3CC71

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation c2487u
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3cc7100
3I56Z 1S721 1Q7Y2 3CCJZ 3CCM1 1YJNZ 1VQPZ 1Q811 1Q862 1VQ51 1QVGY 3I551 1NJI1 3CCJ1 2QEXZ 1VQLZ 1KD11 1K732 2OTLZ 1VQ6Z 1VQK1 1K8A2 1YJ9Z 1JJ2Y 1YHQ1 1VQL1 3G6E1 1M901 2OTJZ 3CCRZ 1VQNZ 2QA4Z 1K9M1 1VQ41 3CC21 3G71Z 3CC4Z 3CPWZ 1VQ7Z 3I561 3CCEZ 3G4SZ 1W2BY 1KQSY 3CD6Z 1Q812 1YJN1 1VQ8Z 1VQP1 1NJI2 3CCE1 3CMEZ 1YJWZ 3CCSZ 1KD12 2QEX1 2OTL1 1VQMZ 1VQ61 1YJ91 1VQ9Z 3CCUZ 1M1K1 1QVFZ 1KC81 1M902 1N8R1 3CC7Z 2OTJ1 3CCR1 3CXCZ 3CCQZ 1VQN1 1N8R2 1K9M2 3OW2Z 3CCVZ 2QA41 1YI2Z 3G711 3CC41 1YITZ 1Q821 1VQ71 3CD61 3G4S1 1S72Z 3CXCY 3CPWY 3OW2Y 3CCLZ 1VQ81 3CCMZ 1Q7Y1 3CMAZ 3CME1 1YJW1 3CCS1 1VQ5Z 1YIJZ 3CCL1 3I55Z 1Q861 3CMA1 1M1K2 1JJ2Z 1VQM1 1KC82 1VQ91 3CCU1 1YIJ1 1VQKZ 1K731 1K8A1 3CC71 1VQOZ 1YHQZ 1QVFY 3G6EZ 3CCQ1 3CCV1 1YI21 1VQO1 1Q822 1YIT1 1VQ4Z 1W2BZ 3CC2Z 1KQSZ 1QVGZ
chains in the Genus database with same CATH superfamily
3I56Z 4A3BI 1Q16A 3CCM1 1K83I 2QKDA 2WB1A 4A3CI 1NP6A 4E2XA 3KIFA 3K7AI 4EWCA 3PO3S 3KIHA 2RT9A 3D6WA 3IFUA 4RVHA 2BJOA 3TE5B 3H3VJ 2QEXZ 1VQ6Z 4NH1C 2RHBA 4AYBA 1K8A2 1YJ9Z 1VQK1 4BY1I 1YHQ1 1LQLA 2VPXA 4NFRA 3G6E1 1VQL1 1RQFA 3S1NI 5C3EI 3CQZI 3NDJA 1K9M1 3S15I 3TDHB 2NVTI 3FQQA 4A3DI 4RV9A 1TWAI 1W2BY 4HGYA 5C4JI 1RLYA 1VQ8Z 3M4OI 3CCE1 2G2KA 1YJWZ 1QYPA 1Y1WI 1PFTA 1VQMZ 1Z02A 2DE7A 3CCR1 2JA5I 3CCQZ 2V45A 3I07A 2LEXA 1K9M2 2F4OA 2E2JI 3I4NI 3CCVZ 2R93I 3FKII 4A3EI 1S7MA 2KI7B 1Q821 3GTQI 4BBRI 2K5RA 3CXCY 3CPWY 1RO2A 1ZB9A 1RO0A 4QTUA 3CMAZ 4NBCA 2JIOA 3I55Z 1Q861 3VMHA 3S1MI 1Y1VI 1VQ91 4CL1A 3U50C 2VPZA 2F4MA 2O4HA 4RS4A 2E7ZA 3NDIA 1VQO1 2JIQA 1Q822 1NUIA 2O53A 1W2BZ 3CC2Z 4NBDA 2Y0SA 3S1RI 2JUBA 4MONA 1S721 2P28A 2NVYI 2Q51A 3J80f 4E30A 2PK7A 2RIQA 4RVDA 3EEDA 1VQPZ 1Q811 1Q862 3LUSA 1NJI1 2W04A 2GTIA 5FLXf 3IF8A 1KD11 1WJ2A 4MH4A 2EGTA 3MONA 2R7ZI 5IT9b 1JJ2Y 1FDIA 1FDOA 1VQNZ 1DL6A 4E33A 2QA4Z 3BG0B 2IV2X 1VQ41 3GTGI 3G71Z 2PMZA 3J80b 3CPWZ 1VQ7Z 1TWHI 3CD6Z 1KQSY 2DE5A 4E2WA 1Q812 1YJN1 1ZH1A 5FLXb 1I50I 1NJI2 3P5JB 4QTTA 1USPA 1Z03A 4E31A 1KD12 2HF1A 3NH8A 3MZKB 1RO4A 3HKZA 1X3WA 4NB9A 2GTHA 2OTL1 3NFZA 1KC81 2PM9A 3GTOI 1JWHC 4NBBA 2OTJ1 2VUMI 3VB9A 3S16I 4S1TA 1N8R2 3JAMf 2QRDB 4A3JI 1I3QI 3CC41 1YUAA 1YITZ 4A3LI 4A3II 3I4MI 2V8JA 4E2ZA 3G4S1 1WIIA 2RBLA 4A3FI 3H0GI 3OW2Y 5CM2M 2V8KA 3GTJI 3ESWA 3CCMZ 1Q7Y1 4NBFA 3GTKI 3CME1 3CCS1 1YIJZ 2R6MA 2LFUA 3CMA1 2OOXB 1KC82 1JJ2Z 3CCU1 1VQKZ 2R92I 3JAMb 4BXXI 3CC71 1YHQZ 1QVFY 3G6EZ 3EERA 3HOUI 1QF8A 3VMIA 1YI21 3Q87A 4E2YA 4E32A 1KQSZ 2JS4A 5D1OB 1Q7Y2 1WZNA 5D1PA 3CCJZ 2E2HI 4A3MI 1L1OC 4A3KI 1VQ51 1QVGY 4X6AI 3IR7A 3GTPI 5IT9f 4NBEA 1QXFA 1M901 3CCRZ 4NBAA 3D9XA 1SIWA 3S17I 4RVGA 1AA6A 2JNYA 1YUKA 2KPIA 3I561 1TWGI 2M48A 3BG1B 3HOYI 2V3VA 3GCFA 2K3RA 1R9TI 2OOYB 2I3CA 2QRCB 3NH4A 2QEX1 3HOXI 1VQ61 3VMGA 1VQ9Z 1YJ91 1QVFZ 1N2FA 4MRIA 5T6BA 1M902 2AKLA 3S14I 4MD8A 1N8R1 2W03A 3CXCZ 2P3YA 2NVXI 3HOVI 2NVQI 1X0TA 4RVFA 3VTNA 1VLAA 2VF1A 1S72Z 3IX0A 2VUGA 3CCLZ 1VQ81 4HH4A 1YJW1 4TNUA 1WW9A 3S2DI 2JA6I 2RPRA 1VQM1 2GU2A 2J6AA 3HOZI 4NB8A 1YIJ1 2VPWA 4NOZA 1K731 4BY7I 3S2HI 2YU9I 3RZDI 2JIRA 4DQYB 3CCQ1 4MXUA 5A2Qf 3CCV1 3PO2I 1KRLA 5T67A 4DGLA 1RNIA 3GTMS 1VQ4Z 2JR6A 3D2LA 5IP7I 2IZ4A 1YJNZ 3QWUA 3I551 3CCJ1 1SFOI 2E9HA 1VQLZ 1X3ZA 1K732 2OTLZ 2JA7I 1ML8A 5A2Qb 2JIPA 3F3PC 2QLVB 2VPYA 3FQMA 2DE6A 3J81f 2OTJZ 1WCMI 3S1QI 4DK1A 5AN9F 2WAQA 3CC21 2ZAEB 3CC4Z 4MD7A 5T64A 3GKQA 1TWFI 3CCEZ 3G4SZ 4NBGA 1VQP1 3GTLI 2V8IA 3CMEZ 3CCSZ 4A3GI 2H85A 3J81b 2JA8I 2YADA 1Y8CA 3CCUZ 1ZB8A 1M1K1 2HU9A 4BBSI 4A93I 3T4NB 3HOWI 3CC7Z 5FLMI 2Q4ZA 2LIYA 5LL6f 1VQN1 3OW2Z 2QA41 1YI2Z 3J7A4 2M6NA 3MZLB 3G711 3NH5A 1VQ71 2E2II 2JMOA 3CD61 1USPB 2QREB 2AYDA 1P9NA 4HGZA 3RZOI 2OZKA 1Z01A 5D1OA 1VQ5Z 3M3YI 3F3FC 3CCL1 5C4XI 1Y1VS 5C44I 4XX2A 1M1K2 1TWCI 4MD9A 4NBHA 3PO3I 4Y7NI 1K8A1 1VQOZ 4Y52I 2IZ3A 2B63I 5IP9I 2NAPA 1TFIA 1YIT1 2QR1B 1QVGZ 3GTMI 1I6HI 2JIMA
chains in the Genus database with same CATH topology
3I56Z 4A3BI 3CCM1 1K83I 2QKDA 2WB1A 4A3CI 1NP6A 4E2XA 3KIFA 3K7AI 4EWCA 3PO3S 3KIHA 2RT9A 3D6WA 3IFUA 4RVHA 2BJOA 3TE5B 3H3VJ 2QEXZ 1VQ6Z 4NH1C 2RHBA 4AYBA 1K8A2 1YJ9Z 1VQK1 4BY1I 1YHQ1 1LQLA 1VQL1 4NFRA 3G6E1 1RQFA 3S1NI 5C3EI 3CQZI 3NDJA 1K9M1 3S15I 3TDHB 2NVTI 3FQQA 4A3DI 4RV9A 1TWAI 1W2BY 4HGYA 5C4JI 1RLYA 1VQ8Z 3M4OI 3CCE1 2G2KA 1YJWZ 1QYPA 1Y1WI 1PFTA 1VQMZ 1Z02A 2DE7A 3CCR1 2JA5I 3CCQZ 1K9M2 3I07A 2E2JI 2F4OA 3I4NI 3CCVZ 2R93I 3FKII 4A3EI 1S7MA 2KI7B 1Q821 3GTQI 4BBRI 2K5RA 3CXCY 3CPWY 1RO2A 1ZB9A 1RO0A 4QTUA 3CMAZ 4NBCA 3I55Z 1Q861 3VMHA 3S1MI 1Y1VI 1VQ91 4CL1A 3U50C 2F4MA 2O4HA 4RS4A 3NDIA 1VQO1 1Q822 1NUIA 2O53A 1W2BZ 3CC2Z 4NBDA 2Y0SA 3S1RI 2JUBA 4MONA 1S721 2P28A 2NVYI 2Q51A 3J80f 4E30A 2PK7A 2RIQA 4RVDA 3EEDA 1VQPZ 1Q811 1Q862 3LUSA 1NJI1 2W04A 2GTIA 5FLXf 3IF8A 1KD11 4MH4A 2EGTA 3MONA 2R7ZI 5IT9b 1JJ2Y 1VQNZ 1DL6A 4E33A 2QA4Z 3BG0B 1VQ41 3GTGI 3G71Z 2PMZA 3J80b 3CPWZ 1VQ7Z 1TWHI 3CD6Z 1KQSY 2DE5A 4E2WA 1Q812 1YJN1 1ZH1A 5FLXb 1I50I 1NJI2 3P5JB 4QTTA 1USPA 1Z03A 4E31A 1KD12 2HF1A 3NH8A 3MZKB 1RO4A 3HKZA 1X3WA 4NB9A 2GTHA 2OTL1 3NFZA 1KC81 2PM9A 3GTOI 1JWHC 4NBBA 2OTJ1 2VUMI 3VB9A 3S16I 4S1TA 1N8R2 3JAMf 2QRDB 4A3JI 1I3QI 3CC41 1YUAA 1YITZ 4A3LI 4A3II 3I4MI 2V8JA 4E2ZA 3G4S1 1WIIA 2RBLA 4A3FI 3H0GI 3OW2Y 5CM2M 2V8KA 3GTJI 3ESWA 3CCMZ 1Q7Y1 4NBFA 3GTKI 3CME1 3CCS1 1YIJZ 2R6MA 2LFUA 3CMA1 2OOXB 1KC82 1JJ2Z 3CCU1 1VQKZ 2R92I 3JAMb 4BXXI 3CC71 1YHQZ 1QVFY 3G6EZ 3EERA 3HOUI 1QF8A 3VMIA 1YI21 3Q87A 4E2YA 4E32A 1KQSZ 2JS4A 5D1OB 1Q7Y2 5D1PA 3CCJZ 2E2HI 4A3MI 1L1OC 4A3KI 1VQ51 1QVGY 4X6AI 3GTPI 5IT9f 4NBEA 1M901 3CCRZ 4NBAA 3D9XA 3S17I 4RVGA 2JNYA 1YUKA 2KPIA 3I561 1TWGI 2M48A 3BG1B 3HOYI 3GCFA 2K3RA 1R9TI 2OOYB 2I3CA 2QRCB 3NH4A 2QEX1 3HOXI 1VQ61 3VMGA 1VQ9Z 1YJ91 1QVFZ 1N2FA 4MRIA 5T6BA 1M902 2AKLA 3S14I 4MD8A 1N8R1 2W03A 3CXCZ 2P3YA 2NVXI 3HOVI 2NVQI 1X0TA 4RVFA 3VTNA 1VLAA 2VF1A 1S72Z 3IX0A 2VUGA 3CCLZ 1VQ81 4HH4A 1YJW1 4TNUA 1WW9A 3S2DI 2JA6I 2RPRA 1VQM1 2GU2A 2J6AA 3HOZI 4NB8A 1YIJ1 4NOZA 1K731 4BY7I 3S2HI 2YU9I 3RZDI 4DQYB 3CCQ1 4MXUA 5A2Qf 3CCV1 3PO2I 1KRLA 5T67A 4DGLA 1RNIA 3GTMS 1VQ4Z 2JR6A 5IP7I 2IZ4A 1YJNZ 3QWUA 3I551 3CCJ1 1SFOI 2E9HA 1VQLZ 1X3ZA 1K732 2OTLZ 2JA7I 1ML8A 5A2Qb 3F3PC 2QLVB 3FQMA 2DE6A 3J81f 2OTJZ 1WCMI 3S1QI 4DK1A 5AN9F 2WAQA 3CC21 2ZAEB 3CC4Z 4MD7A 5T64A 3GKQA 1TWFI 3CCEZ 3G4SZ 4NBGA 1VQP1 3GTLI 2V8IA 3CMEZ 3CCSZ 4A3GI 2H85A 3J81b 2JA8I 2YADA 3CCUZ 1ZB8A 1M1K1 2HU9A 4BBSI 4A93I 3T4NB 3HOWI 3CC7Z 5FLMI 2Q4ZA 2LIYA 5LL6f 1VQN1 3OW2Z 2QA41 1YI2Z 3J7A4 2M6NA 3MZLB 3G711 3NH5A 1VQ71 2E2II 2JMOA 3CD61 1USPB 2QREB 1P9NA 4HGZA 3RZOI 2OZKA 1Z01A 5D1OA 1VQ5Z 3M3YI 3F3FC 3CCL1 5C4XI 1Y1VS 5C44I 4XX2A 1M1K2 1TWCI 4MD9A 4NBHA 3PO3I 4Y7NI 1K8A1 1VQOZ 4Y52I 2IZ3A 2B63I 5IP9I 1TFIA 1YIT1 2QR1B 1QVGZ 3GTMI 1I6HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Z;  1S72 1;  1Q7Y 2;  3CCJ Z;  3CCM 1;  1YJN Z;  1VQP Z;  1Q81 1;  1Q86 2;  1VQ5 1;  1QVG Y;  3I55 1;  1NJI 1;  3CCJ 1;  2QEX Z;  1VQL Z;  1KD1 1;  1K73 2;  2OTL Z;  1VQ6 Z;  1VQK 1;  1K8A 2;  1YJ9 Z;  1JJ2 Y;  1YHQ 1;  1VQL 1;  3G6E 1;  1M90 1;  2OTJ Z;  3CCR Z;  1VQN Z;  2QA4 Z;  1K9M 1;  1VQ4 1;  3CC2 1;  3G71 Z;  3CC4 Z;  3CPW Z;  1VQ7 Z;  3I56 1;  3CCE Z;  3G4S Z;  1W2B Y;  1KQS Y;  3CD6 Z;  1Q81 2;  1YJN 1;  1VQ8 Z;  1VQP 1;  1NJI 2;  3CCE 1;  3CME Z;  1YJW Z;  3CCS Z;  1KD1 2;  2QEX 1;  2OTL 1;  1VQM Z;  1VQ6 1;  1YJ9 1;  1VQ9 Z;  3CCU Z;  1M1K 1;  1QVF Z;  1KC8 1;  1M90 2;  1N8R 1;  3CC7 Z;  2OTJ 1;  3CCR 1;  3CXC Z;  3CCQ Z;  1VQN 1;  1N8R 2;  1K9M 2;  3OW2 Z;  3CCV Z;  2QA4 1;  1YI2 Z;  3G71 1;  3CC4 1;  1YIT Z;  1Q82 1;  1VQ7 1;  3CD6 1;  3G4S 1;  1S72 Z;  3CXC Y;  3CPW Y;  3OW2 Y;  3CCL Z;  1VQ8 1;  3CCM Z;  1Q7Y 1;  3CMA Z;  3CME 1;  1YJW 1;  3CCS 1;  1VQ5 Z;  1YIJ Z;  3CCL 1;  3I55 Z;  1Q86 1;  3CMA 1;  1M1K 2;  1JJ2 Z;  1VQM 1;  1KC8 2;  1VQ9 1;  3CCU 1;  1YIJ 1;  1VQK Z;  1K73 1;  1K8A 1;  3CC7 1;  1VQO Z;  1YHQ Z;  1QVF Y;  3G6E Z;  3CCQ 1;  3CCV 1;  1YI2 1;  1VQO 1;  1Q82 2;  1YIT 1;  1VQ4 Z;  1W2B Z;  3CC2 Z;  1KQS Z;  1QVG Z; 
#chains in the Genus database with same CATH topology
 3I56 Z;  4A3B I;  1Q16 A;  3CCM 1;  1K83 I;  2QKD A;  2WB1 A;  4A3C I;  1NP6 A;  4E2X A;  3KIF A;  3K7A I;  4EWC A;  3PO3 S;  3KIH A;  2RT9 A;  3D6W A;  3IFU A;  4RVH A;  2BJO A;  3TE5 B;  3H3V J;  2QEX Z;  1VQ6 Z;  4NH1 C;  2RHB A;  4AYB A;  1K8A 2;  1YJ9 Z;  1VQK 1;  4BY1 I;  1YHQ 1;  1LQL A;  2VPX A;  4NFR A;  3G6E 1;  1VQL 1;  1RQF A;  3S1N I;  5C3E I;  3CQZ I;  3NDJ A;  1K9M 1;  3S15 I;  3TDH B;  2NVT I;  3FQQ A;  4A3D I;  4RV9 A;  1TWA I;  1W2B Y;  4HGY A;  5C4J I;  1RLY A;  1VQ8 Z;  3M4O I;  3CCE 1;  2G2K A;  1YJW Z;  1QYP A;  1Y1W I;  1PFT A;  1VQM Z;  1Z02 A;  2DE7 A;  3CCR 1;  2JA5 I;  3CCQ Z;  2V45 A;  3I07 A;  2LEX A;  1K9M 2;  2F4O A;  2E2J I;  3I4N I;  3CCV Z;  2R93 I;  3FKI I;  4A3E I;  1S7M A;  2KI7 B;  1Q82 1;  3GTQ I;  4BBR I;  2K5R A;  3CXC Y;  3CPW Y;  1RO2 A;  1ZB9 A;  1RO0 A;  4QTU A;  3CMA Z;  4NBC A;  2JIO A;  3I55 Z;  1Q86 1;  3VMH A;  3S1M I;  1Y1V I;  1VQ9 1;  4CL1 A;  3U50 C;  2VPZ A;  2F4M A;  2O4H A;  4RS4 A;  2E7Z A;  3NDI A;  1VQO 1;  2JIQ A;  1Q82 2;  1NUI A;  2O53 A;  1W2B Z;  3CC2 Z;  4NBD A;  2Y0S A;  3S1R I;  2JUB A;  4MON A;  1S72 1;  2P28 A;  2NVY I;  2Q51 A;  3J80 f;  4E30 A;  2PK7 A;  2RIQ A;  4RVD A;  3EED A;  1VQP Z;  1Q81 1;  1Q86 2;  3LUS A;  1NJI 1;  2W04 A;  2GTI A;  5FLX f;  3IF8 A;  1KD1 1;  1WJ2 A;  4MH4 A;  2EGT A;  3MON A;  2R7Z I;  5IT9 b;  1JJ2 Y;  1FDI A;  1FDO A;  1VQN Z;  1DL6 A;  4E33 A;  2QA4 Z;  3BG0 B;  2IV2 X;  1VQ4 1;  3GTG I;  3G71 Z;  2PMZ A;  3J80 b;  3CPW Z;  1VQ7 Z;  1TWH I;  3CD6 Z;  1KQS Y;  2DE5 A;  4E2W A;  1Q81 2;  1YJN 1;  1ZH1 A;  5FLX b;  1I50 I;  1NJI 2;  3P5J B;  4QTT A;  1USP A;  1Z03 A;  4E31 A;  1KD1 2;  2HF1 A;  3NH8 A;  3MZK B;  1RO4 A;  3HKZ A;  1X3W A;  4NB9 A;  2GTH A;  2OTL 1;  3NFZ A;  1KC8 1;  2PM9 A;  3GTO I;  1JWH C;  4NBB A;  2OTJ 1;  2VUM I;  3VB9 A;  3S16 I;  4S1T A;  1N8R 2;  3JAM f;  2QRD B;  4A3J I;  1I3Q I;  3CC4 1;  1YUA A;  1YIT Z;  4A3L I;  4A3I I;  3I4M I;  2V8J A;  4E2Z A;  3G4S 1;  1WII A;  2RBL A;  4A3F I;  3H0G I;  3OW2 Y;  5CM2 M;  2V8K A;  3GTJ I;  3ESW A;  3CCM Z;  1Q7Y 1;  4NBF A;  3GTK I;  3CME 1;  3CCS 1;  1YIJ Z;  2R6M A;  2LFU A;  3CMA 1;  2OOX B;  1KC8 2;  1JJ2 Z;  3CCU 1;  1VQK Z;  2R92 I;  3JAM b;  4BXX I;  3CC7 1;  1YHQ Z;  1QVF Y;  3G6E Z;  3EER A;  3HOU I;  1QF8 A;  3VMI A;  1YI2 1;  3Q87 A;  4E2Y A;  4E32 A;  1KQS Z;  2JS4 A;  5D1O B;  1Q7Y 2;  1WZN A;  5D1P A;  3CCJ Z;  2E2H I;  4A3M I;  1L1O C;  4A3K I;  1VQ5 1;  1QVG Y;  4X6A I;  3IR7 A;  3GTP I;  5IT9 f;  4NBE A;  1QXF A;  1M90 1;  3CCR Z;  4NBA A;  3D9X A;  1SIW A;  3S17 I;  4RVG A;  1AA6 A;  2JNY A;  1YUK A;  2KPI A;  3I56 1;  1TWG I;  2M48 A;  3BG1 B;  3HOY I;  2V3V A;  3GCF A;  2K3R A;  1R9T I;  2OOY B;  2I3C A;  2QRC B;  3NH4 A;  2QEX 1;  3HOX I;  1VQ6 1;  3VMG A;  1VQ9 Z;  1YJ9 1;  1QVF Z;  1N2F A;  4MRI A;  5T6B A;  1M90 2;  2AKL A;  3S14 I;  4MD8 A;  1N8R 1;  2W03 A;  3CXC Z;  2P3Y A;  2NVX I;  3HOV I;  2NVQ I;  1X0T A;  4RVF A;  3VTN A;  1VLA A;  2VF1 A;  1S72 Z;  3IX0 A;  2VUG A;  3CCL Z;  1VQ8 1;  4HH4 A;  1YJW 1;  4TNU A;  1WW9 A;  3S2D I;  2JA6 I;  2RPR A;  1VQM 1;  2GU2 A;  2J6A A;  3HOZ I;  4NB8 A;  1YIJ 1;  2VPW A;  4NOZ A;  1K73 1;  4BY7 I;  3S2H I;  2YU9 I;  3RZD I;  2JIR A;  4DQY B;  3CCQ 1;  4MXU A;  5A2Q f;  3CCV 1;  3PO2 I;  1KRL A;  5T67 A;  4DGL A;  1RNI A;  3GTM S;  1VQ4 Z;  2JR6 A;  3D2L A;  5IP7 I;  2IZ4 A;  1YJN Z;  3QWU A;  3I55 1;  3CCJ 1;  1SFO I;  2E9H A;  1VQL Z;  1X3Z A;  1K73 2;  2OTL Z;  2JA7 I;  1ML8 A;  5A2Q b;  2JIP A;  3F3P C;  2QLV B;  2VPY A;  3FQM A;  2DE6 A;  3J81 f;  2OTJ Z;  1WCM I;  3S1Q I;  4DK1 A;  5AN9 F;  2WAQ A;  3CC2 1;  2ZAE B;  3CC4 Z;  4MD7 A;  5T64 A;  3GKQ A;  1TWF I;  3CCE Z;  3G4S Z;  4NBG A;  1VQP 1;  3GTL I;  2V8I A;  3CME Z;  3CCS Z;  4A3G I;  2H85 A;  3J81 b;  2JA8 I;  2YAD A;  1Y8C A;  3CCU Z;  1ZB8 A;  1M1K 1;  2HU9 A;  4BBS I;  4A93 I;  3T4N B;  3HOW I;  3CC7 Z;  5FLM I;  2Q4Z A;  2LIY A;  5LL6 f;  1VQN 1;  3OW2 Z;  2QA4 1;  1YI2 Z;  3J7A 4;  2M6N A;  3MZL B;  3G71 1;  3NH5 A;  1VQ7 1;  2E2I I;  2JMO A;  3CD6 1;  1USP B;  2QRE B;  2AYD A;  1P9N A;  4HGZ A;  3RZO I;  2OZK A;  1Z01 A;  5D1O A;  1VQ5 Z;  3M3Y I;  3F3F C;  3CCL 1;  5C4X I;  1Y1V S;  5C44 I;  4XX2 A;  1M1K 2;  1TWC I;  4MD9 A;  4NBH A;  3PO3 I;  4Y7N I;  1K8A 1;  1VQO Z;  4Y52 I;  2IZ3 A;  2B63 I;  5IP9 I;  2NAP A;  1TFI A;  1YIT 1;  2QR1 B;  1QVG Z;  3GTM I;  1I6H I;  2JIM A; 
#chains in the Genus database with same CATH homology
 3I56 Z;  4A3B I;  3CCM 1;  1K83 I;  2QKD A;  2WB1 A;  4A3C I;  1NP6 A;  4E2X A;  3KIF A;  3K7A I;  4EWC A;  3PO3 S;  3KIH A;  2RT9 A;  3D6W A;  3IFU A;  4RVH A;  2BJO A;  3TE5 B;  3H3V J;  2QEX Z;  1VQ6 Z;  4NH1 C;  2RHB A;  4AYB A;  1K8A 2;  1YJ9 Z;  1VQK 1;  4BY1 I;  1YHQ 1;  1LQL A;  1VQL 1;  4NFR A;  3G6E 1;  1RQF A;  3S1N I;  5C3E I;  3CQZ I;  3NDJ A;  1K9M 1;  3S15 I;  3TDH B;  2NVT I;  3FQQ A;  4A3D I;  4RV9 A;  1TWA I;  1W2B Y;  4HGY A;  5C4J I;  1RLY A;  1VQ8 Z;  3M4O I;  3CCE 1;  2G2K A;  1YJW Z;  1QYP A;  1Y1W I;  1PFT A;  1VQM Z;  1Z02 A;  2DE7 A;  3CCR 1;  2JA5 I;  3CCQ Z;  1K9M 2;  3I07 A;  2E2J I;  2F4O A;  3I4N I;  3CCV Z;  2R93 I;  3FKI I;  4A3E I;  1S7M A;  2KI7 B;  1Q82 1;  3GTQ I;  4BBR I;  2K5R A;  3CXC Y;  3CPW Y;  1RO2 A;  1ZB9 A;  1RO0 A;  4QTU A;  3CMA Z;  4NBC A;  3I55 Z;  1Q86 1;  3VMH A;  3S1M I;  1Y1V I;  1VQ9 1;  4CL1 A;  3U50 C;  2F4M A;  2O4H A;  4RS4 A;  3NDI A;  1VQO 1;  1Q82 2;  1NUI A;  2O53 A;  1W2B Z;  3CC2 Z;  4NBD A;  2Y0S A;  3S1R I;  2JUB A;  4MON A;  1S72 1;  2P28 A;  2NVY I;  2Q51 A;  3J80 f;  4E30 A;  2PK7 A;  2RIQ A;  4RVD A;  3EED A;  1VQP Z;  1Q81 1;  1Q86 2;  3LUS A;  1NJI 1;  2W04 A;  2GTI A;  5FLX f;  3IF8 A;  1KD1 1;  4MH4 A;  2EGT A;  3MON A;  2R7Z I;  5IT9 b;  1JJ2 Y;  1VQN Z;  1DL6 A;  4E33 A;  2QA4 Z;  3BG0 B;  1VQ4 1;  3GTG I;  3G71 Z;  2PMZ A;  3J80 b;  3CPW Z;  1VQ7 Z;  1TWH I;  3CD6 Z;  1KQS Y;  2DE5 A;  4E2W A;  1Q81 2;  1YJN 1;  1ZH1 A;  5FLX b;  1I50 I;  1NJI 2;  3P5J B;  4QTT A;  1USP A;  1Z03 A;  4E31 A;  1KD1 2;  2HF1 A;  3NH8 A;  3MZK B;  1RO4 A;  3HKZ A;  1X3W A;  4NB9 A;  2GTH A;  2OTL 1;  3NFZ A;  1KC8 1;  2PM9 A;  3GTO I;  1JWH C;  4NBB A;  2OTJ 1;  2VUM I;  3VB9 A;  3S16 I;  4S1T A;  1N8R 2;  3JAM f;  2QRD B;  4A3J I;  1I3Q I;  3CC4 1;  1YUA A;  1YIT Z;  4A3L I;  4A3I I;  3I4M I;  2V8J A;  4E2Z A;  3G4S 1;  1WII A;  2RBL A;  4A3F I;  3H0G I;  3OW2 Y;  5CM2 M;  2V8K A;  3GTJ I;  3ESW A;  3CCM Z;  1Q7Y 1;  4NBF A;  3GTK I;  3CME 1;  3CCS 1;  1YIJ Z;  2R6M A;  2LFU A;  3CMA 1;  2OOX B;  1KC8 2;  1JJ2 Z;  3CCU 1;  1VQK Z;  2R92 I;  3JAM b;  4BXX I;  3CC7 1;  1YHQ Z;  1QVF Y;  3G6E Z;  3EER A;  3HOU I;  1QF8 A;  3VMI A;  1YI2 1;  3Q87 A;  4E2Y A;  4E32 A;  1KQS Z;  2JS4 A;  5D1O B;  1Q7Y 2;  5D1P A;  3CCJ Z;  2E2H I;  4A3M I;  1L1O C;  4A3K I;  1VQ5 1;  1QVG Y;  4X6A I;  3GTP I;  5IT9 f;  4NBE A;  1M90 1;  3CCR Z;  4NBA A;  3D9X A;  3S17 I;  4RVG A;  2JNY A;  1YUK A;  2KPI A;  3I56 1;  1TWG I;  2M48 A;  3BG1 B;  3HOY I;  3GCF A;  2K3R A;  1R9T I;  2OOY B;  2I3C A;  2QRC B;  3NH4 A;  2QEX 1;  3HOX I;  1VQ6 1;  3VMG A;  1VQ9 Z;  1YJ9 1;  1QVF Z;  1N2F A;  4MRI A;  5T6B A;  1M90 2;  2AKL A;  3S14 I;  4MD8 A;  1N8R 1;  2W03 A;  3CXC Z;  2P3Y A;  2NVX I;  3HOV I;  2NVQ I;  1X0T A;  4RVF A;  3VTN A;  1VLA A;  2VF1 A;  1S72 Z;  3IX0 A;  2VUG A;  3CCL Z;  1VQ8 1;  4HH4 A;  1YJW 1;  4TNU A;  1WW9 A;  3S2D I;  2JA6 I;  2RPR A;  1VQM 1;  2GU2 A;  2J6A A;  3HOZ I;  4NB8 A;  1YIJ 1;  4NOZ A;  1K73 1;  4BY7 I;  3S2H I;  2YU9 I;  3RZD I;  4DQY B;  3CCQ 1;  4MXU A;  5A2Q f;  3CCV 1;  3PO2 I;  1KRL A;  5T67 A;  4DGL A;  1RNI A;  3GTM S;  1VQ4 Z;  2JR6 A;  5IP7 I;  2IZ4 A;  1YJN Z;  3QWU A;  3I55 1;  3CCJ 1;  1SFO I;  2E9H A;  1VQL Z;  1X3Z A;  1K73 2;  2OTL Z;  2JA7 I;  1ML8 A;  5A2Q b;  3F3P C;  2QLV B;  3FQM A;  2DE6 A;  3J81 f;  2OTJ Z;  1WCM I;  3S1Q I;  4DK1 A;  5AN9 F;  2WAQ A;  3CC2 1;  2ZAE B;  3CC4 Z;  4MD7 A;  5T64 A;  3GKQ A;  1TWF I;  3CCE Z;  3G4S Z;  4NBG A;  1VQP 1;  3GTL I;  2V8I A;  3CME Z;  3CCS Z;  4A3G I;  2H85 A;  3J81 b;  2JA8 I;  2YAD A;  3CCU Z;  1ZB8 A;  1M1K 1;  2HU9 A;  4BBS I;  4A93 I;  3T4N B;  3HOW I;  3CC7 Z;  5FLM I;  2Q4Z A;  2LIY A;  5LL6 f;  1VQN 1;  3OW2 Z;  2QA4 1;  1YI2 Z;  3J7A 4;  2M6N A;  3MZL B;  3G71 1;  3NH5 A;  1VQ7 1;  2E2I I;  2JMO A;  3CD6 1;  1USP B;  2QRE B;  1P9N A;  4HGZ A;  3RZO I;  2OZK A;  1Z01 A;  5D1O A;  1VQ5 Z;  3M3Y I;  3F3F C;  3CCL 1;  5C4X I;  1Y1V S;  5C44 I;  4XX2 A;  1M1K 2;  1TWC I;  4MD9 A;  4NBH A;  3PO3 I;  4Y7N I;  1K8A 1;  1VQO Z;  4Y52 I;  2IZ3 A;  2B63 I;  5IP9 I;  1TFI A;  1YIT 1;  2QR1 B;  1QVG Z;  3GTM I;  1I6H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...