3CC71

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc7100
1N8R2 3I56Z 1VQ71 3CPWY 3CCU1 3OW2Y 3CCM1 3CC41 1QVFY 2OTJZ 1S72Z 3I55Z 1Q821 3CCS1 3CMAZ 1K9M1 3CXCZ 1KC82 1YI21 3CCQ1 1VQLZ 3CCRZ 3G711 1Q7Y2 2QEXZ 2OTL1 1M1K2 3CC2Z 3CD6Z 1VQ8Z 1YIT1 1K732 3G6E1 1VQM1 1Q812 1QVGY 1KD12 3CXCY 1YJN1 1VQN1 1KC81 1VQO1 3CCVZ 1Q7Y1 3CC7Z 1YJW1 3G4S1 1VQP1 1S721 1K8A2 1VQ61 1K731 1Q811 3CCEZ 1YJ91 1N8R1 1VQ5Z 1VQL1 1M902 1VQ91 1VQ7Z 1NJI2 1W2BZ 1VQ81 3CCL1 1JJ2Z 3CMEZ 1YHQ1 1KQSZ 3CCMZ 1VQ41 3CC4Z 3CCJ1 1YIJZ 1K8A1 3I561 1VQKZ 3CCSZ 2QA4Z 1YI2Z 3CCQZ 3CPWZ 3CCV1 3CC71 3G71Z 2OTJ1 1M1K1 3I551 3OW2Z 2OTLZ 1QVFZ 1W2BY 3CMA1 1Q822 1JJ2Y 1Q862 1YITZ 3G6EZ 3CCR1 1KD11 2QEX1 1YJNZ 1VQNZ 3CC21 3CCUZ 3CD61 1VQOZ 3CME1 1YJWZ 1YIJ1 3G4SZ 1VQPZ 1VQK1 1Q861 2QA41 1QVGZ 1VQ6Z 1M901 1YJ9Z 1NJI1 1VQ9Z 1KQSY 1K9M2 3CCE1 3CCLZ 1VQMZ 1YHQZ 1VQ4Z 1VQ51 3CCJZ
chains in the Genus database with same CATH superfamily
1N8R2 2HU9A 3I56Z 3CCU1 1TWGI 2M6NA 4A3MI 2VF1A 3D9XA 1WZNA 2E9HA 4A3DI 3CMAZ 4DK1A 1YI21 3GCFA 3M3YI 3G711 4MD8A 4A3FI 4BBRI 4NB8A 2PM9A 1WW9A 1VQ8Z 1R9TI 5D1OB 1YIT1 1SFOI 4A3GI 2R6MA 1QVGY 3CXCY 3S1MI 2O4HA 1KC81 2JR6A 3EEDA 4QTUA 1ZB8A 3TE5B 3CCVZ 1YJW1 3GTMI 3G4S1 2E2II 3PO3I 1S721 3PO2I 1Q811 1YJ91 2R92I 2F4OA 1TWCI 2JMOA 2JIOA 2DE6A 4EWCA 4A3CI 2VPXA 2HF1A 1JJ2Z 3VB9A 3CMEZ 1QYPA 3PO3S 2NVQI 2JA6I 2H85A 2ZAEB 3IFUA 1YI2Z 3G71Z 3D2LA 3I551 2IZ4A 4TNUA 4A3BI 1LQLA 1USPB 1YITZ 4CL1A 1VLAA 5AN9F 1KD11 1RLYA 2JIRA 1L1OC 1QXFA 2JIMA 1X3ZA 4Y52I 3F3FC 1YJWZ 3G4SZ 4A3KI 2QRDB 2NVXI 3GTGI 4HGYA 1QVGZ 4NBEA 4A3JI 3U50C 1YJ9Z 3NDIA 4RV9A 1DL6A 4A3EI 3S16I 1TFIA 2JA8I 1VQ51 3HKZA 3FQMA 5IP7I 3BG1B 1RO2A 4MRIA 2Y0SA 4E30A 3I55Z 4BY7I 1Q16A 4BXXI 2JS4A 2EGTA 1K9M1 2PMZA 2QRCB 2QREB 3M4OI 2OOXB 1VQLZ 2JUBA 2NAPA 3MZLB 1Q7Y2 3GTKI 3QWUA 2DE5A 3KIFA 5C4JI 1K732 3G6E1 1VQM1 3NH8A 1YUAA 1KD12 1K83I 1YJN1 1NUIA 1NP6A 1VQO1 3J7A4 3HOWI 3S1QI 2LIYA 3CC7Z 2IZ3A 3H0GI 2W04A 1VQ61 4NBAA 4NBHA 3S1RI 1VQ5Z 3Q87A 1Y1VI 4MD7A 2LFUA 1VQ91 3S2HI 3CCL1 2AYDA 3VMIA 3CCJ1 1SIWA 1K8A1 1YUKA 1VQKZ 1I6HI 3TDHB 5CM2M 1N2FA 1Z03A 4Y7NI 1M1K1 3D6WA 1W2BY 3GTQI 2V8IA 2Q51A 2DE7A 1Q862 2B63I 3I4NI 3G6EZ 3LUSA 3JAMb 2QEX1 4NOZA 1WCMI 4BY1I 3ESWA 1YJNZ 3CC21 3CCUZ 1VQOZ 3GTMS 2I3CA 2GTIA 1YIJ1 1KRLA 2QA41 1VQ6Z 3RZDI 1M901 2F4MA 2KI7B 1NJI1 1WIIA 1VQ9Z 1TWAI 1KQSY 3GTOI 5LL6f 4E31A 2WB1A 3CCLZ 1RNIA 3CCJZ 3JAMf 3IX0A 4DQYB 3VMHA 3MONA 1Z02A 4XX2A 5D1OA 3CPWY 1JWHC 3FQQA 3CC41 2K3RA 2VPYA 4NH1C 1S72Z 2QR1B 1Q821 2VPZA 3CCS1 4NBCA 2JIPA 3CXCZ 2E2HI 5FLMI 1KC82 4RVGA 3NH5A 1I3QI 2QEXZ 2GTHA 1M1K2 3CC2Z 3K7AI 2RIQA 3VTNA 4A3LI 3S2DI 1Q812 1I50I 1WJ2A 1PFTA 1VQN1 2JIQA 2NVYI 3RZOI 3H3VJ 3CQZI 4NB9A 3J80b 2YADA 3HOXI 5A2Qb 5IT9b 2RHBA 1M902 2OOYB 1USPA 1FDIA 1NJI2 3S14I 2V8KA 3GTLI 1VQ81 2G2KA 1YHQ1 1KQSZ 3CC4Z 2RPRA 4HH4A 3CCSZ 4E33A 2WAQA 4S1TA 3CPWZ 3CCV1 4X6AI 2OTJ1 3S1NI 3HOZI 5FLXb 3J80f 2V3VA 1Q822 1JJ2Y 4QTTA 4A3II 5A2Qf 5IT9f 3CCR1 1ZH1A 4MXUA 4E2WA 2VUGA 1VQNZ 5D1PA 4MH4A 3CD61 2IV2X 4NFRA 3CME1 3GKQA 1QF8A 4NBFA 2QKDA 4DGLA 3GTPI 1ZB9A 1Y1VS 2YU9I 3IF8A 5FLXf 5IP9I 2RBLA 3HOVI 1K9M2 3I4MI 3CCE1 1VQMZ 1YHQZ 5C4XI 3IR7A 2BJOA 1VQ71 4E2YA 3OW2Y 3CCM1 2NVTI 1QVFY 2OTJZ 1S7MA 2J6AA 1ML8A 3F3PC 2R7ZI 2JA7I 4RVHA 3CCQ1 2V8JA 4NBBA 3CCRZ 3MZKB 2OTL1 2JA5I 3BG0B 3CD6Z 2E7ZA 2GU2A 3T4NB 3EERA 2R93I 4BBSI 3NDJA 3HOYI 1TWFI 2VPWA 3FKII 1Q7Y1 4E2XA 2Q4ZA 1VQP1 3P5JB 1K8A2 3GTJI 2RT9A 1FDOA 1K731 1X0TA 3CCEZ 1N8R1 2QLVB 4MONA 1VQL1 1Y8CA 1VQ7Z 1AA6A 4RVDA 2P3YA 2LEXA 1W2BZ 3J81b 5T6BA 3S15I 3CCMZ 1VQ41 1YIJZ 1TWHI 2P28A 1RO0A 3I561 5C44I 2QA4Z 3HOUI 3VMGA 2JNYA 3CCQZ 5T67A 3CC71 4E2ZA 2M48A 2AKLA 1Z01A 2VUMI 3OW2Z 4A93I 2OTLZ 1QVFZ 3CMA1 4NBDA 4RS4A 4RVFA 3NFZA 4MD9A 2K5RA 2W03A 5C3EI 3J81f 2O53A 2PK7A 1RO4A 2V45A 4HGZA 4NBGA 5T64A 1VQPZ 2KPIA 1VQK1 1RQFA 4AYBA 1Q861 2E2JI 1P9NA 3I07A 1Y1WI 4E32A 1X3WA 3NH4A 3KIHA 2OZKA 1VQ4Z 3S17I
chains in the Genus database with same CATH topology
1N8R2 2HU9A 3I56Z 3CCU1 1TWGI 2M6NA 4A3MI 2VF1A 3D9XA 2E9HA 4A3DI 3CMAZ 4DK1A 1YI21 3GCFA 3M3YI 3G711 4MD8A 4A3FI 4BBRI 4NB8A 2PM9A 1WW9A 1VQ8Z 1R9TI 5D1OB 1YIT1 1SFOI 4A3GI 2R6MA 1QVGY 3CXCY 3S1MI 2O4HA 1KC81 2JR6A 3EEDA 4QTUA 1ZB8A 3TE5B 3CCVZ 1YJW1 3GTMI 3G4S1 2E2II 3PO3I 1S721 3PO2I 1Q811 1YJ91 2R92I 2F4OA 1TWCI 2JMOA 2DE6A 4EWCA 4A3CI 2HF1A 1JJ2Z 3VB9A 3CMEZ 1QYPA 3PO3S 2NVQI 2JA6I 2H85A 2ZAEB 3IFUA 1YI2Z 3G71Z 3I551 2IZ4A 4TNUA 4A3BI 1LQLA 1USPB 1YITZ 4CL1A 1VLAA 5AN9F 1KD11 1RLYA 1L1OC 1X3ZA 4Y52I 3F3FC 1YJWZ 3G4SZ 4A3KI 2QRDB 2NVXI 3GTGI 4HGYA 1QVGZ 4NBEA 4A3JI 3U50C 1YJ9Z 3NDIA 4RV9A 1DL6A 4A3EI 3S16I 1TFIA 2JA8I 1VQ51 3HKZA 3FQMA 5IP7I 3BG1B 1RO2A 4MRIA 2Y0SA 4E30A 3I55Z 4BY7I 4BXXI 2JS4A 2EGTA 1K9M1 2PMZA 2QRCB 2QREB 3M4OI 2OOXB 1VQLZ 2JUBA 3MZLB 1Q7Y2 3GTKI 3QWUA 2DE5A 3KIFA 5C4JI 1K732 3G6E1 1VQM1 3NH8A 1YUAA 1KD12 1K83I 1YJN1 1NUIA 1NP6A 1VQO1 3J7A4 3HOWI 3S1QI 2LIYA 3CC7Z 2IZ3A 3H0GI 2W04A 1VQ61 4NBAA 4NBHA 3S1RI 1VQ5Z 3Q87A 1Y1VI 4MD7A 2LFUA 1VQ91 3S2HI 3CCL1 3VMIA 3CCJ1 1K8A1 1YUKA 1VQKZ 1I6HI 3TDHB 5CM2M 1N2FA 1Z03A 4Y7NI 1M1K1 3D6WA 1W2BY 3GTQI 2V8IA 2Q51A 2DE7A 1Q862 2B63I 3I4NI 3G6EZ 3LUSA 3JAMb 2QEX1 4NOZA 1WCMI 4BY1I 3ESWA 1YJNZ 3CC21 3CCUZ 1VQOZ 3GTMS 2I3CA 2GTIA 1YIJ1 1KRLA 2QA41 1VQ6Z 3RZDI 1M901 2F4MA 2KI7B 1NJI1 1WIIA 1VQ9Z 1TWAI 1KQSY 3GTOI 5LL6f 4E31A 2WB1A 3CCLZ 1RNIA 3CCJZ 3JAMf 3IX0A 4DQYB 3VMHA 3MONA 1Z02A 4XX2A 5D1OA 3CPWY 1JWHC 3FQQA 3CC41 2K3RA 4NH1C 1S72Z 2QR1B 1Q821 3CCS1 4NBCA 3CXCZ 2E2HI 5FLMI 1KC82 4RVGA 3NH5A 1I3QI 2QEXZ 2GTHA 1M1K2 3CC2Z 3K7AI 2RIQA 3VTNA 4A3LI 3S2DI 1Q812 1I50I 1PFTA 1VQN1 2NVYI 3RZOI 3H3VJ 3CQZI 4NB9A 3J80b 2YADA 3HOXI 5A2Qb 5IT9b 2RHBA 1M902 2OOYB 1USPA 1NJI2 3S14I 2V8KA 3GTLI 1VQ81 2G2KA 1YHQ1 1KQSZ 3CC4Z 2RPRA 4HH4A 3CCSZ 4E33A 2WAQA 4S1TA 3CPWZ 3CCV1 4X6AI 2OTJ1 3S1NI 3HOZI 5FLXb 3J80f 1Q822 1JJ2Y 4QTTA 4A3II 5A2Qf 5IT9f 3CCR1 1ZH1A 4MXUA 4E2WA 2VUGA 1VQNZ 5D1PA 4MH4A 3CD61 4NFRA 3CME1 3GKQA 1QF8A 4NBFA 2QKDA 4DGLA 3GTPI 1ZB9A 1Y1VS 2YU9I 3IF8A 5FLXf 5IP9I 2RBLA 3HOVI 1K9M2 3I4MI 3CCE1 1VQMZ 1YHQZ 5C4XI 2BJOA 1VQ71 4E2YA 3OW2Y 3CCM1 2NVTI 1QVFY 2OTJZ 1S7MA 2J6AA 1ML8A 3F3PC 2R7ZI 2JA7I 4RVHA 3CCQ1 2V8JA 4NBBA 3CCRZ 3MZKB 2OTL1 2JA5I 3BG0B 3CD6Z 2GU2A 3T4NB 3EERA 2R93I 4BBSI 3NDJA 3HOYI 1TWFI 3FKII 1Q7Y1 4E2XA 2Q4ZA 1VQP1 3P5JB 1K8A2 3GTJI 2RT9A 1K731 1X0TA 3CCEZ 1N8R1 2QLVB 4MONA 1VQL1 1VQ7Z 4RVDA 2P3YA 1W2BZ 3J81b 5T6BA 3S15I 3CCMZ 1VQ41 1YIJZ 1TWHI 2P28A 1RO0A 3I561 5C44I 2QA4Z 3HOUI 3VMGA 2JNYA 3CCQZ 5T67A 3CC71 4E2ZA 2M48A 2AKLA 1Z01A 2VUMI 3OW2Z 4A93I 2OTLZ 1QVFZ 3CMA1 4NBDA 4RS4A 4RVFA 3NFZA 4MD9A 2K5RA 2W03A 5C3EI 3J81f 2O53A 2PK7A 1RO4A 4HGZA 4NBGA 5T64A 1VQPZ 2KPIA 1VQK1 1RQFA 4AYBA 1Q861 2E2JI 1P9NA 3I07A 1Y1WI 4E32A 1X3WA 3NH4A 3KIHA 2OZKA 1VQ4Z 3S17I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N8R 2;  3I56 Z;  1VQ7 1;  3CPW Y;  3CCU 1;  3OW2 Y;  3CCM 1;  3CC4 1;  1QVF Y;  2OTJ Z;  1S72 Z;  3I55 Z;  1Q82 1;  3CCS 1;  3CMA Z;  1K9M 1;  3CXC Z;  1KC8 2;  1YI2 1;  3CCQ 1;  1VQL Z;  3CCR Z;  3G71 1;  1Q7Y 2;  2QEX Z;  2OTL 1;  1M1K 2;  3CC2 Z;  3CD6 Z;  1VQ8 Z;  1YIT 1;  1K73 2;  3G6E 1;  1VQM 1;  1Q81 2;  1QVG Y;  1KD1 2;  3CXC Y;  1YJN 1;  1VQN 1;  1KC8 1;  1VQO 1;  3CCV Z;  1Q7Y 1;  3CC7 Z;  1YJW 1;  3G4S 1;  1VQP 1;  1S72 1;  1K8A 2;  1VQ6 1;  1K73 1;  1Q81 1;  3CCE Z;  1YJ9 1;  1N8R 1;  1VQ5 Z;  1VQL 1;  1M90 2;  1VQ9 1;  1VQ7 Z;  1NJI 2;  1W2B Z;  1VQ8 1;  3CCL 1;  1JJ2 Z;  3CME Z;  1YHQ 1;  1KQS Z;  3CCM Z;  1VQ4 1;  3CC4 Z;  3CCJ 1;  1YIJ Z;  1K8A 1;  3I56 1;  1VQK Z;  3CCS Z;  2QA4 Z;  1YI2 Z;  3CCQ Z;  3CPW Z;  3CCV 1;  3CC7 1;  3G71 Z;  2OTJ 1;  1M1K 1;  3I55 1;  3OW2 Z;  2OTL Z;  1QVF Z;  1W2B Y;  3CMA 1;  1Q82 2;  1JJ2 Y;  1Q86 2;  1YIT Z;  3G6E Z;  3CCR 1;  1KD1 1;  2QEX 1;  1YJN Z;  1VQN Z;  3CC2 1;  3CCU Z;  3CD6 1;  1VQO Z;  3CME 1;  1YJW Z;  1YIJ 1;  3G4S Z;  1VQP Z;  1VQK 1;  1Q86 1;  2QA4 1;  1QVG Z;  1VQ6 Z;  1M90 1;  1YJ9 Z;  1NJI 1;  1VQ9 Z;  1KQS Y;  1K9M 2;  3CCE 1;  3CCL Z;  1VQM Z;  1YHQ Z;  1VQ4 Z;  1VQ5 1;  3CCJ Z; 
#chains in the Genus database with same CATH topology
 1N8R 2;  2HU9 A;  3I56 Z;  3CCU 1;  1TWG I;  2M6N A;  4A3M I;  2VF1 A;  3D9X A;  1WZN A;  2E9H A;  4A3D I;  3CMA Z;  4DK1 A;  1YI2 1;  3GCF A;  3M3Y I;  3G71 1;  4MD8 A;  4A3F I;  4BBR I;  4NB8 A;  2PM9 A;  1WW9 A;  1VQ8 Z;  1R9T I;  5D1O B;  1YIT 1;  1SFO I;  4A3G I;  2R6M A;  1QVG Y;  3CXC Y;  3S1M I;  2O4H A;  1KC8 1;  2JR6 A;  3EED A;  4QTU A;  1ZB8 A;  3TE5 B;  3CCV Z;  1YJW 1;  3GTM I;  3G4S 1;  2E2I I;  3PO3 I;  1S72 1;  3PO2 I;  1Q81 1;  1YJ9 1;  2R92 I;  2F4O A;  1TWC I;  2JMO A;  2JIO A;  2DE6 A;  4EWC A;  4A3C I;  2VPX A;  2HF1 A;  1JJ2 Z;  3VB9 A;  3CME Z;  1QYP A;  3PO3 S;  2NVQ I;  2JA6 I;  2H85 A;  2ZAE B;  3IFU A;  1YI2 Z;  3G71 Z;  3D2L A;  3I55 1;  2IZ4 A;  4TNU A;  4A3B I;  1LQL A;  1USP B;  1YIT Z;  4CL1 A;  1VLA A;  5AN9 F;  1KD1 1;  1RLY A;  2JIR A;  1L1O C;  1QXF A;  2JIM A;  1X3Z A;  4Y52 I;  3F3F C;  1YJW Z;  3G4S Z;  4A3K I;  2QRD B;  2NVX I;  3GTG I;  4HGY A;  1QVG Z;  4NBE A;  4A3J I;  3U50 C;  1YJ9 Z;  3NDI A;  4RV9 A;  1DL6 A;  4A3E I;  3S16 I;  1TFI A;  2JA8 I;  1VQ5 1;  3HKZ A;  3FQM A;  5IP7 I;  3BG1 B;  1RO2 A;  4MRI A;  2Y0S A;  4E30 A;  3I55 Z;  4BY7 I;  1Q16 A;  4BXX I;  2JS4 A;  2EGT A;  1K9M 1;  2PMZ A;  2QRC B;  2QRE B;  3M4O I;  2OOX B;  1VQL Z;  2JUB A;  2NAP A;  3MZL B;  1Q7Y 2;  3GTK I;  3QWU A;  2DE5 A;  3KIF A;  5C4J I;  1K73 2;  3G6E 1;  1VQM 1;  3NH8 A;  1YUA A;  1KD1 2;  1K83 I;  1YJN 1;  1NUI A;  1NP6 A;  1VQO 1;  3J7A 4;  3HOW I;  3S1Q I;  2LIY A;  3CC7 Z;  2IZ3 A;  3H0G I;  2W04 A;  1VQ6 1;  4NBA A;  4NBH A;  3S1R I;  1VQ5 Z;  3Q87 A;  1Y1V I;  4MD7 A;  2LFU A;  1VQ9 1;  3S2H I;  3CCL 1;  2AYD A;  3VMI A;  3CCJ 1;  1SIW A;  1K8A 1;  1YUK A;  1VQK Z;  1I6H I;  3TDH B;  5CM2 M;  1N2F A;  1Z03 A;  4Y7N I;  1M1K 1;  3D6W A;  1W2B Y;  3GTQ I;  2V8I A;  2Q51 A;  2DE7 A;  1Q86 2;  2B63 I;  3I4N I;  3G6E Z;  3LUS A;  3JAM b;  2QEX 1;  4NOZ A;  1WCM I;  4BY1 I;  3ESW A;  1YJN Z;  3CC2 1;  3CCU Z;  1VQO Z;  3GTM S;  2I3C A;  2GTI A;  1YIJ 1;  1KRL A;  2QA4 1;  1VQ6 Z;  3RZD I;  1M90 1;  2F4M A;  2KI7 B;  1NJI 1;  1WII A;  1VQ9 Z;  1TWA I;  1KQS Y;  3GTO I;  5LL6 f;  4E31 A;  2WB1 A;  3CCL Z;  1RNI A;  3CCJ Z;  3JAM f;  3IX0 A;  4DQY B;  3VMH A;  3MON A;  1Z02 A;  4XX2 A;  5D1O A;  3CPW Y;  1JWH C;  3FQQ A;  3CC4 1;  2K3R A;  2VPY A;  4NH1 C;  1S72 Z;  2QR1 B;  1Q82 1;  2VPZ A;  3CCS 1;  4NBC A;  2JIP A;  3CXC Z;  2E2H I;  5FLM I;  1KC8 2;  4RVG A;  3NH5 A;  1I3Q I;  2QEX Z;  2GTH A;  1M1K 2;  3CC2 Z;  3K7A I;  2RIQ A;  3VTN A;  4A3L I;  3S2D I;  1Q81 2;  1I50 I;  1WJ2 A;  1PFT A;  1VQN 1;  2JIQ A;  2NVY I;  3RZO I;  3H3V J;  3CQZ I;  4NB9 A;  3J80 b;  2YAD A;  3HOX I;  5A2Q b;  5IT9 b;  2RHB A;  1M90 2;  2OOY B;  1USP A;  1FDI A;  1NJI 2;  3S14 I;  2V8K A;  3GTL I;  1VQ8 1;  2G2K A;  1YHQ 1;  1KQS Z;  3CC4 Z;  2RPR A;  4HH4 A;  3CCS Z;  4E33 A;  2WAQ A;  4S1T A;  3CPW Z;  3CCV 1;  4X6A I;  2OTJ 1;  3S1N I;  3HOZ I;  5FLX b;  3J80 f;  2V3V A;  1Q82 2;  1JJ2 Y;  4QTT A;  4A3I I;  5A2Q f;  5IT9 f;  3CCR 1;  1ZH1 A;  4MXU A;  4E2W A;  2VUG A;  1VQN Z;  5D1P A;  4MH4 A;  3CD6 1;  2IV2 X;  4NFR A;  3CME 1;  3GKQ A;  1QF8 A;  4NBF A;  2QKD A;  4DGL A;  3GTP I;  1ZB9 A;  1Y1V S;  2YU9 I;  3IF8 A;  5FLX f;  5IP9 I;  2RBL A;  3HOV I;  1K9M 2;  3I4M I;  3CCE 1;  1VQM Z;  1YHQ Z;  5C4X I;  3IR7 A;  2BJO A;  1VQ7 1;  4E2Y A;  3OW2 Y;  3CCM 1;  2NVT I;  1QVF Y;  2OTJ Z;  1S7M A;  2J6A A;  1ML8 A;  3F3P C;  2R7Z I;  2JA7 I;  4RVH A;  3CCQ 1;  2V8J A;  4NBB A;  3CCR Z;  3MZK B;  2OTL 1;  2JA5 I;  3BG0 B;  3CD6 Z;  2E7Z A;  2GU2 A;  3T4N B;  3EER A;  2R93 I;  4BBS I;  3NDJ A;  3HOY I;  1TWF I;  2VPW A;  3FKI I;  1Q7Y 1;  4E2X A;  2Q4Z A;  1VQP 1;  3P5J B;  1K8A 2;  3GTJ I;  2RT9 A;  1FDO A;  1K73 1;  1X0T A;  3CCE Z;  1N8R 1;  2QLV B;  4MON A;  1VQL 1;  1Y8C A;  1VQ7 Z;  1AA6 A;  4RVD A;  2P3Y A;  2LEX A;  1W2B Z;  3J81 b;  5T6B A;  3S15 I;  3CCM Z;  1VQ4 1;  1YIJ Z;  1TWH I;  2P28 A;  1RO0 A;  3I56 1;  5C44 I;  2QA4 Z;  3HOU I;  3VMG A;  2JNY A;  3CCQ Z;  5T67 A;  3CC7 1;  4E2Z A;  2M48 A;  2AKL A;  1Z01 A;  2VUM I;  3OW2 Z;  4A93 I;  2OTL Z;  1QVF Z;  3CMA 1;  4NBD A;  4RS4 A;  4RVF A;  3NFZ A;  4MD9 A;  2K5R A;  2W03 A;  5C3E I;  3J81 f;  2O53 A;  2PK7 A;  1RO4 A;  2V45 A;  4HGZ A;  4NBG A;  5T64 A;  1VQP Z;  2KPI A;  1VQK 1;  1RQF A;  4AYB A;  1Q86 1;  2E2J I;  1P9N A;  3I07 A;  1Y1W I;  4E32 A;  1X3W A;  3NH4 A;  3KIH A;  2OZK A;  1VQ4 Z;  3S17 I; 
#chains in the Genus database with same CATH homology
 1N8R 2;  2HU9 A;  3I56 Z;  3CCU 1;  1TWG I;  2M6N A;  4A3M I;  2VF1 A;  3D9X A;  2E9H A;  4A3D I;  3CMA Z;  4DK1 A;  1YI2 1;  3GCF A;  3M3Y I;  3G71 1;  4MD8 A;  4A3F I;  4BBR I;  4NB8 A;  2PM9 A;  1WW9 A;  1VQ8 Z;  1R9T I;  5D1O B;  1YIT 1;  1SFO I;  4A3G I;  2R6M A;  1QVG Y;  3CXC Y;  3S1M I;  2O4H A;  1KC8 1;  2JR6 A;  3EED A;  4QTU A;  1ZB8 A;  3TE5 B;  3CCV Z;  1YJW 1;  3GTM I;  3G4S 1;  2E2I I;  3PO3 I;  1S72 1;  3PO2 I;  1Q81 1;  1YJ9 1;  2R92 I;  2F4O A;  1TWC I;  2JMO A;  2DE6 A;  4EWC A;  4A3C I;  2HF1 A;  1JJ2 Z;  3VB9 A;  3CME Z;  1QYP A;  3PO3 S;  2NVQ I;  2JA6 I;  2H85 A;  2ZAE B;  3IFU A;  1YI2 Z;  3G71 Z;  3I55 1;  2IZ4 A;  4TNU A;  4A3B I;  1LQL A;  1USP B;  1YIT Z;  4CL1 A;  1VLA A;  5AN9 F;  1KD1 1;  1RLY A;  1L1O C;  1X3Z A;  4Y52 I;  3F3F C;  1YJW Z;  3G4S Z;  4A3K I;  2QRD B;  2NVX I;  3GTG I;  4HGY A;  1QVG Z;  4NBE A;  4A3J I;  3U50 C;  1YJ9 Z;  3NDI A;  4RV9 A;  1DL6 A;  4A3E I;  3S16 I;  1TFI A;  2JA8 I;  1VQ5 1;  3HKZ A;  3FQM A;  5IP7 I;  3BG1 B;  1RO2 A;  4MRI A;  2Y0S A;  4E30 A;  3I55 Z;  4BY7 I;  4BXX I;  2JS4 A;  2EGT A;  1K9M 1;  2PMZ A;  2QRC B;  2QRE B;  3M4O I;  2OOX B;  1VQL Z;  2JUB A;  3MZL B;  1Q7Y 2;  3GTK I;  3QWU A;  2DE5 A;  3KIF A;  5C4J I;  1K73 2;  3G6E 1;  1VQM 1;  3NH8 A;  1YUA A;  1KD1 2;  1K83 I;  1YJN 1;  1NUI A;  1NP6 A;  1VQO 1;  3J7A 4;  3HOW I;  3S1Q I;  2LIY A;  3CC7 Z;  2IZ3 A;  3H0G I;  2W04 A;  1VQ6 1;  4NBA A;  4NBH A;  3S1R I;  1VQ5 Z;  3Q87 A;  1Y1V I;  4MD7 A;  2LFU A;  1VQ9 1;  3S2H I;  3CCL 1;  3VMI A;  3CCJ 1;  1K8A 1;  1YUK A;  1VQK Z;  1I6H I;  3TDH B;  5CM2 M;  1N2F A;  1Z03 A;  4Y7N I;  1M1K 1;  3D6W A;  1W2B Y;  3GTQ I;  2V8I A;  2Q51 A;  2DE7 A;  1Q86 2;  2B63 I;  3I4N I;  3G6E Z;  3LUS A;  3JAM b;  2QEX 1;  4NOZ A;  1WCM I;  4BY1 I;  3ESW A;  1YJN Z;  3CC2 1;  3CCU Z;  1VQO Z;  3GTM S;  2I3C A;  2GTI A;  1YIJ 1;  1KRL A;  2QA4 1;  1VQ6 Z;  3RZD I;  1M90 1;  2F4M A;  2KI7 B;  1NJI 1;  1WII A;  1VQ9 Z;  1TWA I;  1KQS Y;  3GTO I;  5LL6 f;  4E31 A;  2WB1 A;  3CCL Z;  1RNI A;  3CCJ Z;  3JAM f;  3IX0 A;  4DQY B;  3VMH A;  3MON A;  1Z02 A;  4XX2 A;  5D1O A;  3CPW Y;  1JWH C;  3FQQ A;  3CC4 1;  2K3R A;  4NH1 C;  1S72 Z;  2QR1 B;  1Q82 1;  3CCS 1;  4NBC A;  3CXC Z;  2E2H I;  5FLM I;  1KC8 2;  4RVG A;  3NH5 A;  1I3Q I;  2QEX Z;  2GTH A;  1M1K 2;  3CC2 Z;  3K7A I;  2RIQ A;  3VTN A;  4A3L I;  3S2D I;  1Q81 2;  1I50 I;  1PFT A;  1VQN 1;  2NVY I;  3RZO I;  3H3V J;  3CQZ I;  4NB9 A;  3J80 b;  2YAD A;  3HOX I;  5A2Q b;  5IT9 b;  2RHB A;  1M90 2;  2OOY B;  1USP A;  1NJI 2;  3S14 I;  2V8K A;  3GTL I;  1VQ8 1;  2G2K A;  1YHQ 1;  1KQS Z;  3CC4 Z;  2RPR A;  4HH4 A;  3CCS Z;  4E33 A;  2WAQ A;  4S1T A;  3CPW Z;  3CCV 1;  4X6A I;  2OTJ 1;  3S1N I;  3HOZ I;  5FLX b;  3J80 f;  1Q82 2;  1JJ2 Y;  4QTT A;  4A3I I;  5A2Q f;  5IT9 f;  3CCR 1;  1ZH1 A;  4MXU A;  4E2W A;  2VUG A;  1VQN Z;  5D1P A;  4MH4 A;  3CD6 1;  4NFR A;  3CME 1;  3GKQ A;  1QF8 A;  4NBF A;  2QKD A;  4DGL A;  3GTP I;  1ZB9 A;  1Y1V S;  2YU9 I;  3IF8 A;  5FLX f;  5IP9 I;  2RBL A;  3HOV I;  1K9M 2;  3I4M I;  3CCE 1;  1VQM Z;  1YHQ Z;  5C4X I;  2BJO A;  1VQ7 1;  4E2Y A;  3OW2 Y;  3CCM 1;  2NVT I;  1QVF Y;  2OTJ Z;  1S7M A;  2J6A A;  1ML8 A;  3F3P C;  2R7Z I;  2JA7 I;  4RVH A;  3CCQ 1;  2V8J A;  4NBB A;  3CCR Z;  3MZK B;  2OTL 1;  2JA5 I;  3BG0 B;  3CD6 Z;  2GU2 A;  3T4N B;  3EER A;  2R93 I;  4BBS I;  3NDJ A;  3HOY I;  1TWF I;  3FKI I;  1Q7Y 1;  4E2X A;  2Q4Z A;  1VQP 1;  3P5J B;  1K8A 2;  3GTJ I;  2RT9 A;  1K73 1;  1X0T A;  3CCE Z;  1N8R 1;  2QLV B;  4MON A;  1VQL 1;  1VQ7 Z;  4RVD A;  2P3Y A;  1W2B Z;  3J81 b;  5T6B A;  3S15 I;  3CCM Z;  1VQ4 1;  1YIJ Z;  1TWH I;  2P28 A;  1RO0 A;  3I56 1;  5C44 I;  2QA4 Z;  3HOU I;  3VMG A;  2JNY A;  3CCQ Z;  5T67 A;  3CC7 1;  4E2Z A;  2M48 A;  2AKL A;  1Z01 A;  2VUM I;  3OW2 Z;  4A93 I;  2OTL Z;  1QVF Z;  3CMA 1;  4NBD A;  4RS4 A;  4RVF A;  3NFZ A;  4MD9 A;  2K5R A;  2W03 A;  5C3E I;  3J81 f;  2O53 A;  2PK7 A;  1RO4 A;  4HGZ A;  4NBG A;  5T64 A;  1VQP Z;  2KPI A;  1VQK 1;  1RQF A;  4AYB A;  1Q86 1;  2E2J I;  1P9N A;  3I07 A;  1Y1W I;  4E32 A;  1X3W A;  3NH4 A;  3KIH A;  2OZK A;  1VQ4 Z;  3S17 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...