2JA5I

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I02
1QYPA 1DL6A 3VMIA 4A3GI 3HOZI 3HOXI 1K83I 4BBRI 4Y7NI 4BY1I 4NB9A 1RLYA 2RBLA 1X3ZA 4A3BI 3S16I 1TWAI 4NBGA 5IP9I 4A3II 5C3EI 4BXXI 4NB8A 4NBBA 1TWCI 4A3MI 3S2HI 2YU9I 1VLAA 4A93I 3U50C 3GTKI 5C4JI 3LUSA 2P3YA 3PO3S 2NVTI 1TWGI 4XX2A 1X3WA 4X6AI 3I4NI 1ML8A 1TWFI 4A3LI 3K7AI 5CM2M 2DE6A 1RO4A 3S2DI 4QTTA 3I07A 3VMGA 1Y1VS 3H3VJ 3PO2I 2R93I 2NVYI 3H0GI 1ZB9A 2F4MA 1R9TI 2R7ZI 2J6AA 3S1MI 3S17I 4A3CI 4NBHA 4QTUA 2NVXI 3M3YI 1Y1WI 1TFIA 4A3JI 1LQLA 3GTJI 2B63I 5C44I 3FKII 3S1RI 1WW9A 4A3KI 4BBSI 5C4XI 2JA5I 4NBEA 1I50I 3HOVI 3PO3I 2F4OA 3GKQA 1PFTA 2JA6I 3S15I 3GTLI 2PK7A 3GTQI 3D6WA 2E2II 2JA7I 3HOYI 3GTMS 1ZB8A 3S1NI 4NOZA 1N2FA 4BY7I 2E2HI 3RZOI 1Y1VI 2JNYA 4NBDA 3ESWA 1I6HI 5FLMI 3I4MI 2BJOA 4A3EI 1YUAA 3GTGI 4NBAA 3HOUI 1SFOI 3HOWI 2AKLA 5IP7I 2HF1A 2DE5A 4NBCA 1USPA 1USPB 3RZDI 2KPIA 3M4OI 4A3FI 3VB9A 3S14I 3Q87A 1TWHI 2E2JI 3GCFA 4A3DI 3EERA 2JS4A 4MH4A 1I3QI 2K5RA 2VUMI 3VMHA 2R92I 1WCMI 1L1OC 3GTMI 3GTOI 4NBFA 1NUIA 3S1QI 3GTPI 3CQZI 2JA8I 2JR6A 2NVQI 4Y52I 2DE7A
chains in the Genus database with same CATH superfamily
2OTJZ 1DL6A 4A3GI 1K731 1VQ51 4E33A 2M48A 3G6EZ 2IZ3A 1QVGZ 2JIQA 2RBLA 1TWAI 5C3EI 3CMAZ 1KD11 1VLAA 3NFZA 3NH4A 3U50C 5D1OA 1TWGI 4XX2A 1TWFI 5T67A 2PM9A 1K8A2 4RS4A 4QTTA 3EEDA 1Q7Y1 1NJI1 1Y1VS 1YI2Z 3PO2I 1M1K1 2R7ZI 1VQN1 1VQ7Z 2QA4Z 2RT9A 2NVXI 4A3JI 1VQ6Z 4EWCA 2B63I 1RQFA 2K3RA 3TE5B 2R6MA 3S1RI 1K9M1 1YITZ 3I56Z 2EGTA 2LFUA 3HOVI 3JAMf 2VUGA 3GTMS 3JAMb 1ZB8A 1YIJ1 2IZ4A 2VPXA 4NBDA 3ESWA 2GTIA 1KC82 4A3EI 1M902 1VQMZ 1YUAA 3GTGI 1QXFA 3CCJZ 1YHQZ 1Q861 1VQ9Z 3CME1 4MD8A 2DE5A 1Z03A 2PMZA 1VQLZ 3Q87A 3CC41 2E2JI 2IV2X 4A3DI 3EERA 4MH4A 1I3QI 2K5RA 2R92I 1L1OC 3GTOI 2AYDA 1Q812 1VQO1 4E2YA 1SIWA 2JMOA 3IR7A 1VQ8Z 1FDOA 2JR6A 4NH1C 2NVQI 1M1K2 4RVGA 1YUKA 3I551 2WB1A 3VMIA 4DGLA 4E30A 3HOXI 3HOZI 3CCQ1 4BBRI 2KI7B 3J81f 2QEX1 4Y7NI 5LL6f 1S7MA 1X3ZA 3S16I 2Q51A 4MD9A 5IP9I 3J81b 3CCVZ 4NB8A 3KIHA 3S2HI 3G71Z 3BG0B 3GTKI 5C4JI 3CD6Z 1YJ9Z 4HGZA 3CCMZ 1X3WA 4X6AI 3I4NI 3VTNA 2V8IA 4MONA 5CM2M 2DE6A 1Q821 2VPZA 1WZNA 3H3VJ 2OTJ1 1Y8CA 2NVYI 1ZB9A 2YADA 2J6AA 3S17I 3G6E1 3NH8A 4NBHA 2LEXA 3J80f 1Z02A 3CMA1 3IX0A 3J80b 1WJ2A 2E9HA 1NP6A 1WW9A 2V8KA 1N8R1 2JA5I 3KIFA 3MONA 3GKQA 3GTQI 2E7ZA 1KRLA 5A2Qf 3G4SZ 2JA7I 3S1NI 1YI21 2NAPA 5A2Qb 1Y1VI 2JIMA 1VQ71 3CCSZ 1I6HI 2I3CA 2QA41 3I4MI 1VQPZ 4E31A 2W03A 4MD7A 1VQ61 2WAQA 2QR1B 1RO2A 1ZH1A 3CCRZ 1Z01A 1YIT1 5D1PA 3I561 1USPB 3CC7Z 2OTLZ 4A3FI 4AYBA 3S14I 3MZLB 2GTHA 2JS4A 2VUMI 3CCLZ 1WCMI 3GTMI 4RV9A 1RNIA 4NBFA 1NUIA 2ZAEB 2QKDA 3S1QI 1K732 1VQM1 3CC21 2G2KA 3CCJ1 1YHQ1 2VF1A 1VQ91 3P5JB 1YJNZ 1KD12 1X0TA 4NB9A 2V8JA 3TDHB 1RLYA 1VQL1 4NBGA 2QREB 1TWCI 4A3MI 2YU9I 2VPYA 4A93I 2OOXB 2P3YA 3PO3S 2NVTI 2RHBA 5T64A 1WIIA 4TNUA 1ML8A 1Q7Y2 1NJI2 1VQ81 2JIRA 3D2LA 1Q16A 3NDJA 3H0GI 1S72Z 2F4MA 1K8A1 3HKZA 3S1MI 4QTUA 3M3YI 1VQ4Z 1VQKZ 4NFRA 1LQLA 3FQMA 4S1TA 1JJ2Y 2JIOA 3GTJI 3CCV1 1K9M2 1RO0A 5C44I 3FKII 3G711 3F3PC 4BBSI 3CD61 2V45A 2H85A 1YJWZ 1YJ91 4NBEA 2VPWA 3CCM1 3CCEZ 3T4NB 2F4OA 1PFTA 2Q4ZA 2W04A 2PK7A 5IT9f 3HOYI 3IF8A 4NOZA 1N2FA 4BY7I 2E2HI 5IT9b 4E2XA 3CCUZ 2JNYA 1JJ2Z 3MZKB 1P9NA 1Q862 1JWHC 4NBAA 5AN9F 1M901 1VQ5Z 4RVFA 2GU2A 5IP7I 3D9XA 2HF1A 4NBCA 1USPA 3RZDI 3M4OI 3F3FC 3G4S1 2RIQA 2JIPA 3VMHA 4RVHA 1AA6A 3CXCY 3CCS1 1VQP1 4CL1A 3IFUA 1Q811 3CPWY 4Y52I 1QYPA 4E2WA 2QRDB 1VQNZ 3CCR1 1K83I 4HH4A 4BY1I 3CC71 2OTL1 4A3BI 3J7A4 4A3II 2JUBA 4NBBA 4BXXI 3CXCZ 3CCL1 3LUSA 5D1OB 1Q822 3CPWZ 4A3LI 3K7AI 1RO4A 3S2DI 3NH5A 3I07A 1KQSY 3VMGA 5FLXf 1YIJZ 2R93I 1R9TI 1QVFY 4A3CI 5FLXb 1YJN1 1Y1WI 1TFIA 3FQQA 5T6BA 2QLVB 1N8R2 3CC2Z 1W2BY 2QRCB 4A3KI 2P28A 5C4XI 3CMEZ 3OW2Y 2LIYA 1I50I 2OZKA 2Y0SA 3PO3I 4E32A 3S15I 2JA6I 1KQSZ 3GTLI 3CC4Z 1QF8A 3D6WA 2E2II 4DQYB 1QVFZ 3NDIA 1S721 3RZOI 4MRIA 1VQOZ 3BG1B 5FLMI 2BJOA 1VQ41 1VQK1 1W2BZ 2OOYB 2O4HA 3I55Z 3HOUI 4MXUA 3OW2Z 1SFOI 3HOWI 2AKLA 3CCQZ 1FDIA 4HGYA 1YJW1 2QEXZ 3CCE1 2KPIA 4DK1A 3VB9A 4E2ZA 2O53A 1QVGY 1TWHI 3GCFA 3QWUA 2M6NA 2RPRA 2V3VA 3CCU1 3GTPI 3CQZI 2JA8I 2HU9A 1KC81 4RVDA 2DE7A
chains in the Genus database with same CATH topology
2OTJZ 1DL6A 4A3GI 1K731 1VQ51 4E33A 2M48A 3G6EZ 2IZ3A 1QVGZ 2RBLA 1TWAI 5C3EI 3CMAZ 1KD11 1VLAA 3NFZA 3NH4A 3U50C 5D1OA 1TWGI 4XX2A 1TWFI 5T67A 2PM9A 1K8A2 4RS4A 4QTTA 3EEDA 1Q7Y1 1NJI1 1Y1VS 1YI2Z 3PO2I 1M1K1 2R7ZI 1VQN1 1VQ7Z 2QA4Z 2RT9A 2NVXI 4A3JI 1VQ6Z 4EWCA 2B63I 1RQFA 2K3RA 3TE5B 2R6MA 3S1RI 1K9M1 1YITZ 3I56Z 2EGTA 2LFUA 3HOVI 3JAMf 2VUGA 3GTMS 3JAMb 1ZB8A 1YIJ1 2IZ4A 4NBDA 3ESWA 2GTIA 1KC82 4A3EI 1M902 1VQMZ 1YUAA 3GTGI 3CCJZ 1YHQZ 1Q861 1VQ9Z 3CME1 4MD8A 2DE5A 1Z03A 2PMZA 1VQLZ 3Q87A 3CC41 2E2JI 4A3DI 3EERA 4MH4A 1I3QI 2K5RA 2R92I 1L1OC 3GTOI 1Q812 1VQO1 4E2YA 2JMOA 1VQ8Z 2JR6A 4NH1C 2NVQI 1M1K2 4RVGA 1YUKA 3I551 2WB1A 3VMIA 4DGLA 4E30A 3HOXI 3HOZI 3CCQ1 4BBRI 2KI7B 3J81f 2QEX1 4Y7NI 5LL6f 1S7MA 1X3ZA 3S16I 2Q51A 4MD9A 5IP9I 3J81b 3CCVZ 4NB8A 3KIHA 3S2HI 3G71Z 3BG0B 3GTKI 5C4JI 3CD6Z 1YJ9Z 4HGZA 3CCMZ 1X3WA 4X6AI 3I4NI 3VTNA 2V8IA 4MONA 5CM2M 2DE6A 1Q821 3H3VJ 2OTJ1 2NVYI 1ZB9A 2YADA 2J6AA 3S17I 3G6E1 3NH8A 4NBHA 3J80f 1Z02A 3CMA1 3IX0A 3J80b 2E9HA 1NP6A 1WW9A 2V8KA 1N8R1 2JA5I 3KIFA 3MONA 3GKQA 3GTQI 1KRLA 5A2Qf 3G4SZ 2JA7I 3S1NI 1YI21 5A2Qb 1Y1VI 1VQ71 3CCSZ 1I6HI 2I3CA 2QA41 3I4MI 1VQPZ 4E31A 2W03A 4MD7A 1VQ61 2WAQA 2QR1B 1RO2A 1ZH1A 3CCRZ 1Z01A 1YIT1 5D1PA 3I561 1USPB 3CC7Z 2OTLZ 4A3FI 4AYBA 3S14I 3MZLB 2GTHA 2JS4A 2VUMI 3CCLZ 1WCMI 3GTMI 4RV9A 1RNIA 4NBFA 1NUIA 2ZAEB 2QKDA 3S1QI 1K732 1VQM1 3CC21 2G2KA 3CCJ1 1YHQ1 2VF1A 1VQ91 3P5JB 1YJNZ 1KD12 1X0TA 4NB9A 2V8JA 3TDHB 1RLYA 1VQL1 4NBGA 2QREB 1TWCI 4A3MI 2YU9I 4A93I 2OOXB 2P3YA 3PO3S 2NVTI 2RHBA 5T64A 1WIIA 4TNUA 1ML8A 1Q7Y2 1NJI2 1VQ81 3NDJA 3H0GI 1S72Z 2F4MA 1K8A1 3HKZA 3S1MI 4QTUA 3M3YI 1VQ4Z 1VQKZ 4NFRA 1LQLA 3FQMA 4S1TA 1JJ2Y 3GTJI 3CCV1 1K9M2 1RO0A 5C44I 3FKII 3G711 3F3PC 4BBSI 3CD61 2H85A 1YJWZ 1YJ91 4NBEA 3CCM1 3CCEZ 3T4NB 2F4OA 1PFTA 2Q4ZA 2W04A 2PK7A 5IT9f 3HOYI 3IF8A 4NOZA 1N2FA 4BY7I 2E2HI 5IT9b 4E2XA 3CCUZ 2JNYA 1JJ2Z 3MZKB 1P9NA 1Q862 1JWHC 4NBAA 5AN9F 1M901 1VQ5Z 4RVFA 2GU2A 5IP7I 3D9XA 2HF1A 4NBCA 1USPA 3RZDI 3M4OI 3F3FC 3G4S1 2RIQA 3VMHA 4RVHA 3CXCY 3CCS1 1VQP1 4CL1A 3IFUA 1Q811 3CPWY 4Y52I 1QYPA 4E2WA 2QRDB 1VQNZ 3CCR1 1K83I 4HH4A 4BY1I 3CC71 2OTL1 4A3BI 3J7A4 4A3II 2JUBA 4NBBA 4BXXI 3CXCZ 3CCL1 3LUSA 5D1OB 1Q822 3CPWZ 4A3LI 3K7AI 1RO4A 3S2DI 3NH5A 3I07A 1KQSY 3VMGA 5FLXf 1YIJZ 2R93I 1R9TI 1QVFY 4A3CI 5FLXb 1YJN1 1Y1WI 1TFIA 3FQQA 5T6BA 2QLVB 1N8R2 3CC2Z 1W2BY 2QRCB 4A3KI 2P28A 5C4XI 3CMEZ 3OW2Y 2LIYA 1I50I 2OZKA 2Y0SA 3PO3I 4E32A 3S15I 2JA6I 1KQSZ 3GTLI 3CC4Z 1QF8A 3D6WA 2E2II 4DQYB 1QVFZ 3NDIA 1S721 3RZOI 4MRIA 1VQOZ 3BG1B 5FLMI 2BJOA 1VQ41 1VQK1 1W2BZ 2OOYB 2O4HA 3I55Z 3HOUI 4MXUA 3OW2Z 1SFOI 3HOWI 2AKLA 3CCQZ 4HGYA 1YJW1 2QEXZ 3CCE1 2KPIA 4DK1A 3VB9A 4E2ZA 2O53A 1QVGY 1TWHI 3GCFA 3QWUA 2M6NA 2RPRA 3CCU1 3GTPI 3CQZI 2JA8I 2HU9A 1KC81 4RVDA 2DE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYP A;  1DL6 A;  3VMI A;  4A3G I;  3HOZ I;  3HOX I;  1K83 I;  4BBR I;  4Y7N I;  4BY1 I;  4NB9 A;  1RLY A;  2RBL A;  1X3Z A;  4A3B I;  3S16 I;  1TWA I;  4NBG A;  5IP9 I;  4A3I I;  5C3E I;  4BXX I;  4NB8 A;  4NBB A;  1TWC I;  4A3M I;  3S2H I;  2YU9 I;  1VLA A;  4A93 I;  3U50 C;  3GTK I;  5C4J I;  3LUS A;  2P3Y A;  3PO3 S;  2NVT I;  1TWG I;  4XX2 A;  1X3W A;  4X6A I;  3I4N I;  1ML8 A;  1TWF I;  4A3L I;  3K7A I;  5CM2 M;  2DE6 A;  1RO4 A;  3S2D I;  4QTT A;  3I07 A;  3VMG A;  1Y1V S;  3H3V J;  3PO2 I;  2R93 I;  2NVY I;  3H0G I;  1ZB9 A;  2F4M A;  1R9T I;  2R7Z I;  2J6A A;  3S1M I;  3S17 I;  4A3C I;  4NBH A;  4QTU A;  2NVX I;  3M3Y I;  1Y1W I;  1TFI A;  4A3J I;  1LQL A;  3GTJ I;  2B63 I;  5C44 I;  3FKI I;  3S1R I;  1WW9 A;  4A3K I;  4BBS I;  5C4X I;  2JA5 I;  4NBE A;  1I50 I;  3HOV I;  3PO3 I;  2F4O A;  3GKQ A;  1PFT A;  2JA6 I;  3S15 I;  3GTL I;  2PK7 A;  3GTQ I;  3D6W A;  2E2I I;  2JA7 I;  3HOY I;  3GTM S;  1ZB8 A;  3S1N I;  4NOZ A;  1N2F A;  4BY7 I;  2E2H I;  3RZO I;  1Y1V I;  2JNY A;  4NBD A;  3ESW A;  1I6H I;  5FLM I;  3I4M I;  2BJO A;  4A3E I;  1YUA A;  3GTG I;  4NBA A;  3HOU I;  1SFO I;  3HOW I;  2AKL A;  5IP7 I;  2HF1 A;  2DE5 A;  4NBC A;  1USP A;  1USP B;  3RZD I;  2KPI A;  3M4O I;  4A3F I;  3VB9 A;  3S14 I;  3Q87 A;  1TWH I;  2E2J I;  3GCF A;  4A3D I;  3EER A;  2JS4 A;  4MH4 A;  1I3Q I;  2K5R A;  2VUM I;  3VMH A;  2R92 I;  1WCM I;  1L1O C;  3GTM I;  3GTO I;  4NBF A;  1NUI A;  3S1Q I;  3GTP I;  3CQZ I;  2JA8 I;  2JR6 A;  2NVQ I;  4Y52 I;  2DE7 A; 
#chains in the Genus database with same CATH topology
 2OTJ Z;  1DL6 A;  4A3G I;  1K73 1;  1VQ5 1;  4E33 A;  2M48 A;  3G6E Z;  2IZ3 A;  1QVG Z;  2JIQ A;  2RBL A;  1TWA I;  5C3E I;  3CMA Z;  1KD1 1;  1VLA A;  3NFZ A;  3NH4 A;  3U50 C;  5D1O A;  1TWG I;  4XX2 A;  1TWF I;  5T67 A;  2PM9 A;  1K8A 2;  4RS4 A;  4QTT A;  3EED A;  1Q7Y 1;  1NJI 1;  1Y1V S;  1YI2 Z;  3PO2 I;  1M1K 1;  2R7Z I;  1VQN 1;  1VQ7 Z;  2QA4 Z;  2RT9 A;  2NVX I;  4A3J I;  1VQ6 Z;  4EWC A;  2B63 I;  1RQF A;  2K3R A;  3TE5 B;  2R6M A;  3S1R I;  1K9M 1;  1YIT Z;  3I56 Z;  2EGT A;  2LFU A;  3HOV I;  3JAM f;  2VUG A;  3GTM S;  3JAM b;  1ZB8 A;  1YIJ 1;  2IZ4 A;  2VPX A;  4NBD A;  3ESW A;  2GTI A;  1KC8 2;  4A3E I;  1M90 2;  1VQM Z;  1YUA A;  3GTG I;  1QXF A;  3CCJ Z;  1YHQ Z;  1Q86 1;  1VQ9 Z;  3CME 1;  4MD8 A;  2DE5 A;  1Z03 A;  2PMZ A;  1VQL Z;  3Q87 A;  3CC4 1;  2E2J I;  2IV2 X;  4A3D I;  3EER A;  4MH4 A;  1I3Q I;  2K5R A;  2R92 I;  1L1O C;  3GTO I;  2AYD A;  1Q81 2;  1VQO 1;  4E2Y A;  1SIW A;  2JMO A;  3IR7 A;  1VQ8 Z;  1FDO A;  2JR6 A;  4NH1 C;  2NVQ I;  1M1K 2;  4RVG A;  1YUK A;  3I55 1;  2WB1 A;  3VMI A;  4DGL A;  4E30 A;  3HOX I;  3HOZ I;  3CCQ 1;  4BBR I;  2KI7 B;  3J81 f;  2QEX 1;  4Y7N I;  5LL6 f;  1S7M A;  1X3Z A;  3S16 I;  2Q51 A;  4MD9 A;  5IP9 I;  3J81 b;  3CCV Z;  4NB8 A;  3KIH A;  3S2H I;  3G71 Z;  3BG0 B;  3GTK I;  5C4J I;  3CD6 Z;  1YJ9 Z;  4HGZ A;  3CCM Z;  1X3W A;  4X6A I;  3I4N I;  3VTN A;  2V8I A;  4MON A;  5CM2 M;  2DE6 A;  1Q82 1;  2VPZ A;  1WZN A;  3H3V J;  2OTJ 1;  1Y8C A;  2NVY I;  1ZB9 A;  2YAD A;  2J6A A;  3S17 I;  3G6E 1;  3NH8 A;  4NBH A;  2LEX A;  3J80 f;  1Z02 A;  3CMA 1;  3IX0 A;  3J80 b;  1WJ2 A;  2E9H A;  1NP6 A;  1WW9 A;  2V8K A;  1N8R 1;  2JA5 I;  3KIF A;  3MON A;  3GKQ A;  3GTQ I;  2E7Z A;  1KRL A;  5A2Q f;  3G4S Z;  2JA7 I;  3S1N I;  1YI2 1;  2NAP A;  5A2Q b;  1Y1V I;  2JIM A;  1VQ7 1;  3CCS Z;  1I6H I;  2I3C A;  2QA4 1;  3I4M I;  1VQP Z;  4E31 A;  2W03 A;  4MD7 A;  1VQ6 1;  2WAQ A;  2QR1 B;  1RO2 A;  1ZH1 A;  3CCR Z;  1Z01 A;  1YIT 1;  5D1P A;  3I56 1;  1USP B;  3CC7 Z;  2OTL Z;  4A3F I;  4AYB A;  3S14 I;  3MZL B;  2GTH A;  2JS4 A;  2VUM I;  3CCL Z;  1WCM I;  3GTM I;  4RV9 A;  1RNI A;  4NBF A;  1NUI A;  2ZAE B;  2QKD A;  3S1Q I;  1K73 2;  1VQM 1;  3CC2 1;  2G2K A;  3CCJ 1;  1YHQ 1;  2VF1 A;  1VQ9 1;  3P5J B;  1YJN Z;  1KD1 2;  1X0T A;  4NB9 A;  2V8J A;  3TDH B;  1RLY A;  1VQL 1;  4NBG A;  2QRE B;  1TWC I;  4A3M I;  2YU9 I;  2VPY A;  4A93 I;  2OOX B;  2P3Y A;  3PO3 S;  2NVT I;  2RHB A;  5T64 A;  1WII A;  4TNU A;  1ML8 A;  1Q7Y 2;  1NJI 2;  1VQ8 1;  2JIR A;  3D2L A;  1Q16 A;  3NDJ A;  3H0G I;  1S72 Z;  2F4M A;  1K8A 1;  3HKZ A;  3S1M I;  4QTU A;  3M3Y I;  1VQ4 Z;  1VQK Z;  4NFR A;  1LQL A;  3FQM A;  4S1T A;  1JJ2 Y;  2JIO A;  3GTJ I;  3CCV 1;  1K9M 2;  1RO0 A;  5C44 I;  3FKI I;  3G71 1;  3F3P C;  4BBS I;  3CD6 1;  2V45 A;  2H85 A;  1YJW Z;  1YJ9 1;  4NBE A;  2VPW A;  3CCM 1;  3CCE Z;  3T4N B;  2F4O A;  1PFT A;  2Q4Z A;  2W04 A;  2PK7 A;  5IT9 f;  3HOY I;  3IF8 A;  4NOZ A;  1N2F A;  4BY7 I;  2E2H I;  5IT9 b;  4E2X A;  3CCU Z;  2JNY A;  1JJ2 Z;  3MZK B;  1P9N A;  1Q86 2;  1JWH C;  4NBA A;  5AN9 F;  1M90 1;  1VQ5 Z;  4RVF A;  2GU2 A;  5IP7 I;  3D9X A;  2HF1 A;  4NBC A;  1USP A;  3RZD I;  3M4O I;  3F3F C;  3G4S 1;  2RIQ A;  2JIP A;  3VMH A;  4RVH A;  1AA6 A;  3CXC Y;  3CCS 1;  1VQP 1;  4CL1 A;  3IFU A;  1Q81 1;  3CPW Y;  4Y52 I;  1QYP A;  4E2W A;  2QRD B;  1VQN Z;  3CCR 1;  1K83 I;  4HH4 A;  4BY1 I;  3CC7 1;  2OTL 1;  4A3B I;  3J7A 4;  4A3I I;  2JUB A;  4NBB A;  4BXX I;  3CXC Z;  3CCL 1;  3LUS A;  5D1O B;  1Q82 2;  3CPW Z;  4A3L I;  3K7A I;  1RO4 A;  3S2D I;  3NH5 A;  3I07 A;  1KQS Y;  3VMG A;  5FLX f;  1YIJ Z;  2R93 I;  1R9T I;  1QVF Y;  4A3C I;  5FLX b;  1YJN 1;  1Y1W I;  1TFI A;  3FQQ A;  5T6B A;  2QLV B;  1N8R 2;  3CC2 Z;  1W2B Y;  2QRC B;  4A3K I;  2P28 A;  5C4X I;  3CME Z;  3OW2 Y;  2LIY A;  1I50 I;  2OZK A;  2Y0S A;  3PO3 I;  4E32 A;  3S15 I;  2JA6 I;  1KQS Z;  3GTL I;  3CC4 Z;  1QF8 A;  3D6W A;  2E2I I;  4DQY B;  1QVF Z;  3NDI A;  1S72 1;  3RZO I;  4MRI A;  1VQO Z;  3BG1 B;  5FLM I;  2BJO A;  1VQ4 1;  1VQK 1;  1W2B Z;  2OOY B;  2O4H A;  3I55 Z;  3HOU I;  4MXU A;  3OW2 Z;  1SFO I;  3HOW I;  2AKL A;  3CCQ Z;  1FDI A;  4HGY A;  1YJW 1;  2QEX Z;  3CCE 1;  2KPI A;  4DK1 A;  3VB9 A;  4E2Z A;  2O53 A;  1QVG Y;  1TWH I;  3GCF A;  3QWU A;  2M6N A;  2RPR A;  2V3V A;  3CCU 1;  3GTP I;  3CQZ I;  2JA8 I;  2HU9 A;  1KC8 1;  4RVD A;  2DE7 A; 
#chains in the Genus database with same CATH homology
 2OTJ Z;  1DL6 A;  4A3G I;  1K73 1;  1VQ5 1;  4E33 A;  2M48 A;  3G6E Z;  2IZ3 A;  1QVG Z;  2RBL A;  1TWA I;  5C3E I;  3CMA Z;  1KD1 1;  1VLA A;  3NFZ A;  3NH4 A;  3U50 C;  5D1O A;  1TWG I;  4XX2 A;  1TWF I;  5T67 A;  2PM9 A;  1K8A 2;  4RS4 A;  4QTT A;  3EED A;  1Q7Y 1;  1NJI 1;  1Y1V S;  1YI2 Z;  3PO2 I;  1M1K 1;  2R7Z I;  1VQN 1;  1VQ7 Z;  2QA4 Z;  2RT9 A;  2NVX I;  4A3J I;  1VQ6 Z;  4EWC A;  2B63 I;  1RQF A;  2K3R A;  3TE5 B;  2R6M A;  3S1R I;  1K9M 1;  1YIT Z;  3I56 Z;  2EGT A;  2LFU A;  3HOV I;  3JAM f;  2VUG A;  3GTM S;  3JAM b;  1ZB8 A;  1YIJ 1;  2IZ4 A;  4NBD A;  3ESW A;  2GTI A;  1KC8 2;  4A3E I;  1M90 2;  1VQM Z;  1YUA A;  3GTG I;  3CCJ Z;  1YHQ Z;  1Q86 1;  1VQ9 Z;  3CME 1;  4MD8 A;  2DE5 A;  1Z03 A;  2PMZ A;  1VQL Z;  3Q87 A;  3CC4 1;  2E2J I;  4A3D I;  3EER A;  4MH4 A;  1I3Q I;  2K5R A;  2R92 I;  1L1O C;  3GTO I;  1Q81 2;  1VQO 1;  4E2Y A;  2JMO A;  1VQ8 Z;  2JR6 A;  4NH1 C;  2NVQ I;  1M1K 2;  4RVG A;  1YUK A;  3I55 1;  2WB1 A;  3VMI A;  4DGL A;  4E30 A;  3HOX I;  3HOZ I;  3CCQ 1;  4BBR I;  2KI7 B;  3J81 f;  2QEX 1;  4Y7N I;  5LL6 f;  1S7M A;  1X3Z A;  3S16 I;  2Q51 A;  4MD9 A;  5IP9 I;  3J81 b;  3CCV Z;  4NB8 A;  3KIH A;  3S2H I;  3G71 Z;  3BG0 B;  3GTK I;  5C4J I;  3CD6 Z;  1YJ9 Z;  4HGZ A;  3CCM Z;  1X3W A;  4X6A I;  3I4N I;  3VTN A;  2V8I A;  4MON A;  5CM2 M;  2DE6 A;  1Q82 1;  3H3V J;  2OTJ 1;  2NVY I;  1ZB9 A;  2YAD A;  2J6A A;  3S17 I;  3G6E 1;  3NH8 A;  4NBH A;  3J80 f;  1Z02 A;  3CMA 1;  3IX0 A;  3J80 b;  2E9H A;  1NP6 A;  1WW9 A;  2V8K A;  1N8R 1;  2JA5 I;  3KIF A;  3MON A;  3GKQ A;  3GTQ I;  1KRL A;  5A2Q f;  3G4S Z;  2JA7 I;  3S1N I;  1YI2 1;  5A2Q b;  1Y1V I;  1VQ7 1;  3CCS Z;  1I6H I;  2I3C A;  2QA4 1;  3I4M I;  1VQP Z;  4E31 A;  2W03 A;  4MD7 A;  1VQ6 1;  2WAQ A;  2QR1 B;  1RO2 A;  1ZH1 A;  3CCR Z;  1Z01 A;  1YIT 1;  5D1P A;  3I56 1;  1USP B;  3CC7 Z;  2OTL Z;  4A3F I;  4AYB A;  3S14 I;  3MZL B;  2GTH A;  2JS4 A;  2VUM I;  3CCL Z;  1WCM I;  3GTM I;  4RV9 A;  1RNI A;  4NBF A;  1NUI A;  2ZAE B;  2QKD A;  3S1Q I;  1K73 2;  1VQM 1;  3CC2 1;  2G2K A;  3CCJ 1;  1YHQ 1;  2VF1 A;  1VQ9 1;  3P5J B;  1YJN Z;  1KD1 2;  1X0T A;  4NB9 A;  2V8J A;  3TDH B;  1RLY A;  1VQL 1;  4NBG A;  2QRE B;  1TWC I;  4A3M I;  2YU9 I;  4A93 I;  2OOX B;  2P3Y A;  3PO3 S;  2NVT I;  2RHB A;  5T64 A;  1WII A;  4TNU A;  1ML8 A;  1Q7Y 2;  1NJI 2;  1VQ8 1;  3NDJ A;  3H0G I;  1S72 Z;  2F4M A;  1K8A 1;  3HKZ A;  3S1M I;  4QTU A;  3M3Y I;  1VQ4 Z;  1VQK Z;  4NFR A;  1LQL A;  3FQM A;  4S1T A;  1JJ2 Y;  3GTJ I;  3CCV 1;  1K9M 2;  1RO0 A;  5C44 I;  3FKI I;  3G71 1;  3F3P C;  4BBS I;  3CD6 1;  2H85 A;  1YJW Z;  1YJ9 1;  4NBE A;  3CCM 1;  3CCE Z;  3T4N B;  2F4O A;  1PFT A;  2Q4Z A;  2W04 A;  2PK7 A;  5IT9 f;  3HOY I;  3IF8 A;  4NOZ A;  1N2F A;  4BY7 I;  2E2H I;  5IT9 b;  4E2X A;  3CCU Z;  2JNY A;  1JJ2 Z;  3MZK B;  1P9N A;  1Q86 2;  1JWH C;  4NBA A;  5AN9 F;  1M90 1;  1VQ5 Z;  4RVF A;  2GU2 A;  5IP7 I;  3D9X A;  2HF1 A;  4NBC A;  1USP A;  3RZD I;  3M4O I;  3F3F C;  3G4S 1;  2RIQ A;  3VMH A;  4RVH A;  3CXC Y;  3CCS 1;  1VQP 1;  4CL1 A;  3IFU A;  1Q81 1;  3CPW Y;  4Y52 I;  1QYP A;  4E2W A;  2QRD B;  1VQN Z;  3CCR 1;  1K83 I;  4HH4 A;  4BY1 I;  3CC7 1;  2OTL 1;  4A3B I;  3J7A 4;  4A3I I;  2JUB A;  4NBB A;  4BXX I;  3CXC Z;  3CCL 1;  3LUS A;  5D1O B;  1Q82 2;  3CPW Z;  4A3L I;  3K7A I;  1RO4 A;  3S2D I;  3NH5 A;  3I07 A;  1KQS Y;  3VMG A;  5FLX f;  1YIJ Z;  2R93 I;  1R9T I;  1QVF Y;  4A3C I;  5FLX b;  1YJN 1;  1Y1W I;  1TFI A;  3FQQ A;  5T6B A;  2QLV B;  1N8R 2;  3CC2 Z;  1W2B Y;  2QRC B;  4A3K I;  2P28 A;  5C4X I;  3CME Z;  3OW2 Y;  2LIY A;  1I50 I;  2OZK A;  2Y0S A;  3PO3 I;  4E32 A;  3S15 I;  2JA6 I;  1KQS Z;  3GTL I;  3CC4 Z;  1QF8 A;  3D6W A;  2E2I I;  4DQY B;  1QVF Z;  3NDI A;  1S72 1;  3RZO I;  4MRI A;  1VQO Z;  3BG1 B;  5FLM I;  2BJO A;  1VQ4 1;  1VQK 1;  1W2B Z;  2OOY B;  2O4H A;  3I55 Z;  3HOU I;  4MXU A;  3OW2 Z;  1SFO I;  3HOW I;  2AKL A;  3CCQ Z;  4HGY A;  1YJW 1;  2QEX Z;  3CCE 1;  2KPI A;  4DK1 A;  3VB9 A;  4E2Z A;  2O53 A;  1QVG Y;  1TWH I;  3GCF A;  3QWU A;  2M6N A;  2RPR A;  3CCU 1;  3GTP I;  3CQZ I;  2JA8 I;  2HU9 A;  1KC8 1;  4RVD A;  2DE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...