CCQ Z;  1TWG I;  3VTN A;  3CC2 1;  1JJ2 Y;  2NVY I;  1YIT 1;  2E2H I;  2QLV B;  1VQL Z;  2QRD B;  2W04 A;  2LEX A;  1VQO Z;  1VQN 1;  1YIJ Z;  1KD1 1;  2QRC B;  2GU2 A;  3OW2 Y;  2RHB A;  5IT9 f;  2NVT I;  1YJW 1;  4EWC A;  3GTP I;  1QVF Z;  3CCL 1;  4BBR I;  1NP6 A;  1Z03 A;  5D1O B;  3HOW I;  2QA4 1;  3CCU Z;  4BY7 I;  1M90 1;  3IF8 A;  1QVF Y;  4DK1 A;  5IT9 b;  1VQP 1;  1Q81 1;  2V45 A;  5FLX f;  1RLY A;  2PMZ A;  3G6E 1;  4NFR A;  3U50 C;  1FDO A;  2G2K A;  3HOU I;  4BBS I;  2Q51 A;  3IR7 A;  3RZD I;  4RVD A;  1K8A 1;  1TWH I;  3GTK I;  1VQM Z;  5FLX b;  4MD7 A;  1K73 2;  5IP7 I;  1YI2 1;  2QKD A;  3I4M I;  2YAD A;  3S1M I;  4NB9 A;  4E32 A;  1YJ9 Z;  2V8J A;  5A2Q f;  2JMO A;  1Z02 A;  3IFU A;  4MRI A;  3JAM b;  3CCM 1;  2JIM A;  5LL6 f;  3CCE 1;  3CCJ Z;  3CCV Z;  2E9H A;  5D1O A;  3GKQ A;  2F4O A;  2RBL A;  2H85 A;  3FKI I;  2OOX B;  4DGL A;  5A2Q b;  1USP B;  2QEX 1;  1VQK 1;  3S17 I;  2KPI A;  3CCS Z;  3D6W A;  2OTL Z;  3S2D I;  1QXF A;  2GTI A;  2M6N A;  4RVF A;  3CXC Z;  2OTJ 1;  3GCF A;  1RO0 A;  4NH1 C;  2R7Z I;  1VQ4 Z;  2NAP A;  3J7A 4;  5CM2 M;  3S2H I;  1VQ7 1;  3CXC Y;  2IZ4 A;  3NH4 A;  1Q82 2;  3VMG A;  1K73 1;  2E2I I;  2E2J I;  3Q87 A;  3CC2 Z;  1M1K 2;  4QTT A;  4NBB A;  1S7M A;  2JIR A;  2J6A A;  1R9T I;  2RPR A;  1VLA A;  3CCL Z;  1WCM I;  3H0G I;  2RT9 A;  1ML8 A;  2R6M A;  3M3Y I;  1USP A;  2O4H A;  3NH5 A;  3CCR 1;  4BY1 I;  1RNI A;  1VQP Z;  3FQQ A;  2P28 A;  3I56 1;  3NDI A;  2I3C A;  2IV2 X;  3G6E Z;  3KIF A;  4XX2 A;  4Y52 I;  3H3V J;  2JIP A;  1YJN Z;  2JA7 I;  3TE5 B;  4CL1 A;  3PO3 S;  1YUK A;  1TFI A;  3EED A;  2EGT A;  1Q7Y 1;  3VMI A;  2M48 A;  2HF1 A;  4RV9 A;  1ZB9 A;  3J80 f;  1Y1W I;  1YHQ 1;  4MD8 A;  2IZ3 A;  1X3Z A;  2K3R A;  1Q82 1;  1Q86 2;  4E33 A;  1M1K 1;  3CME 1;  1I6H I;  4A3G I;  3CCE Z;  3HOZ I;  3PO3 I;  4NBF A;  3S1Q I;  4MON A;  3J80 b;  1Q16 A;  3GTG I;  2AKL A;  2O53 A;  2RIQ A;  3D2L A;  3J81 b;  3LUS A;  2JIO A;  2K5R A;  3JAM f;  1I3Q I;  2JR6 A;  3M4O I;  3GTM S;  3G71 1;  3MZL B;  1VQ9 Z;  2OTJ Z;  1Z01 A;  3S16 I;  3I55 1;  2R92 I;  1K83 I;  1RQF A;  4E2W A;  3S14 I;  2VF1 A;  3GTJ I;  5AN9 F;  1YIJ 1;  4A93 I;  2HU9 A;  1RO4 A;  3CMA Z;  1Y8C A;  3GTM I;  1P9N A;  3CD6 1;  1Q86 1;  4RVG A;  2R93 I;  3NH8 A;  4A3J I;  1TWC I;  3CCU 1;  5T67 A;  5FLM I;  3GTO I;  5C44 I;  4A3M I;  1X0T A;  3QWU A;  4X6A I;  4RS4 A;  2VPW A;  3F3F C;  2JS4 A;  2Q4Z A;  4A3C I;  3CC4 Z;  1K9M 2;  3KIH A;  3CC7 1;  1FDI A;  1VQ6 Z;  3I56 Z;  3EER A;  4DQY B;  2P3Y A;  4QTU A;  1VQM 1;  1YIT Z;  3TDH B;  1VQN Z;  4RVH A;  2VPY A;  4A3L I;  1YUA A;  1YJW Z;  1SFO I;  2PK7 A;  2VUM I;  2QA4 Z;  3CPW Z;  3MON A;  4HGZ A;  3CCV 1;  5T64 A;  1ZB8 A;  3D9X A;  2DE5 A;  2B63 I;  3FQM A;  3I4N I;  4HH4 A;  1KQS Z;  2JIQ A;  3CPW Y;  2F4M A;  4S1T A;  1NJI 2;  2KI7 B;  2QR1 B;  3NFZ A;  3I07 A;  2VPX A;  1WII A;  1KQS Y;  1L1O C;  1PFT A;  3BG1 B;  2WB1 A;  5IP9 I;  1K9M 1;  1YI2 Z;  4MH4 A;  1SIW A;  1VQ8 1;  1VQ4 1;  3J81 f;  3CCM Z;  4HGY A;  2VUG A;  3VMH A;  4E2X A;  3I55 Z;  1S72 1;  3MZK B;  2JA6 I;  4A3F I;  4TNU A;  3S1R I;  2NVX I;  2JNY A;  3CD6 Z;  2QEX Z;  1W2B Z;  1VQK Z;  2V8K A;  2WAQ A;  2E7Z A;  5T6B A;  4E2Y A;  1VQ5 1;  3HOV I;  4A3I I;  3NDJ A;  1W2B Y;  3GTQ I;  3G4S 1;  3ESW A;  4A3E I;  1NJI 1;  3RZO I;  4MD9 A;  3CC7 Z;  2Y0S A;  3VB9 A;  2JA5 I;  3IX0 A;  1YJN 1;  3CCQ 1;  2JUB A;  1VQ7 Z;  1QYP A;  2LFU A;  1WW9 A;  1VQL 1;  1LQL A;  1VQO 1;  4NBE A;  2DE6 A;  3HKZ A;  4A3D I;  1KC8 2;  1DL6 A;  4A3K I;  1Y1V S;  3CQZ I;  5C3E I;  4NBA A;  1N2F A;  4BXX I;  1NUI A;  1N8R 2;  2NVQ I;  3S15 I;  3CCR Z;  4A3B I;  1KRL A;  1TWF I;  1Q7Y 2;  1QVG Z;  2QRE B;  4E2Z A;  4NB8 A;  1WJ2 A;  5D1P A;  1AA6 A;  1RO2 A;  1Y1V I;  3P5J B;  3PO2 I;  4NBH A;  1QVG Y;  3S1N I;  1X3W A;  3GTL I;  4AYB A;  4MXU A;  2AYD A;  4E31 A;  1VQ9 1;  4E30 A;  2OOY B;  1YJ9 1;  1YHQ Z;  1VQ8 Z;  1KD1 2;  1TWA I;  2JA8 I;  3CCJ 1;  3CME Z;  2OZK A;  1S72 Z;  2YU9 I;  1M90 2;  1KC8 1;  2V8I A;  4NBG A;  2DE7 A;  1I50 I;  4Y7N I;  3HOX I;  3CMA 1;  2VPZ A;  3CCS 1;  1Q81 2;  5C4X I;  1JWH C;  1QF8 A;  4NOZ A;  2LIY A;  1N8R 1;  2BJO A;  2OTL 1;  3F3P C;  2V3V A;  1VQ5 Z;  2W03 A;  1WZN A;  5C4J I; 
#chains in the Genus database with same CATH homology
 3HOY I;  3T4N B;  1K8A 2;  2PM9 A;  3G71 Z;  3G4S Z;  2ZAE B;  3CC4 1;  1JJ2 Z;  2GTH A;  1VQ6 1;  4NBD A;  3K7A I;  1ZH1 A;  3OW2 Z;  3BG0 B;  4NBC A;  3CCQ Z;  1TWG I;  3VTN A;  3CC2 1;  1JJ2 Y;  2NVY I;  1YIT 1;  2E2H I;  2QLV B;  1VQL Z;  2QRD B;  2W04 A;  1VQO Z;  1VQN 1;  1YIJ Z;  1KD1 1;  2QRC B;  2GU2 A;  3OW2 Y;  2RHB A;  5IT9 f;  2NVT I;  1YJW 1;  4EWC A;  3GTP I;  1QVF Z;  3CCL 1;  4BBR I;  1NP6 A;  1Z03 A;  5D1O B;  3HOW I;  2QA4 1;  3CCU Z;  4BY7 I;  1M90 1;  3IF8 A;  1QVF Y;  4DK1 A;  5IT9 b;  1VQP 1;  1Q81 1;  5FLX f;  1RLY A;  2PMZ A;  3G6E 1;  4NFR A;  3U50 C;  2G2K A;  3HOU I;  4BBS I;  2Q51 A;  3RZD I;  4RVD A;  1K8A 1;  1TWH I;  3GTK I;  1VQM Z;  5FLX b;  4MD7 A;  1K73 2;  5IP7 I;  1YI2 1;  2QKD A;  3I4M I;  2YAD A;  3S1M I;  4NB9 A;  4E32 A;  1YJ9 Z;  2V8J A;  2JMO A;  1Z02 A;  5A2Q f;  3IFU A;  4MRI A;  3JAM b;  3CCM 1;  5LL6 f;  3CCE 1;  3CCJ Z;  3CCV Z;  2E9H A;  5D1O A;  3GKQ A;  2F4O A;  2RBL A;  2H85 A;  3FKI I;  2OOX B;  4DGL A;  5A2Q b;  1USP B;  2QEX 1;  1VQK 1;  3S17 I;  2KPI A;  3CCS Z;  3D6W A;  2OTL Z;  3S2D I;  2GTI A;  2M6N A;  4RVF A;  3CXC Z;  2OTJ 1;  3GCF A;  1RO0 A;  4NH1 C;  2R7Z I;  1VQ4 Z;  3J7A 4;  5CM2 M;  3S2H I;  1VQ7 1;  3CXC Y;  2IZ4 A;  3NH4 A;  1Q82 2;  3VMG A;  1K73 1;  2E2I I;  2E2J I;  3Q87 A;  3CC2 Z;  1M1K 2;  4QTT A;  4NBB A;  1S7M A;  2J6A A;  1R9T I;  2RPR A;  1VLA A;  3CCL Z;  1WCM I;  3H0G I;  2RT9 A;  1ML8 A;  2R6M A;  3M3Y I;  1USP A;  2O4H A;  3NH5 A;  3CCR 1;  4BY1 I;  1RNI A;  1VQP Z;  3FQQ A;  2P28 A;  3I56 1;  3NDI A;  2I3C A;  3G6E Z;  3KIF A;  4XX2 A;  4Y52 I;  3H3V J;  1YJN Z;  2JA7 I;  3TE5 B;  4CL1 A;  3PO3 S;  1YUK A;  1TFI A;  3EED A;  2EGT A;  1Q7Y 1;  3VMI A;  2M48 A;  2HF1 A;  4RV9 A;  1ZB9 A;  3J80 f;  1Y1W I;  1YHQ 1;  4MD8 A;  2IZ3 A;  1X3Z A;  2K3R A;  1Q82 1;  1Q86 2;  4E33 A;  1M1K 1;  3CME 1;  1I6H I;  4A3G I;  3CCE Z;  3HOZ I;  3PO3 I;  4NBF A;  3S1Q I;  4MON A;  3J80 b;  3GTG I;  2AKL A;  2O53 A;  2RIQ A;  3J81 b;  3LUS A;  2K5R A;  3JAM f;  1I3Q I;  2JR6 A;  3M4O I;  3GTM S;  3G71 1;  3MZL B;  1VQ9 Z;  2OTJ Z;  1Z01 A;  3S16 I;  3I55 1;  2R92 I;  1K83 I;  1RQF A;  4E2W A;  3S14 I;  2VF1 A;  3GTJ I;  5AN9 F;  1YIJ 1;  4A93 I;  2HU9 A;  1RO4 A;  3CMA Z;  3GTM I;  1P9N A;  3CD6 1;  1Q86 1;  4RVG A;  2R93 I;  3NH8 A;  4A3J I;  1TWC I;  3CCU 1;  5T67 A;  5FLM I;  3GTO I;  5C44 I;  4A3M I;  1X0T A;  3QWU A;  4X6A I;  4RS4 A;  3F3F C;  2JS4 A;  2Q4Z A;  4A3C I;  3CC4 Z;  1K9M 2;  3KIH A;  3CC7 1;  1VQ6 Z;  3I56 Z;  3EER A;  4DQY B;  2P3Y A;  4QTU A;  1VQM 1;  1YIT Z;  3TDH B;  1VQN Z;  4RVH A;  4A3L I;  1YUA A;  1YJW Z;  1SFO I;  2PK7 A;  2VUM I;  2QA4 Z;  3CPW Z;  3MON A;  4HGZ A;  3CCV 1;  5T64 A;  1ZB8 A;  3D9X A;  2DE5 A;  2B63 I;  3FQM A;  3I4N I;  4HH4 A;  1KQS Z;  3CPW Y;  2F4M A;  4S1T A;  1NJI 2;  2KI7 B;  2QR1 B;  3NFZ A;  3I07 A;  1WII A;  1KQS Y;  1L1O C;  1PFT A;  3BG1 B;  2WB1 A;  5IP9 I;  1K9M 1;  1YI2 Z;  4MH4 A;  1VQ8 1;  1VQ4 1;  3J81 f;  3CCM Z;  4HGY A;  2VUG A;  3VMH A;  4E2X A;  3I55 Z;  1S72 1;  3MZK B;  2JA6 I;  4A3F I;  4TNU A;  2NVX I;  2JNY A;  3CD6 Z;  2QEX Z;  1W2B Z;  1VQK Z;  2V8K A;  2WAQ A;  5T6B A;  4E2Y A;  1VQ5 1;  3HOV I;  4A3I I;  3NDJ A;  1W2B Y;  3GTQ I;  3G4S 1;  3ESW A;  4A3E I;  1NJI 1;  3RZO I;  4MD9 A;  3CC7 Z;  2Y0S A;  3VB9 A;  2JA5 I;  3IX0 A;  1YJN 1;  3CCQ 1;  2JUB A;  1VQ7 Z;  1QYP A;  2LFU A;  1WW9 A;  1VQL 1;  1LQL A;  1VQO 1;  4NBE A;  2DE6 A;  3HKZ A;  4A3D I;  1KC8 2;  1DL6 A;  4A3K I;  1Y1V S;  3CQZ I;  5C3E I;  4NBA A;  1N2F A;  4BXX I;  1NUI A;  1N8R 2;  2NVQ I;  3S15 I;  3CCR Z;  4A3B I;  1KRL A;  1TWF I;  1Q7Y 2;  1QVG Z;  2QRE B;  4E2Z A;  4NB8 A;  5D1P A;  1RO2 A;  1Y1V I;  3P5J B;  3PO2 I;  4NBH A;  1QVG Y;  3S1N I;  1X3W A;  3GTL I;  4AYB A;  4MXU A;  4E31 A;  1VQ9 1;  4E30 A;  2OOY B;  1YJ9 1;  1YHQ Z;  1VQ8 Z;  1KD1 2;  1TWA I;  2JA8 I;  3CCJ 1;  3CME Z;  2OZK A;  1S72 Z;  2YU9 I;  1M90 2;  1KC8 1;  2V8I A;  4NBG A;  2DE7 A;  1I50 I;  4Y7N I;  3HOX I;  3CMA 1;  3CCS 1;  1Q81 2;  5C4X I;  1JWH C;  1QF8 A;  4NOZ A;  2LIY A;  1N8R 1;  2BJO A;  2OTL 1;  3F3P C;  1VQ5 Z;  2W03 A;  3S1R I;  5C4J I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...