3CC71

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc7100
1KC82 1VQ5Z 1N8R1 2QA41 3CC71 1N8R2 1KC81 1KQSY 3CCEZ 1K732 1VQ41 1VQKZ 3OW2Z 3CCM1 1VQPZ 1VQM1 1VQ61 3CPWZ 1Q7Y2 1K8A2 3CCMZ 3CCJZ 3CCQ1 1VQ8Z 1K8A1 3CMAZ 3CC4Z 1VQMZ 1KQSZ 1YITZ 1YJN1 3I55Z 1VQ9Z 1VQO1 1YHQZ 3CCE1 2OTLZ 1Q861 1JJ2Y 3CCQZ 3CC7Z 3CPWY 1VQ7Z 1YJWZ 2OTJZ 1VQ6Z 3CCS1 1QVFZ 1Q822 2QEX1 1K9M2 3CCRZ 1M1K2 1NJI1 1M1K1 3CCR1 3CCU1 1Q7Y1 3I56Z 3CC2Z 1K9M1 1QVFY 3CME1 1KD11 1YJ91 3G6EZ 3OW2Y 1JJ2Z 3G4S1 2OTL1 1Q862 3G4SZ 1YIJZ 1VQOZ 3G6E1 3CCVZ 3CD61 3CC21 3CCL1 1M901 3CCJ1 1VQ81 3I551 1YIT1 3CMEZ 1Q812 1Q821 3CC41 1M902 3CMA1 1YI2Z 1K731 1VQLZ 3CD6Z 1YI21 3CCSZ 1VQ91 1YJNZ 2OTJ1 1YJ9Z 1VQ71 1VQ4Z 3CXCY 1W2BY 3I561 1VQNZ 1VQL1 3CCUZ 1YHQ1 1KD12 2QA4Z 1VQ51 1QVGY 3CCLZ 1Q811 3G711 1S72Z 1VQP1 1NJI2 3G71Z 1YJW1 1VQK1 1YIJ1 1QVGZ 2QEXZ 1VQN1 3CCV1 3CXCZ 1S721 1W2BZ
chains in the Genus database with same CATH superfamily
2QA41 3HOYI 3HOZI 2QRCB 4NBCA 4A3FI 2GTHA 2W03A 3GTMI 4QTUA 1LQLA 1WCMI 1RQFA 1VQPZ 3KIHA 3T4NB 3CPWZ 3M3YI 1Q7Y2 3CCMZ 3CCJZ 1Z02A 2PM9A 3RZOI 2Y0SA 1JWHC 5T64A 2JUBA 4A3DI 5FLMI 3CCE1 2NVQI 4DQYB 1Q861 2NVYI 2LEXA 2P3YA 4NBBA 3CC7Z 3HOXI 2VPXA 3NDIA 3IR7A 3PO3I 4MD9A 1Q822 2DE7A 1M1K2 1WW9A 3Q87A 1M1K1 3GKQA 3CCR1 1Q7Y1 2QLVB 3CC2Z 1X0TA 3NH4A 3G6EZ 2JA7I 3OW2Y 2JS4A 1JJ2Z 1ZB9A 2IZ3A 2JIRA 1NP6A 3J81f 5CM2M 4A93I 4DGLA 3GTOI 3CCVZ 2E2HI 3CD61 3P5JB 2VUGA 1Z01A 1L1OC 4NFRA 3CCJ1 4RV9A 3GTGI 4QTTA 4MD8A 4BBRI 4RVGA 3F3FC 1Q821 3CC41 1M902 3NH5A 2WAQA 3J7A4 2ZAEB 2RPRA 1K731 2K5RA 1VQLZ 2AYDA 2I3CA 1VQ91 2RBLA 2JA8I 2V45A 1VQNZ 1RO2A 1KD12 3GTMS 1QVGY 4MH4A 3CCLZ 4A3II 2B63I 1S72Z 3EEDA 3PO2I 3LUSA 4Y52I 4NBAA 1YIJ1 1RO0A 2GTIA 3FKII 3JAMf 3MONA 3I4MI 2VUMI 1ZH1A 4MONA 4NBDA 1VQ5Z 1N8R1 4MXUA 1N8R2 2E9HA 3J80b 1KQSY 5A2Qb 1K732 3MZKB 4E2WA 2V8JA 1VQ61 4CL1A 2E7ZA 2E2JI 3S17I 1QF8A 1K8A1 3S14I 2NAPA 3D2LA 4MRIA 2O4HA 1VQMZ 3TDHB 3GCFA 1YITZ 1YJN1 1Y1VS 3I55Z 1VQ9Z 3NH8A 1TWFI 1JJ2Y 1KRLA 1YJWZ 4NBEA 1VLAA 2JMOA 3CCRZ 1RLYA 2QR1B 3TE5B 3U50C 3I56Z 1FDIA 2JIMA 1QVFY 2PK7A 1YJ91 2EGTA 1KD11 3HOWI 1K83I 3J80f 3G4S1 2OTL1 1Q862 2JIOA 3G4SZ 1TWCI 1FDOA 3G6E1 1Z03A 3VMIA 3M4OI 3VB9A 1M901 5LL6f 2Q4ZA 2Q51A 2VF1A 1VQ81 3GTQI 2AKLA 2VPWA 1I50I 4HGYA 2K3RA 2P28A 3CMA1 2RT9A 1W2BZ 2F4OA 1USPB 4RVDA 1YI21 1S7MA 2G2KA 1YJNZ 4RVHA 4E30A 4A3BI 3CXCY 1WIIA 2JIPA 3I561 3CCUZ 4TNUA 2QREB 3D9XA 2KPIA 2OZKA 1Y1VI 1Q811 3G711 2M48A 1VQP1 2H85A 3VMHA 3S2HI 2BJOA 3S1MI 4NH1C 3S2DI 1QVGZ 2J6AA 4A3MI 5IP9I 4E2XA 3BG1B 3CC71 2QKDA 4A3LI 3CCEZ 5T6BA 1VQ41 1VQKZ 2VPZA 2F4MA 1WZNA 1VQM1 1QYPA 1K8A2 1Y1WI 3CCQ1 4RS4A 4E2YA 1Q16A 1TWHI 4S1TA 3CMAZ 1DL6A 3VMGA 4E2ZA 4RVFA 1VQO1 4E33A 1YHQZ 4E32A 3GTKI 1YUKA 5C4JI 1USPA 3CPWY 4HGZA 1VQ7Z 2OTJZ 3CCS1 2WB1A 3IF8A 3FQMA 2QEX1 1AA6A 1NJI1 2DE6A 3D6WA 3FQQA 3CCU1 3IFUA 1K9M1 3CME1 2JA6I 4A3GI 3S1RI 2R92I 1NUIA 5C3EI 1VQOZ 5D1OB 2YADA 4A3EI 2JA5I 2QRDB 4DK1A 4E31A 3PO3S 2R7ZI 1X3WA 5T67A 3CC21 2HU9A 2IV2X 4BY7I 2JR6A 1YIT1 1PFTA 3CMEZ 2E2II 4NB8A 2HF1A 3MZLB 4A3JI 2OOXB 1YI2Z 3KIFA 2O53A 1I3QI 3CD6Z 4Y7NI 2V3VA 5A2Qf 5D1OA 3JAMb 2R93I 1YJ9Z 1VQ71 1VQ4Z 1ML8A 1W2BY 2NVXI 1YHQ1 4HH4A 3I4NI 4BY1I 1QXFA 3IX0A 1YJW1 2LIYA 2VPYA 4NOZA 2NVTI 3CCV1 3CXCZ 1KC82 3H3VJ 4BXXI 1KC81 4NBFA 2KI7B 1WJ2A 2PMZA 2IZ4A 3S1NI 3OW2Z 3CCM1 3S1QI 2R6MA 2V8KA 3HKZA 1VQ8Z 3GTPI 5IP7I 3CC4Z 1TFIA 2LFUA 5IT9b 3S15I 1N2FA 1KQSZ 1Y8CA 5FLXf 3RZDI 2JIQA 4EWCA 2OTLZ 1R9TI 4XX2A 3K7AI 5C44I 3CCQZ 3VTNA 1S721 1VQ6Z 1QVFZ 3HOUI 1X3ZA 1K9M2 3H0GI 4BBSI 5C4XI 1TWAI 4X6AI 1P9NA 4A3CI 3CQZI 5FLXb 2RIQA 1RNIA 1YIJZ 4A3KI 1SFOI 1I6HI 4NBHA 3J81b 2YU9I 3CCL1 4NBGA 2DE5A 5D1PA 2GU2A 3I551 2OOYB 5IT9f 3NFZA 3NDJA 1Q812 4MD7A 2JNYA 2RHBA 2V8IA 2W04A 3CCSZ 3S16I 2OTJ1 3BG0B 3QWUA 1VQL1 3EERA 1RO4A 2QA4Z 3F3PC 1VQ51 1SIWA 1TWGI 1NJI2 3G71Z 4NB9A 1VQK1 2M6NA 1YUAA 4AYBA 3ESWA 5AN9F 3GTJI 2QEXZ 1VQN1 3GTLI 3HOVI 3I07A 1ZB8A
chains in the Genus database with same CATH topology
2QA41 3HOYI 3HOZI 2QRCB 4NBCA 4A3FI 2GTHA 2W03A 3GTMI 4QTUA 1LQLA 1WCMI 1RQFA 1VQPZ 3KIHA 3T4NB 3CPWZ 3M3YI 1Q7Y2 3CCMZ 3CCJZ 1Z02A 2PM9A 3RZOI 2Y0SA 1JWHC 5T64A 2JUBA 4A3DI 5FLMI 3CCE1 2NVQI 4DQYB 1Q861 2NVYI 2P3YA 4NBBA 3CC7Z 3HOXI 3NDIA 3PO3I 4MD9A 1Q822 2DE7A 1M1K2 1WW9A 3Q87A 1M1K1 3GKQA 3CCR1 1Q7Y1 2QLVB 3CC2Z 1X0TA 3NH4A 3G6EZ 2JA7I 3OW2Y 2JS4A 1JJ2Z 1ZB9A 2IZ3A 1NP6A 3J81f 5CM2M 4A93I 4DGLA 3GTOI 3CCVZ 2E2HI 3CD61 3P5JB 2VUGA 1Z01A 1L1OC 4NFRA 3CCJ1 4RV9A 3GTGI 4QTTA 4MD8A 4BBRI 4RVGA 3F3FC 1Q821 3CC41 1M902 3NH5A 2WAQA 3J7A4 2ZAEB 2RPRA 1K731 2K5RA 1VQLZ 2I3CA 1VQ91 2RBLA 2JA8I 1VQNZ 1RO2A 1KD12 3GTMS 1QVGY 4MH4A 3CCLZ 4A3II 2B63I 1S72Z 3EEDA 3PO2I 3LUSA 4Y52I 4NBAA 1YIJ1 1RO0A 2GTIA 3FKII 3JAMf 3MONA 3I4MI 2VUMI 1ZH1A 4MONA 4NBDA 1VQ5Z 1N8R1 4MXUA 1N8R2 2E9HA 3J80b 1KQSY 5A2Qb 1K732 3MZKB 4E2WA 2V8JA 1VQ61 4CL1A 2E2JI 3S17I 1QF8A 1K8A1 3S14I 4MRIA 2O4HA 1VQMZ 3TDHB 3GCFA 1YITZ 1YJN1 1Y1VS 3I55Z 1VQ9Z 3NH8A 1TWFI 1JJ2Y 1KRLA 1YJWZ 3I07A 4NBEA 1VLAA 2JMOA 3CCRZ 1RLYA 2QR1B 3TE5B 3U50C 3I56Z 1QVFY 2PK7A 1YJ91 2EGTA 1KD11 3HOWI 1K83I 3J80f 3G4S1 2OTL1 1Q862 1TWCI 3G4SZ 3G6E1 1Z03A 3VMIA 3M4OI 3VB9A 1M901 5LL6f 2Q4ZA 2Q51A 2VF1A 1VQ81 3GTQI 2AKLA 1I50I 4HGYA 2K3RA 2P28A 3CMA1 2RT9A 2F4OA 1USPB 4RVDA 1YI21 1S7MA 2G2KA 1YJNZ 4RVHA 4E30A 4A3BI 3CXCY 1WIIA 3I561 3CCUZ 4TNUA 2QREB 3D9XA 2KPIA 2OZKA 1Y1VI 1Q811 3G711 2M48A 1VQP1 2H85A 3VMHA 3S2HI 2BJOA 3S1MI 4NH1C 3S2DI 1QVGZ 2J6AA 4A3MI 5IP9I 1ZB8A 4E2XA 3BG1B 3CC71 2QKDA 4A3LI 3CCEZ 5T6BA 1VQ41 1VQKZ 2F4MA 1VQM1 1QYPA 1K8A2 1Y1WI 3CCQ1 4RS4A 4E2YA 1TWHI 4S1TA 3CMAZ 1DL6A 3VMGA 4E2ZA 4RVFA 1VQO1 4E33A 1YHQZ 4E32A 3GTKI 1YUKA 5C4JI 1USPA 3CPWY 4HGZA 1VQ7Z 2OTJZ 3CCS1 2WB1A 3IF8A 3FQMA 2QEX1 1NJI1 2DE6A 3D6WA 3FQQA 3CCU1 3IFUA 1K9M1 3CME1 2JA6I 4A3GI 3S1RI 2R92I 1NUIA 5C3EI 1VQOZ 5D1OB 2YADA 4A3EI 2JA5I 2QRDB 4DK1A 4E31A 3PO3S 2R7ZI 1X3WA 5T67A 3CC21 2HU9A 4BY7I 2JR6A 1YIT1 1PFTA 3CMEZ 2E2II 4NB8A 2HF1A 3MZLB 4A3JI 2OOXB 1YI2Z 3KIFA 2O53A 1I3QI 3CD6Z 4Y7NI 5A2Qf 5D1OA 3JAMb 2R93I 1YJ9Z 1VQ71 1VQ4Z 1ML8A 1W2BY 2NVXI 1YHQ1 4HH4A 3I4NI 4BY1I 3IX0A 1YJW1 2LIYA 4NOZA 2NVTI 3CCV1 3CXCZ 1KC82 3H3VJ 4BXXI 1KC81 4NBFA 2KI7B 2PMZA 2IZ4A 3S1NI 3OW2Z 3CCM1 3S1QI 2R6MA 2V8KA 3HKZA 1VQ8Z 3GTPI 5IP7I 3CC4Z 1TFIA 2LFUA 5IT9b 3S15I 1N2FA 1KQSZ 5FLXf 3RZDI 4EWCA 2OTLZ 1R9TI 4XX2A 3K7AI 5C44I 3CCQZ 3VTNA 1VQ6Z 1QVFZ 3HOUI 1X3ZA 1K9M2 3H0GI 4BBSI 5C4XI 1TWAI 4X6AI 1P9NA 4A3CI 3CQZI 5FLXb 2RIQA 1RNIA 1YIJZ 4A3KI 1SFOI 1I6HI 4NBHA 3J81b 2YU9I 3CCL1 4NBGA 2DE5A 5D1PA 2GU2A 3I551 2OOYB 5IT9f 3NFZA 3NDJA 1Q812 4MD7A 2JNYA 2RHBA 2V8IA 2W04A 3CCSZ 3S16I 2OTJ1 3BG0B 3QWUA 1VQL1 3EERA 1RO4A 2QA4Z 3F3PC 1VQ51 1TWGI 1NJI2 3G71Z 4NB9A 1VQK1 2M6NA 1YUAA 4AYBA 3ESWA 5AN9F 3GTJI 2QEXZ 1VQN1 3GTLI 3HOVI 1S721 1W2BZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 2;  1VQ5 Z;  1N8R 1;  2QA4 1;  3CC7 1;  1N8R 2;  1KC8 1;  1KQS Y;  3CCE Z;  1K73 2;  1VQ4 1;  1VQK Z;  3OW2 Z;  3CCM 1;  1VQP Z;  1VQM 1;  1VQ6 1;  3CPW Z;  1Q7Y 2;  1K8A 2;  3CCM Z;  3CCJ Z;  3CCQ 1;  1VQ8 Z;  1K8A 1;  3CMA Z;  3CC4 Z;  1VQM Z;  1KQS Z;  1YIT Z;  1YJN 1;  3I55 Z;  1VQ9 Z;  1VQO 1;  1YHQ Z;  3CCE 1;  2OTL Z;  1Q86 1;  1JJ2 Y;  3CCQ Z;  3CC7 Z;  3CPW Y;  1VQ7 Z;  1YJW Z;  2OTJ Z;  1VQ6 Z;  3CCS 1;  1QVF Z;  1Q82 2;  2QEX 1;  1K9M 2;  3CCR Z;  1M1K 2;  1NJI 1;  1M1K 1;  3CCR 1;  3CCU 1;  1Q7Y 1;  3I56 Z;  3CC2 Z;  1K9M 1;  1QVF Y;  3CME 1;  1KD1 1;  1YJ9 1;  3G6E Z;  3OW2 Y;  1JJ2 Z;  3G4S 1;  2OTL 1;  1Q86 2;  3G4S Z;  1YIJ Z;  1VQO Z;  3G6E 1;  3CCV Z;  3CD6 1;  3CC2 1;  3CCL 1;  1M90 1;  3CCJ 1;  1VQ8 1;  3I55 1;  1YIT 1;  3CME Z;  1Q81 2;  1Q82 1;  3CC4 1;  1M90 2;  3CMA 1;  1YI2 Z;  1K73 1;  1VQL Z;  3CD6 Z;  1YI2 1;  3CCS Z;  1VQ9 1;  1YJN Z;  2OTJ 1;  1YJ9 Z;  1VQ7 1;  1VQ4 Z;  3CXC Y;  1W2B Y;  3I56 1;  1VQN Z;  1VQL 1;  3CCU Z;  1YHQ 1;  1KD1 2;  2QA4 Z;  1VQ5 1;  1QVG Y;  3CCL Z;  1Q81 1;  3G71 1;  1S72 Z;  1VQP 1;  1NJI 2;  3G71 Z;  1YJW 1;  1VQK 1;  1YIJ 1;  1QVG Z;  2QEX Z;  1VQN 1;  3CCV 1;  3CXC Z;  1S72 1;  1W2B Z; 
#chains in the Genus database with same CATH topology
 2QA4 1;  3HOY I;  3HOZ I;  2QRC B;  4NBC A;  4A3F I;  2GTH A;  2W03 A;  3GTM I;  4QTU A;  1LQL A;  1WCM I;  1RQF A;  1VQP Z;  3KIH A;  3T4N B;  3CPW Z;  3M3Y I;  1Q7Y 2;  3CCM Z;  3CCJ Z;  1Z02 A;  2PM9 A;  3RZO I;  2Y0S A;  1JWH C;  5T64 A;  2JUB A;  4A3D I;  5FLM I;  3CCE 1;  2NVQ I;  4DQY B;  1Q86 1;  2NVY I;  2LEX A;  2P3Y A;  4NBB A;  3CC7 Z;  3HOX I;  2VPX A;  3NDI A;  3IR7 A;  3PO3 I;  4MD9 A;  1Q82 2;  2DE7 A;  1M1K 2;  1WW9 A;  3Q87 A;  1M1K 1;  3GKQ A;  3CCR 1;  1Q7Y 1;  2QLV B;  3CC2 Z;  1X0T A;  3NH4 A;  3G6E Z;  2JA7 I;  3OW2 Y;  2JS4 A;  1JJ2 Z;  1ZB9 A;  2IZ3 A;  2JIR A;  1NP6 A;  3J81 f;  5CM2 M;  4A93 I;  4DGL A;  3GTO I;  3CCV Z;  2E2H I;  3CD6 1;  3P5J B;  2VUG A;  1Z01 A;  1L1O C;  4NFR A;  3CCJ 1;  4RV9 A;  3GTG I;  4QTT A;  4MD8 A;  4BBR I;  4RVG A;  3F3F C;  1Q82 1;  3CC4 1;  1M90 2;  3NH5 A;  2WAQ A;  3J7A 4;  2ZAE B;  2RPR A;  1K73 1;  2K5R A;  1VQL Z;  2AYD A;  2I3C A;  1VQ9 1;  2RBL A;  2JA8 I;  2V45 A;  1VQN Z;  1RO2 A;  1KD1 2;  3GTM S;  1QVG Y;  4MH4 A;  3CCL Z;  4A3I I;  2B63 I;  1S72 Z;  3EED A;  3PO2 I;  3LUS A;  4Y52 I;  4NBA A;  1YIJ 1;  1RO0 A;  2GTI A;  3FKI I;  3JAM f;  3MON A;  3I4M I;  2VUM I;  1ZH1 A;  4MON A;  4NBD A;  1VQ5 Z;  1N8R 1;  4MXU A;  1N8R 2;  2E9H A;  3J80 b;  1KQS Y;  5A2Q b;  1K73 2;  3MZK B;  4E2W A;  2V8J A;  1VQ6 1;  4CL1 A;  2E7Z A;  2E2J I;  3S17 I;  1QF8 A;  1K8A 1;  3S14 I;  2NAP A;  3D2L A;  4MRI A;  2O4H A;  1VQM Z;  3TDH B;  3GCF A;  1YIT Z;  1YJN 1;  1Y1V S;  3I55 Z;  1VQ9 Z;  3NH8 A;  1TWF I;  1JJ2 Y;  1KRL A;  1YJW Z;  4NBE A;  1VLA A;  2JMO A;  3CCR Z;  1RLY A;  2QR1 B;  3TE5 B;  3U50 C;  3I56 Z;  1FDI A;  2JIM A;  1QVF Y;  2PK7 A;  1YJ9 1;  2EGT A;  1KD1 1;  3HOW I;  1K83 I;  3J80 f;  3G4S 1;  2OTL 1;  1Q86 2;  2JIO A;  3G4S Z;  1TWC I;  1FDO A;  3G6E 1;  1Z03 A;  3VMI A;  3M4O I;  3VB9 A;  1M90 1;  5LL6 f;  2Q4Z A;  2Q51 A;  2VF1 A;  1VQ8 1;  3GTQ I;  2AKL A;  2VPW A;  1I50 I;  4HGY A;  2K3R A;  2P28 A;  3CMA 1;  2RT9 A;  1W2B Z;  2F4O A;  1USP B;  4RVD A;  1YI2 1;  1S7M A;  2G2K A;  1YJN Z;  4RVH A;  4E30 A;  4A3B I;  3CXC Y;  1WII A;  2JIP A;  3I56 1;  3CCU Z;  4TNU A;  2QRE B;  3D9X A;  2KPI A;  2OZK A;  1Y1V I;  1Q81 1;  3G71 1;  2M48 A;  1VQP 1;  2H85 A;  3VMH A;  3S2H I;  2BJO A;  3S1M I;  4NH1 C;  3S2D I;  1QVG Z;  2J6A A;  4A3M I;  5IP9 I;  4E2X A;  3BG1 B;  3CC7 1;  2QKD A;  4A3L I;  3CCE Z;  5T6B A;  1VQ4 1;  1VQK Z;  2VPZ A;  2F4M A;  1WZN A;  1VQM 1;  1QYP A;  1K8A 2;  1Y1W I;  3CCQ 1;  4RS4 A;  4E2Y A;  1Q16 A;  1TWH I;  4S1T A;  3CMA Z;  1DL6 A;  3VMG A;  4E2Z A;  4RVF A;  1VQO 1;  4E33 A;  1YHQ Z;  4E32 A;  3GTK I;  1YUK A;  5C4J I;  1USP A;  3CPW Y;  4HGZ A;  1VQ7 Z;  2OTJ Z;  3CCS 1;  2WB1 A;  3IF8 A;  3FQM A;  2QEX 1;  1AA6 A;  1NJI 1;  2DE6 A;  3D6W A;  3FQQ A;  3CCU 1;  3IFU A;  1K9M 1;  3CME 1;  2JA6 I;  4A3G I;  3S1R I;  2R92 I;  1NUI A;  5C3E I;  1VQO Z;  5D1O B;  2YAD A;  4A3E I;  2JA5 I;  2QRD B;  4DK1 A;  4E31 A;  3PO3 S;  2R7Z I;  1X3W A;  5T67 A;  3CC2 1;  2HU9 A;  2IV2 X;  4BY7 I;  2JR6 A;  1YIT 1;  1PFT A;  3CME Z;  2E2I I;  4NB8 A;  2HF1 A;  3MZL B;  4A3J I;  2OOX B;  1YI2 Z;  3KIF A;  2O53 A;  1I3Q I;  3CD6 Z;  4Y7N I;  2V3V A;  5A2Q f;  5D1O A;  3JAM b;  2R93 I;  1YJ9 Z;  1VQ7 1;  1VQ4 Z;  1ML8 A;  1W2B Y;  2NVX I;  1YHQ 1;  4HH4 A;  3I4N I;  4BY1 I;  1QXF A;  3IX0 A;  1YJW 1;  2LIY A;  2VPY A;  4NOZ A;  2NVT I;  3CCV 1;  3CXC Z;  1KC8 2;  3H3V J;  4BXX I;  1KC8 1;  4NBF A;  2KI7 B;  1WJ2 A;  2PMZ A;  2IZ4 A;  3S1N I;  3OW2 Z;  3CCM 1;  3S1Q I;  2R6M A;  2V8K A;  3HKZ A;  1VQ8 Z;  3GTP I;  5IP7 I;  3CC4 Z;  1TFI A;  2LFU A;  5IT9 b;  3S15 I;  1N2F A;  1KQS Z;  1Y8C A;  5FLX f;  3RZD I;  2JIQ A;  4EWC A;  2OTL Z;  1R9T I;  4XX2 A;  3K7A I;  5C44 I;  3CCQ Z;  3VTN A;  1S72 1;  1VQ6 Z;  1QVF Z;  3HOU I;  1X3Z A;  1K9M 2;  3H0G I;  4BBS I;  5C4X I;  1TWA I;  4X6A I;  1P9N A;  4A3C I;  3CQZ I;  5FLX b;  2RIQ A;  1RNI A;  1YIJ Z;  4A3K I;  1SFO I;  1I6H I;  4NBH A;  3J81 b;  2YU9 I;  3CCL 1;  4NBG A;  2DE5 A;  5D1P A;  2GU2 A;  3I55 1;  2OOY B;  5IT9 f;  3NFZ A;  3NDJ A;  1Q81 2;  4MD7 A;  2JNY A;  2RHB A;  2V8I A;  2W04 A;  3CCS Z;  3S16 I;  2OTJ 1;  3BG0 B;  3QWU A;  1VQL 1;  3EER A;  1RO4 A;  2QA4 Z;  3F3P C;  1VQ5 1;  1SIW A;  1TWG I;  1NJI 2;  3G71 Z;  4NB9 A;  1VQK 1;  2M6N A;  1YUA A;  4AYB A;  3ESW A;  5AN9 F;  3GTJ I;  2QEX Z;  1VQN 1;  3GTL I;  3HOV I;  3I07 A;  1ZB8 A; 
#chains in the Genus database with same CATH homology
 2QA4 1;  3HOY I;  3HOZ I;  2QRC B;  4NBC A;  4A3F I;  2GTH A;  2W03 A;  3GTM I;  4QTU A;  1LQL A;  1WCM I;  1RQF A;  1VQP Z;  3KIH A;  3T4N B;  3CPW Z;  3M3Y I;  1Q7Y 2;  3CCM Z;  3CCJ Z;  1Z02 A;  2PM9 A;  3RZO I;  2Y0S A;  1JWH C;  5T64 A;  2JUB A;  4A3D I;  5FLM I;  3CCE 1;  2NVQ I;  4DQY B;  1Q86 1;  2NVY I;  2P3Y A;  4NBB A;  3CC7 Z;  3HOX I;  3NDI A;  3PO3 I;  4MD9 A;  1Q82 2;  2DE7 A;  1M1K 2;  1WW9 A;  3Q87 A;  1M1K 1;  3GKQ A;  3CCR 1;  1Q7Y 1;  2QLV B;  3CC2 Z;  1X0T A;  3NH4 A;  3G6E Z;  2JA7 I;  3OW2 Y;  2JS4 A;  1JJ2 Z;  1ZB9 A;  2IZ3 A;  1NP6 A;  3J81 f;  5CM2 M;  4A93 I;  4DGL A;  3GTO I;  3CCV Z;  2E2H I;  3CD6 1;  3P5J B;  2VUG A;  1Z01 A;  1L1O C;  4NFR A;  3CCJ 1;  4RV9 A;  3GTG I;  4QTT A;  4MD8 A;  4BBR I;  4RVG A;  3F3F C;  1Q82 1;  3CC4 1;  1M90 2;  3NH5 A;  2WAQ A;  3J7A 4;  2ZAE B;  2RPR A;  1K73 1;  2K5R A;  1VQL Z;  2I3C A;  1VQ9 1;  2RBL A;  2JA8 I;  1VQN Z;  1RO2 A;  1KD1 2;  3GTM S;  1QVG Y;  4MH4 A;  3CCL Z;  4A3I I;  2B63 I;  1S72 Z;  3EED A;  3PO2 I;  3LUS A;  4Y52 I;  4NBA A;  1YIJ 1;  1RO0 A;  2GTI A;  3FKI I;  3JAM f;  3MON A;  3I4M I;  2VUM I;  1ZH1 A;  4MON A;  4NBD A;  1VQ5 Z;  1N8R 1;  4MXU A;  1N8R 2;  2E9H A;  3J80 b;  1KQS Y;  5A2Q b;  1K73 2;  3MZK B;  4E2W A;  2V8J A;  1VQ6 1;  4CL1 A;  2E2J I;  3S17 I;  1QF8 A;  1K8A 1;  3S14 I;  4MRI A;  2O4H A;  1VQM Z;  3TDH B;  3GCF A;  1YIT Z;  1YJN 1;  1Y1V S;  3I55 Z;  1VQ9 Z;  3NH8 A;  1TWF I;  1JJ2 Y;  1KRL A;  1YJW Z;  3I07 A;  4NBE A;  1VLA A;  2JMO A;  3CCR Z;  1RLY A;  2QR1 B;  3TE5 B;  3U50 C;  3I56 Z;  1QVF Y;  2PK7 A;  1YJ9 1;  2EGT A;  1KD1 1;  3HOW I;  1K83 I;  3J80 f;  3G4S 1;  2OTL 1;  1Q86 2;  1TWC I;  3G4S Z;  3G6E 1;  1Z03 A;  3VMI A;  3M4O I;  3VB9 A;  1M90 1;  5LL6 f;  2Q4Z A;  2Q51 A;  2VF1 A;  1VQ8 1;  3GTQ I;  2AKL A;  1I50 I;  4HGY A;  2K3R A;  2P28 A;  3CMA 1;  2RT9 A;  2F4O A;  1USP B;  4RVD A;  1YI2 1;  1S7M A;  2G2K A;  1YJN Z;  4RVH A;  4E30 A;  4A3B I;  3CXC Y;  1WII A;  3I56 1;  3CCU Z;  4TNU A;  2QRE B;  3D9X A;  2KPI A;  2OZK A;  1Y1V I;  1Q81 1;  3G71 1;  2M48 A;  1VQP 1;  2H85 A;  3VMH A;  3S2H I;  2BJO A;  3S1M I;  4NH1 C;  3S2D I;  1QVG Z;  2J6A A;  4A3M I;  5IP9 I;  1ZB8 A;  4E2X A;  3BG1 B;  3CC7 1;  2QKD A;  4A3L I;  3CCE Z;  5T6B A;  1VQ4 1;  1VQK Z;  2F4M A;  1VQM 1;  1QYP A;  1K8A 2;  1Y1W I;  3CCQ 1;  4RS4 A;  4E2Y A;  1TWH I;  4S1T A;  3CMA Z;  1DL6 A;  3VMG A;  4E2Z A;  4RVF A;  1VQO 1;  4E33 A;  1YHQ Z;  4E32 A;  3GTK I;  1YUK A;  5C4J I;  1USP A;  3CPW Y;  4HGZ A;  1VQ7 Z;  2OTJ Z;  3CCS 1;  2WB1 A;  3IF8 A;  3FQM A;  2QEX 1;  1NJI 1;  2DE6 A;  3D6W A;  3FQQ A;  3CCU 1;  3IFU A;  1K9M 1;  3CME 1;  2JA6 I;  4A3G I;  3S1R I;  2R92 I;  1NUI A;  5C3E I;  1VQO Z;  5D1O B;  2YAD A;  4A3E I;  2JA5 I;  2QRD B;  4DK1 A;  4E31 A;  3PO3 S;  2R7Z I;  1X3W A;  5T67 A;  3CC2 1;  2HU9 A;  4BY7 I;  2JR6 A;  1YIT 1;  1PFT A;  3CME Z;  2E2I I;  4NB8 A;  2HF1 A;  3MZL B;  4A3J I;  2OOX B;  1YI2 Z;  3KIF A;  2O53 A;  1I3Q I;  3CD6 Z;  4Y7N I;  5A2Q f;  5D1O A;  3JAM b;  2R93 I;  1YJ9 Z;  1VQ7 1;  1VQ4 Z;  1ML8 A;  1W2B Y;  2NVX I;  1YHQ 1;  4HH4 A;  3I4N I;  4BY1 I;  3IX0 A;  1YJW 1;  2LIY A;  4NOZ A;  2NVT I;  3CCV 1;  3CXC Z;  1KC8 2;  3H3V J;  4BXX I;  1KC8 1;  4NBF A;  2KI7 B;  2PMZ A;  2IZ4 A;  3S1N I;  3OW2 Z;  3CCM 1;  3S1Q I;  2R6M A;  2V8K A;  3HKZ A;  1VQ8 Z;  3GTP I;  5IP7 I;  3CC4 Z;  1TFI A;  2LFU A;  5IT9 b;  3S15 I;  1N2F A;  1KQS Z;  5FLX f;  3RZD I;  4EWC A;  2OTL Z;  1R9T I;  4XX2 A;  3K7A I;  5C44 I;  3CCQ Z;  3VTN A;  1VQ6 Z;  1QVF Z;  3HOU I;  1X3Z A;  1K9M 2;  3H0G I;  4BBS I;  5C4X I;  1TWA I;  4X6A I;  1P9N A;  4A3C I;  3CQZ I;  5FLX b;  2RIQ A;  1RNI A;  1YIJ Z;  4A3K I;  1SFO I;  1I6H I;  4NBH A;  3J81 b;  2YU9 I;  3CCL 1;  4NBG A;  2DE5 A;  5D1P A;  2GU2 A;  3I55 1;  2OOY B;  5IT9 f;  3NFZ A;  3NDJ A;  1Q81 2;  4MD7 A;  2JNY A;  2RHB A;  2V8I A;  2W04 A;  3CCS Z;  3S16 I;  2OTJ 1;  3BG0 B;  3QWU A;  1VQL 1;  3EER A;  1RO4 A;  2QA4 Z;  3F3P C;  1VQ5 1;  1TWG I;  1NJI 2;  3G71 Z;  4NB9 A;  1VQK 1;  2M6N A;  1YUA A;  4AYB A;  3ESW A;  5AN9 F;  3GTJ I;  2QEX Z;  1VQN 1;  3GTL I;  3HOV I;  1S72 1;  1W2B Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...