3FKII

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fkiI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3fkiI02
3Q87A 1SFOI 4BY7I 2NVQI 5FLMI 4Y52I 4NBBA 2F4MA 4BBRI 3I4MI 2E2JI 2P3YA 1N2FA 4A3LI 1RO4A 2K5RA 1X3WA 3PO2I 4A3GI 4NB9A 4A93I 4NBHA 3LUSA 1WCMI 1PFTA 3I07A 3GTKI 1TWHI 5IP7I 1TWCI 2F4OA 4NBDA 1YUAA 4NBFA 3GTGI 3RZOI 4A3II 3PO3S 2E2II 2BJOA 1NUIA 3HOUI 3HOWI 2RBLA 1USPB 3GTOI 3S1MI 3U50C 2NVTI 2J6AA 1I50I 3HOZI 1LQLA 2JR6A 5C4JI 2DE6A 1QYPA 5C4XI 1ML8A 3S1QI 5CM2M 2JNYA 1L1OC 1VLAA 3GKQA 3M4OI 3VMHA 3S1RI 3VB9A 3K7AI 5C3EI 4A3MI 4NBEA 3GCFA 3HOXI 3GTJI 2JS4A 3H3VJ 2R7ZI 1TWFI 4A3CI 2PK7A 1I6HI 1Y1WI 2DE5A 3S14I 3GTLI 5C44I 2HF1A 4XX2A 1ZB8A 4NBGA 2JA7I 3S16I 1WW9A 1R9TI 1Y1VI 3H0GI 4X6AI 2YU9I 3S15I 3RZDI 3VMIA 3HOYI 2NVYI 1RLYA 3D6WA 4A3DI 1I3QI 2JA6I 1DL6A 3GTMI 3M3YI 3I4NI 3FKII 4Y7NI 3GTMS 4QTUA 4MH4A 3EERA 4BBSI 3VMGA 3S1NI 1USPA 2NVXI 1ZB9A 1K83I 1TWGI 4A3KI 3GTPI 1TWAI 3S17I 2JA5I 2DE7A 2KPIA 4NBAA 4A3JI 2E2HI 2JA8I 1Y1VS 5IP9I 2AKLA 1X3ZA 1TFIA 4BXXI 3GTQI 4NB8A 4QTTA 4A3EI 3ESWA 3CQZI 3PO3I 2B63I 4BY1I 3S2DI 3HOVI 2R93I 4NBCA 2VUMI 4A3BI 3S2HI 4NOZA 4A3FI 2R92I
chains in the Genus database with same CATH superfamily
1Z03A 2NVQI 2PM9A 3QWUA 5FLMI 2K5RA 1X3WA 2JUBA 1VQN1 4NB9A 3BG0B 2RPRA 3FQQA 1Z02A 3I07A 2RHBA 3KIHA 4NBDA 1K732 5D1PA 2RIQA 3JAMf 1VQ81 3HOUI 1YUKA 2QREB 3U50C 2O4HA 1LQLA 1YIT1 2JMOA 2VPXA 3EEDA 5CM2M 2JIMA 3G711 3GKQA 1YJNZ 2M48A 1Q16A 4HH4A 5IT9f 2RT9A 5C3EI 5LL6f 3GTJI 1Q812 2R7ZI 3CPWZ 3G6E1 3J80f 4NBGA 2JA7I 3J80b 3S16I 1M902 2W04A 1VQ5Z 3H0GI 1KQSZ 3CPWY 3CMAZ 2Q4ZA 2QEX1 2WAQA 1RO0A 2JIOA 2VPYA 1N8R1 2LFUA 2H85A 1KQSY 1YI2Z 4QTUA 2VPZA 4MH4A 3CCMZ 3P5JB 1RQFA 3CCLZ 1M1K1 3IX0A 1VQ41 1K8A1 1K83I 4MD9A 1TWGI 1QVGZ 2KI7B 1TWAI 3CCV1 2DE7A 4NH1C 2IV2X 1Y1VS 3T4NB 2OTL1 4A3EI 3CXCZ 3D9XA 3PO3I 3CCJ1 2B63I 1QVGY 3J81b 4E2YA 4A3BI 4NOZA 1VQP1 3CXCY 1S7MA 3G71Z 1Q7Y2 1VQ71 2E2JI 2P3YA 1N2FA 1VQLZ 3CCR1 4DGLA 2HU9A 1JJ2Z 2OOXB 2LIYA 1VQ91 1K9M2 1TWCI 3MONA 3G4S1 1YUAA 1QXFA 4A3II 2E2II 2EGTA 3GTOI 2QEXZ 1VQMZ 1JJ2Y 1W2BZ 2NVTI 3FQMA 1I50I 3MZLB 4DQYB 3KIFA 1K731 5T64A 5C4JI 1YHQZ 3CMEZ 1QYPA 1ML8A 3CC41 1VLAA 1NJI2 3M4OI 3I56Z 1W2BY 3S1RI 2R6MA 3K7AI 3CC2Z 2JS4A 4RVFA 2IZ3A 1VQOZ 1Y1WI 3IR7A 2DE5A 3CCU1 3JAMb 2OTLZ 1QVFZ 1X0TA 1R9TI 3RZDI 3NDIA 2JIPA 3VMIA 2QA41 2NVYI 2QKDA 3D6WA 4A3DI 1I3QI 1QVFY 3M3YI 4E2XA 3FKII 1VQ7Z 1Q822 3VTNA 5IT9b 3EERA 1VQKZ 3CCQ1 4BBSI 3S1NI 2OTJZ 1ZB9A 2WB1A 1YJ91 3NFZA 4A3KI 3GTPI 2E2HI 1TFIA 2Q51A 4NB8A 5T6BA 3I551 2AYDA 3IF8A 2V3VA 1YIJ1 2OZKA 1VQ61 2JIQA 1Y8CA 2IZ4A 2QLVB 3CCE1 3F3FC 4A3FI 1SFOI 4BY7I 4Y52I 1VQNZ 3CD61 1YJW1 1KC82 1Q861 2LEXA 1P9NA 2QRDB 4MD7A 2NAPA 4A93I 1Q7Y1 3LUSA 1VQ8Z 1WCMI 3GTKI 1TWHI 4MONA 4RS4A 4NBFA 3RZOI 3CC71 5T67A 1NUIA 1YITZ 1USPB 3S1MI 3F3PC 1S721 4E2ZA 4E31A 2VUGA 4S1TA 2VPWA 4E30A 2JR6A 2DE6A 1WIIA 1KD11 2QR1B 2P28A 1M1K2 3CCQZ 3VB9A 3G6EZ 1K8A2 4EWCA 1YJN1 1WZNA 1TWFI 4A3CI 2PK7A 1I6HI 1SIWA 3HKZA 3GTLI 4XX2A 1ZB8A 3NH8A 1WW9A 1Y1VI 4X6AI 2YU9I 1YIJZ 4MRIA 2ZAEB 5A2Qf 3CMA1 4TNUA 2JA6I 3TE5B 3GTMI 5FLXf 1KRLA 2E9HA 4Y7NI 1VQ4Z 3VMGA 4DK1A 3D2LA 3CCVZ 2JIRA 1USPA 1YI21 3CCM1 3CCS1 1Q811 1Q821 3S17I 2GU2A 2KPIA 4MD8A 4NBAA 3CCJZ 3CCL1 2JA8I 2PMZA 5IP9I 2AKLA 1X3ZA 2G2KA 4CL1A 3CC7Z 4RVDA 4BXXI 3GTQI 5AN9F 3TDHB 1VQPZ 1S72Z 1M901 2VF1A 3HOVI 4NBCA 3OW2Z 2VUMI 3Q87A 3CCRZ 4NBBA 1Z01A 2F4MA 4BBRI 3I4MI 3OW2Y 2V45A 4A3LI 1RO4A 3NDJA 1VQ9Z 1RNIA 3BG1B 3PO2I 4A3GI 3G4SZ 5D1OB 4NBHA 1KC81 2K3RA 1PFTA 2M6NA 1VQL1 5IP7I 2F4OA 4RVHA 3GTGI 3PO3S 2W03A 2O53A 2BJOA 3HOWI 2RBLA 4HGZA 2E7ZA 3CC4Z 2J6AA 3HOZI 4NFRA 1RO2A 5C4XI 1VQM1 3S1QI 2GTIA 2JNYA 1L1OC 2YADA 1ZH1A 3VMHA 1YHQ1 4AYBA 1WJ2A 3CME1 4A3MI 1FDIA 3GCFA 4NBEA 3CCUZ 3HOXI 3H3VJ 3I561 4E33A 2QRCB 3CCSZ 3J7A4 3S14I 2OOYB 5C44I 3IFUA 3CC21 2HF1A 4RV9A 2QA4Z 1VQO1 1N8R2 1K9M1 1QF8A 3S15I 3NH5A 3HOYI 2V8IA 3J81f 1RLYA 4HGYA 5D1OA 2Y0SA 1DL6A 1NP6A 3MZKB 1FDOA 1Q862 3I4NI 2GTHA 2V8JA 4RVGA 3GTMS 1YJ9Z 4MXUA 1NJI1 3NH4A 2NVXI 1VQK1 1JWHC 2OTJ1 4E2WA 3I55Z 2JA5I 2V8KA 4E32A 4A3JI 1VQ6Z 2I3CA 1AA6A 3CCEZ 4QTTA 3ESWA 1VQ51 3CQZI 4BY1I 3S2DI 5A2Qb 2R93I 1KD12 3CD6Z 3S2HI 1YJWZ 5FLXb 2R92I
chains in the Genus database with same CATH topology
1Z03A 2NVQI 2PM9A 3QWUA 5FLMI 2K5RA 1X3WA 2JUBA 1VQN1 4NB9A 3BG0B 2RPRA 3FQQA 1Z02A 3I07A 2RHBA 3KIHA 4NBDA 1K732 5D1PA 2RIQA 3JAMf 1VQ81 3HOUI 1YUKA 2QREB 3U50C 2O4HA 1LQLA 1YIT1 2JMOA 3EEDA 5CM2M 3G711 3GKQA 1YJNZ 2M48A 4HH4A 5IT9f 2RT9A 5C3EI 5LL6f 3GTJI 1Q812 2R7ZI 3CPWZ 3G6E1 3J80f 4NBGA 2JA7I 3J80b 3S16I 1M902 2W04A 1VQ5Z 3H0GI 1KQSZ 3CPWY 3CMAZ 2Q4ZA 2QEX1 2WAQA 1RO0A 1N8R1 2LFUA 2H85A 1KQSY 1YI2Z 4QTUA 4MH4A 3CCMZ 3P5JB 1RQFA 3CCLZ 1M1K1 3IX0A 1VQ41 1K8A1 1K83I 4MD9A 1TWGI 1QVGZ 2KI7B 1TWAI 3CCV1 2DE7A 4NH1C 1Y1VS 3T4NB 2OTL1 4A3EI 3CXCZ 3D9XA 3PO3I 3CCJ1 2B63I 1QVGY 3J81b 4E2YA 4A3BI 4NOZA 1VQP1 3CXCY 1S7MA 3G71Z 1Q7Y2 1VQ71 2E2JI 2P3YA 1N2FA 1VQLZ 3CCR1 4DGLA 2HU9A 1JJ2Z 2OOXB 2LIYA 1VQ91 1K9M2 1TWCI 3MONA 3G4S1 1YUAA 4A3II 2E2II 2EGTA 3GTOI 2QEXZ 1VQMZ 1JJ2Y 1W2BZ 2NVTI 3FQMA 1I50I 3MZLB 4DQYB 3KIFA 1K731 5T64A 5C4JI 1YHQZ 3CMEZ 1QYPA 1ML8A 3CC41 1VLAA 1NJI2 3M4OI 3I56Z 1W2BY 3S1RI 2R6MA 3K7AI 3CC2Z 2JS4A 4RVFA 2IZ3A 1VQOZ 1Y1WI 2DE5A 3CCU1 3JAMb 2OTLZ 1QVFZ 1X0TA 1R9TI 3RZDI 3NDIA 3VMIA 2QA41 2NVYI 2QKDA 3D6WA 4A3DI 1I3QI 1QVFY 3M3YI 4E2XA 3FKII 1VQ7Z 1Q822 3VTNA 5IT9b 3EERA 1VQKZ 3CCQ1 4BBSI 3S1NI 2OTJZ 1ZB9A 2WB1A 1YJ91 3NFZA 4A3KI 3GTPI 2E2HI 1TFIA 2Q51A 4NB8A 5T6BA 3I551 3IF8A 1YIJ1 2OZKA 1VQ61 2IZ4A 2QLVB 3CCE1 3F3FC 4A3FI 1SFOI 4BY7I 4Y52I 1VQNZ 3CD61 1YJW1 1KC82 1Q861 1P9NA 2QRDB 4MD7A 4A93I 1Q7Y1 3LUSA 1VQ8Z 1WCMI 3GTKI 1TWHI 4MONA 4RS4A 4NBFA 3RZOI 3CC71 5T67A 1NUIA 1YITZ 1USPB 3S1MI 3F3PC 1S721 4E2ZA 4E31A 2VUGA 4S1TA 4E30A 2JR6A 2DE6A 1WIIA 1KD11 2QR1B 2P28A 1M1K2 3CCQZ 3VB9A 3G6EZ 1K8A2 4EWCA 1YJN1 1TWFI 4A3CI 2PK7A 1I6HI 3HKZA 3GTLI 4XX2A 1ZB8A 3NH8A 1WW9A 1Y1VI 4X6AI 2YU9I 1YIJZ 4MRIA 2ZAEB 5A2Qf 3CMA1 4TNUA 2JA6I 3TE5B 3GTMI 5FLXf 1KRLA 2E9HA 4Y7NI 1VQ4Z 3VMGA 4DK1A 3CCVZ 1USPA 1YI21 3CCM1 3CCS1 1Q811 1Q821 3S17I 2GU2A 2KPIA 4MD8A 4NBAA 3CCJZ 3CCL1 2JA8I 2PMZA 5IP9I 2AKLA 1X3ZA 2G2KA 4CL1A 3CC7Z 4RVDA 4BXXI 3GTQI 5AN9F 3TDHB 1VQPZ 1S72Z 1M901 2VF1A 3HOVI 4NBCA 3OW2Z 2VUMI 3Q87A 3CCRZ 4NBBA 1Z01A 2F4MA 4BBRI 3I4MI 3OW2Y 4A3LI 1RO4A 3NDJA 1VQ9Z 1RNIA 3BG1B 3PO2I 4A3GI 3G4SZ 5D1OB 4NBHA 1KC81 2K3RA 1PFTA 2M6NA 1VQL1 5IP7I 2F4OA 4RVHA 3GTGI 3PO3S 2W03A 2O53A 2BJOA 3HOWI 2RBLA 4HGZA 3CC4Z 2J6AA 3HOZI 4NFRA 1RO2A 5C4XI 1VQM1 3S1QI 2GTIA 2JNYA 1L1OC 2YADA 1ZH1A 3VMHA 1YHQ1 4AYBA 3CME1 4A3MI 4NBEA 3GCFA 3CCUZ 3HOXI 3H3VJ 3I561 4E33A 2QRCB 3CCSZ 3J7A4 3S14I 2OOYB 5C44I 3IFUA 3CC21 2HF1A 4RV9A 2QA4Z 1VQO1 1N8R2 1K9M1 1QF8A 3S15I 3NH5A 3HOYI 2V8IA 3J81f 1RLYA 4HGYA 5D1OA 2Y0SA 1DL6A 1NP6A 3MZKB 1Q862 3I4NI 2GTHA 2V8JA 4RVGA 3GTMS 1YJ9Z 4MXUA 1NJI1 3NH4A 2NVXI 1VQK1 1JWHC 2OTJ1 4E2WA 3I55Z 2JA5I 2V8KA 4E32A 4A3JI 1VQ6Z 2I3CA 3CCEZ 4QTTA 3ESWA 1VQ51 3CQZI 4BY1I 3S2DI 5A2Qb 2R93I 1KD12 3CD6Z 3S2HI 1YJWZ 5FLXb 2R92I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q87 A;  1SFO I;  4BY7 I;  2NVQ I;  5FLM I;  4Y52 I;  4NBB A;  2F4M A;  4BBR I;  3I4M I;  2E2J I;  2P3Y A;  1N2F A;  4A3L I;  1RO4 A;  2K5R A;  1X3W A;  3PO2 I;  4A3G I;  4NB9 A;  4A93 I;  4NBH A;  3LUS A;  1WCM I;  1PFT A;  3I07 A;  3GTK I;  1TWH I;  5IP7 I;  1TWC I;  2F4O A;  4NBD A;  1YUA A;  4NBF A;  3GTG I;  3RZO I;  4A3I I;  3PO3 S;  2E2I I;  2BJO A;  1NUI A;  3HOU I;  3HOW I;  2RBL A;  1USP B;  3GTO I;  3S1M I;  3U50 C;  2NVT I;  2J6A A;  1I50 I;  3HOZ I;  1LQL A;  2JR6 A;  5C4J I;  2DE6 A;  1QYP A;  5C4X I;  1ML8 A;  3S1Q I;  5CM2 M;  2JNY A;  1L1O C;  1VLA A;  3GKQ A;  3M4O I;  3VMH A;  3S1R I;  3VB9 A;  3K7A I;  5C3E I;  4A3M I;  4NBE A;  3GCF A;  3HOX I;  3GTJ I;  2JS4 A;  3H3V J;  2R7Z I;  1TWF I;  4A3C I;  2PK7 A;  1I6H I;  1Y1W I;  2DE5 A;  3S14 I;  3GTL I;  5C44 I;  2HF1 A;  4XX2 A;  1ZB8 A;  4NBG A;  2JA7 I;  3S16 I;  1WW9 A;  1R9T I;  1Y1V I;  3H0G I;  4X6A I;  2YU9 I;  3S15 I;  3RZD I;  3VMI A;  3HOY I;  2NVY I;  1RLY A;  3D6W A;  4A3D I;  1I3Q I;  2JA6 I;  1DL6 A;  3GTM I;  3M3Y I;  3I4N I;  3FKI I;  4Y7N I;  3GTM S;  4QTU A;  4MH4 A;  3EER A;  4BBS I;  3VMG A;  3S1N I;  1USP A;  2NVX I;  1ZB9 A;  1K83 I;  1TWG I;  4A3K I;  3GTP I;  1TWA I;  3S17 I;  2JA5 I;  2DE7 A;  2KPI A;  4NBA A;  4A3J I;  2E2H I;  2JA8 I;  1Y1V S;  5IP9 I;  2AKL A;  1X3Z A;  1TFI A;  4BXX I;  3GTQ I;  4NB8 A;  4QTT A;  4A3E I;  3ESW A;  3CQZ I;  3PO3 I;  2B63 I;  4BY1 I;  3S2D I;  3HOV I;  2R93 I;  4NBC A;  2VUM I;  4A3B I;  3S2H I;  4NOZ A;  4A3F I;  2R92 I; 
#chains in the Genus database with same CATH topology
 1Z03 A;  2NVQ I;  2PM9 A;  3QWU A;  5FLM I;  2K5R A;  1X3W A;  2JUB A;  1VQN 1;  4NB9 A;  3BG0 B;  2RPR A;  3FQQ A;  1Z02 A;  3I07 A;  2RHB A;  3KIH A;  4NBD A;  1K73 2;  5D1P A;  2RIQ A;  3JAM f;  1VQ8 1;  3HOU I;  1YUK A;  2QRE B;  3U50 C;  2O4H A;  1LQL A;  1YIT 1;  2JMO A;  2VPX A;  3EED A;  5CM2 M;  2JIM A;  3G71 1;  3GKQ A;  1YJN Z;  2M48 A;  1Q16 A;  4HH4 A;  5IT9 f;  2RT9 A;  5C3E I;  5LL6 f;  3GTJ I;  1Q81 2;  2R7Z I;  3CPW Z;  3G6E 1;  3J80 f;  4NBG A;  2JA7 I;  3J80 b;  3S16 I;  1M90 2;  2W04 A;  1VQ5 Z;  3H0G I;  1KQS Z;  3CPW Y;  3CMA Z;  2Q4Z A;  2QEX 1;  2WAQ A;  1RO0 A;  2JIO A;  2VPY A;  1N8R 1;  2LFU A;  2H85 A;  1KQS Y;  1YI2 Z;  4QTU A;  2VPZ A;  4MH4 A;  3CCM Z;  3P5J B;  1RQF A;  3CCL Z;  1M1K 1;  3IX0 A;  1VQ4 1;  1K8A 1;  1K83 I;  4MD9 A;  1TWG I;  1QVG Z;  2KI7 B;  1TWA I;  3CCV 1;  2DE7 A;  4NH1 C;  2IV2 X;  1Y1V S;  3T4N B;  2OTL 1;  4A3E I;  3CXC Z;  3D9X A;  3PO3 I;  3CCJ 1;  2B63 I;  1QVG Y;  3J81 b;  4E2Y A;  4A3B I;  4NOZ A;  1VQP 1;  3CXC Y;  1S7M A;  3G71 Z;  1Q7Y 2;  1VQ7 1;  2E2J I;  2P3Y A;  1N2F A;  1VQL Z;  3CCR 1;  4DGL A;  2HU9 A;  1JJ2 Z;  2OOX B;  2LIY A;  1VQ9 1;  1K9M 2;  1TWC I;  3MON A;  3G4S 1;  1YUA A;  1QXF A;  4A3I I;  2E2I I;  2EGT A;  3GTO I;  2QEX Z;  1VQM Z;  1JJ2 Y;  1W2B Z;  2NVT I;  3FQM A;  1I50 I;  3MZL B;  4DQY B;  3KIF A;  1K73 1;  5T64 A;  5C4J I;  1YHQ Z;  3CME Z;  1QYP A;  1ML8 A;  3CC4 1;  1VLA A;  1NJI 2;  3M4O I;  3I56 Z;  1W2B Y;  3S1R I;  2R6M A;  3K7A I;  3CC2 Z;  2JS4 A;  4RVF A;  2IZ3 A;  1VQO Z;  1Y1W I;  3IR7 A;  2DE5 A;  3CCU 1;  3JAM b;  2OTL Z;  1QVF Z;  1X0T A;  1R9T I;  3RZD I;  3NDI A;  2JIP A;  3VMI A;  2QA4 1;  2NVY I;  2QKD A;  3D6W A;  4A3D I;  1I3Q I;  1QVF Y;  3M3Y I;  4E2X A;  3FKI I;  1VQ7 Z;  1Q82 2;  3VTN A;  5IT9 b;  3EER A;  1VQK Z;  3CCQ 1;  4BBS I;  3S1N I;  2OTJ Z;  1ZB9 A;  2WB1 A;  1YJ9 1;  3NFZ A;  4A3K I;  3GTP I;  2E2H I;  1TFI A;  2Q51 A;  4NB8 A;  5T6B A;  3I55 1;  2AYD A;  3IF8 A;  2V3V A;  1YIJ 1;  2OZK A;  1VQ6 1;  2JIQ A;  1Y8C A;  2IZ4 A;  2QLV B;  3CCE 1;  3F3F C;  4A3F I;  1SFO I;  4BY7 I;  4Y52 I;  1VQN Z;  3CD6 1;  1YJW 1;  1KC8 2;  1Q86 1;  2LEX A;  1P9N A;  2QRD B;  4MD7 A;  2NAP A;  4A93 I;  1Q7Y 1;  3LUS A;  1VQ8 Z;  1WCM I;  3GTK I;  1TWH I;  4MON A;  4RS4 A;  4NBF A;  3RZO I;  3CC7 1;  5T67 A;  1NUI A;  1YIT Z;  1USP B;  3S1M I;  3F3P C;  1S72 1;  4E2Z A;  4E31 A;  2VUG A;  4S1T A;  2VPW A;  4E30 A;  2JR6 A;  2DE6 A;  1WII A;  1KD1 1;  2QR1 B;  2P28 A;  1M1K 2;  3CCQ Z;  3VB9 A;  3G6E Z;  1K8A 2;  4EWC A;  1YJN 1;  1WZN A;  1TWF I;  4A3C I;  2PK7 A;  1I6H I;  1SIW A;  3HKZ A;  3GTL I;  4XX2 A;  1ZB8 A;  3NH8 A;  1WW9 A;  1Y1V I;  4X6A I;  2YU9 I;  1YIJ Z;  4MRI A;  2ZAE B;  5A2Q f;  3CMA 1;  4TNU A;  2JA6 I;  3TE5 B;  3GTM I;  5FLX f;  1KRL A;  2E9H A;  4Y7N I;  1VQ4 Z;  3VMG A;  4DK1 A;  3D2L A;  3CCV Z;  2JIR A;  1USP A;  1YI2 1;  3CCM 1;  3CCS 1;  1Q81 1;  1Q82 1;  3S17 I;  2GU2 A;  2KPI A;  4MD8 A;  4NBA A;  3CCJ Z;  3CCL 1;  2JA8 I;  2PMZ A;  5IP9 I;  2AKL A;  1X3Z A;  2G2K A;  4CL1 A;  3CC7 Z;  4RVD A;  4BXX I;  3GTQ I;  5AN9 F;  3TDH B;  1VQP Z;  1S72 Z;  1M90 1;  2VF1 A;  3HOV I;  4NBC A;  3OW2 Z;  2VUM I;  3Q87 A;  3CCR Z;  4NBB A;  1Z01 A;  2F4M A;  4BBR I;  3I4M I;  3OW2 Y;  2V45 A;  4A3L I;  1RO4 A;  3NDJ A;  1VQ9 Z;  1RNI A;  3BG1 B;  3PO2 I;  4A3G I;  3G4S Z;  5D1O B;  4NBH A;  1KC8 1;  2K3R A;  1PFT A;  2M6N A;  1VQL 1;  5IP7 I;  2F4O A;  4RVH A;  3GTG I;  3PO3 S;  2W03 A;  2O53 A;  2BJO A;  3HOW I;  2RBL A;  4HGZ A;  2E7Z A;  3CC4 Z;  2J6A A;  3HOZ I;  4NFR A;  1RO2 A;  5C4X I;  1VQM 1;  3S1Q I;  2GTI A;  2JNY A;  1L1O C;  2YAD A;  1ZH1 A;  3VMH A;  1YHQ 1;  4AYB A;  1WJ2 A;  3CME 1;  4A3M I;  1FDI A;  3GCF A;  4NBE A;  3CCU Z;  3HOX I;  3H3V J;  3I56 1;  4E33 A;  2QRC B;  3CCS Z;  3J7A 4;  3S14 I;  2OOY B;  5C44 I;  3IFU A;  3CC2 1;  2HF1 A;  4RV9 A;  2QA4 Z;  1VQO 1;  1N8R 2;  1K9M 1;  1QF8 A;  3S15 I;  3NH5 A;  3HOY I;  2V8I A;  3J81 f;  1RLY A;  4HGY A;  5D1O A;  2Y0S A;  1DL6 A;  1NP6 A;  3MZK B;  1FDO A;  1Q86 2;  3I4N I;  2GTH A;  2V8J A;  4RVG A;  3GTM S;  1YJ9 Z;  4MXU A;  1NJI 1;  3NH4 A;  2NVX I;  1VQK 1;  1JWH C;  2OTJ 1;  4E2W A;  3I55 Z;  2JA5 I;  2V8K A;  4E32 A;  4A3J I;  1VQ6 Z;  2I3C A;  1AA6 A;  3CCE Z;  4QTT A;  3ESW A;  1VQ5 1;  3CQZ I;  4BY1 I;  3S2D I;  5A2Q b;  2R93 I;  1KD1 2;  3CD6 Z;  3S2H I;  1YJW Z;  5FLX b;  2R92 I; 
#chains in the Genus database with same CATH homology
 1Z03 A;  2NVQ I;  2PM9 A;  3QWU A;  5FLM I;  2K5R A;  1X3W A;  2JUB A;  1VQN 1;  4NB9 A;  3BG0 B;  2RPR A;  3FQQ A;  1Z02 A;  3I07 A;  2RHB A;  3KIH A;  4NBD A;  1K73 2;  5D1P A;  2RIQ A;  3JAM f;  1VQ8 1;  3HOU I;  1YUK A;  2QRE B;  3U50 C;  2O4H A;  1LQL A;  1YIT 1;  2JMO A;  3EED A;  5CM2 M;  3G71 1;  3GKQ A;  1YJN Z;  2M48 A;  4HH4 A;  5IT9 f;  2RT9 A;  5C3E I;  5LL6 f;  3GTJ I;  1Q81 2;  2R7Z I;  3CPW Z;  3G6E 1;  3J80 f;  4NBG A;  2JA7 I;  3J80 b;  3S16 I;  1M90 2;  2W04 A;  1VQ5 Z;  3H0G I;  1KQS Z;  3CPW Y;  3CMA Z;  2Q4Z A;  2QEX 1;  2WAQ A;  1RO0 A;  1N8R 1;  2LFU A;  2H85 A;  1KQS Y;  1YI2 Z;  4QTU A;  4MH4 A;  3CCM Z;  3P5J B;  1RQF A;  3CCL Z;  1M1K 1;  3IX0 A;  1VQ4 1;  1K8A 1;  1K83 I;  4MD9 A;  1TWG I;  1QVG Z;  2KI7 B;  1TWA I;  3CCV 1;  2DE7 A;  4NH1 C;  1Y1V S;  3T4N B;  2OTL 1;  4A3E I;  3CXC Z;  3D9X A;  3PO3 I;  3CCJ 1;  2B63 I;  1QVG Y;  3J81 b;  4E2Y A;  4A3B I;  4NOZ A;  1VQP 1;  3CXC Y;  1S7M A;  3G71 Z;  1Q7Y 2;  1VQ7 1;  2E2J I;  2P3Y A;  1N2F A;  1VQL Z;  3CCR 1;  4DGL A;  2HU9 A;  1JJ2 Z;  2OOX B;  2LIY A;  1VQ9 1;  1K9M 2;  1TWC I;  3MON A;  3G4S 1;  1YUA A;  4A3I I;  2E2I I;  2EGT A;  3GTO I;  2QEX Z;  1VQM Z;  1JJ2 Y;  1W2B Z;  2NVT I;  3FQM A;  1I50 I;  3MZL B;  4DQY B;  3KIF A;  1K73 1;  5T64 A;  5C4J I;  1YHQ Z;  3CME Z;  1QYP A;  1ML8 A;  3CC4 1;  1VLA A;  1NJI 2;  3M4O I;  3I56 Z;  1W2B Y;  3S1R I;  2R6M A;  3K7A I;  3CC2 Z;  2JS4 A;  4RVF A;  2IZ3 A;  1VQO Z;  1Y1W I;  2DE5 A;  3CCU 1;  3JAM b;  2OTL Z;  1QVF Z;  1X0T A;  1R9T I;  3RZD I;  3NDI A;  3VMI A;  2QA4 1;  2NVY I;  2QKD A;  3D6W A;  4A3D I;  1I3Q I;  1QVF Y;  3M3Y I;  4E2X A;  3FKI I;  1VQ7 Z;  1Q82 2;  3VTN A;  5IT9 b;  3EER A;  1VQK Z;  3CCQ 1;  4BBS I;  3S1N I;  2OTJ Z;  1ZB9 A;  2WB1 A;  1YJ9 1;  3NFZ A;  4A3K I;  3GTP I;  2E2H I;  1TFI A;  2Q51 A;  4NB8 A;  5T6B A;  3I55 1;  3IF8 A;  1YIJ 1;  2OZK A;  1VQ6 1;  2IZ4 A;  2QLV B;  3CCE 1;  3F3F C;  4A3F I;  1SFO I;  4BY7 I;  4Y52 I;  1VQN Z;  3CD6 1;  1YJW 1;  1KC8 2;  1Q86 1;  1P9N A;  2QRD B;  4MD7 A;  4A93 I;  1Q7Y 1;  3LUS A;  1VQ8 Z;  1WCM I;  3GTK I;  1TWH I;  4MON A;  4RS4 A;  4NBF A;  3RZO I;  3CC7 1;  5T67 A;  1NUI A;  1YIT Z;  1USP B;  3S1M I;  3F3P C;  1S72 1;  4E2Z A;  4E31 A;  2VUG A;  4S1T A;  4E30 A;  2JR6 A;  2DE6 A;  1WII A;  1KD1 1;  2QR1 B;  2P28 A;  1M1K 2;  3CCQ Z;  3VB9 A;  3G6E Z;  1K8A 2;  4EWC A;  1YJN 1;  1TWF I;  4A3C I;  2PK7 A;  1I6H I;  3HKZ A;  3GTL I;  4XX2 A;  1ZB8 A;  3NH8 A;  1WW9 A;  1Y1V I;  4X6A I;  2YU9 I;  1YIJ Z;  4MRI A;  2ZAE B;  5A2Q f;  3CMA 1;  4TNU A;  2JA6 I;  3TE5 B;  3GTM I;  5FLX f;  1KRL A;  2E9H A;  4Y7N I;  1VQ4 Z;  3VMG A;  4DK1 A;  3CCV Z;  1USP A;  1YI2 1;  3CCM 1;  3CCS 1;  1Q81 1;  1Q82 1;  3S17 I;  2GU2 A;  2KPI A;  4MD8 A;  4NBA A;  3CCJ Z;  3CCL 1;  2JA8 I;  2PMZ A;  5IP9 I;  2AKL A;  1X3Z A;  2G2K A;  4CL1 A;  3CC7 Z;  4RVD A;  4BXX I;  3GTQ I;  5AN9 F;  3TDH B;  1VQP Z;  1S72 Z;  1M90 1;  2VF1 A;  3HOV I;  4NBC A;  3OW2 Z;  2VUM I;  3Q87 A;  3CCR Z;  4NBB A;  1Z01 A;  2F4M A;  4BBR I;  3I4M I;  3OW2 Y;  4A3L I;  1RO4 A;  3NDJ A;  1VQ9 Z;  1RNI A;  3BG1 B;  3PO2 I;  4A3G I;  3G4S Z;  5D1O B;  4NBH A;  1KC8 1;  2K3R A;  1PFT A;  2M6N A;  1VQL 1;  5IP7 I;  2F4O A;  4RVH A;  3GTG I;  3PO3 S;  2W03 A;  2O53 A;  2BJO A;  3HOW I;  2RBL A;  4HGZ A;  3CC4 Z;  2J6A A;  3HOZ I;  4NFR A;  1RO2 A;  5C4X I;  1VQM 1;  3S1Q I;  2GTI A;  2JNY A;  1L1O C;  2YAD A;  1ZH1 A;  3VMH A;  1YHQ 1;  4AYB A;  3CME 1;  4A3M I;  4NBE A;  3GCF A;  3CCU Z;  3HOX I;  3H3V J;  3I56 1;  4E33 A;  2QRC B;  3CCS Z;  3J7A 4;  3S14 I;  2OOY B;  5C44 I;  3IFU A;  3CC2 1;  2HF1 A;  4RV9 A;  2QA4 Z;  1VQO 1;  1N8R 2;  1K9M 1;  1QF8 A;  3S15 I;  3NH5 A;  3HOY I;  2V8I A;  3J81 f;  1RLY A;  4HGY A;  5D1O A;  2Y0S A;  1DL6 A;  1NP6 A;  3MZK B;  1Q86 2;  3I4N I;  2GTH A;  2V8J A;  4RVG A;  3GTM S;  1YJ9 Z;  4MXU A;  1NJI 1;  3NH4 A;  2NVX I;  1VQK 1;  1JWH C;  2OTJ 1;  4E2W A;  3I55 Z;  2JA5 I;  2V8K A;  4E32 A;  4A3J I;  1VQ6 Z;  2I3C A;  3CCE Z;  4QTT A;  3ESW A;  1VQ5 1;  3CQZ I;  4BY1 I;  3S2D I;  5A2Q b;  2R93 I;  1KD1 2;  3CD6 Z;  3S2H I;  1YJW Z;  5FLX b;  2R92 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...