2JA5I

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I02
1TWAI 1TWGI 3I4NI 1TFIA 4Y52I 1USPA 1ML8A 3GTJI 5IP7I 4MH4A 2F4MA 4NBHA 2RBLA 4NBFA 2HF1A 1TWHI 2R7ZI 4A3LI 3H0GI 5C3EI 1RO4A 3HOXI 1Y1WI 3GTMS 3GTOI 1I50I 2F4OA 1NUIA 4BBSI 4NBAA 1X3ZA 3CQZI 2R92I 1K83I 3S1QI 4XX2A 5C4JI 3PO3S 4X6AI 4NB8A 2JA6I 1I3QI 3PO2I 1TWFI 3RZOI 3GTKI 2DE6A 4NBEA 3M3YI 3HOWI 3S1MI 2E2II 5FLMI 3M4OI 1QYPA 4A3BI 1X3WA 3VB9A 2PK7A 3S2HI 2P3YA 3S1RI 4A3MI 2BJOA 4QTUA 2JA7I 5CM2M 3VMHA 3HOZI 4BY7I 1DL6A 3FKII 1PFTA 4A93I 1USPB 3GTMI 4NB9A 3S15I 2E2JI 3K7AI 1WCMI 3I4MI 4NBBA 4BXXI 1VLAA 4A3CI 2DE7A 3GTGI 3VMGA 2VUMI 3PO3I 3D6WA 3RZDI 1R9TI 1I6HI 3S1NI 3S16I 2YU9I 2DE5A 2J6AA 5C4XI 2K5RA 4BY1I 3S17I 4NBDA 1LQLA 1YUAA 4A3II 2E2HI 4A3GI 3H3VJ 3EERA 2JNYA 1N2FA 1ZB8A 2JA5I 3GCFA 2NVTI 2NVQI 3HOVI 3I07A 1Y1VS 3GTLI 4A3KI 1RLYA 2JS4A 1WW9A 4A3FI 2NVXI 3GTQI 2AKLA 2NVYI 3ESWA 2JR6A 1SFOI 3GTPI 4NBCA 2JA8I 3U50C 3LUSA 4Y7NI 4A3JI 1L1OC 1ZB9A 1TWCI 2B63I 2R93I 3GKQA 4QTTA 5IP9I 3S2DI 3Q87A 4NBGA 5C44I 4A3EI 3HOYI 4A3DI 3HOUI 4BBRI 4NOZA 2KPIA 3VMIA 3S14I 1Y1VI
chains in the Genus database with same CATH superfamily
1KRLA 1TFIA 1ML8A 3IFUA 3GTJI 4NH1C 2AYDA 2F4MA 4E30A 3CCUZ 1TWHI 3F3FC 5D1OB 3HOXI 1RO4A 2F4OA 3CCSZ 4MD8A 2R92I 3CC2Z 4NB8A 4E2WA 1Z01A 1KD11 3BG0B 3IF8A 2VPZA 4NBEA 3S1MI 5FLMI 3S2HI 3I56Z 3S1RI 2QA4Z 1VQOZ 3NFZA 2IV2X 1M901 1VQ71 2JA7I 3VMHA 5T64A 1QF8A 4E2YA 5LL6f 2V3VA 1YHQ1 4A93I 5FLXf 2ZAEB 3G4SZ 3CMEZ 4NBBA 2WAQA 2RT9A 3GTGI 2V45A 2VUMI 1R9TI 2QEX1 2V8IA 3CC71 4NBDA 2LIYA 3FQMA 4A3II 2E2HI 1Q811 4A3GI 1Q862 3OW2Y 2JNYA 3EEDA 1WZNA 1ZB8A 4MD7A 3F3PC 3GCFA 1Y1VS 3CPWY 3GTLI 3CXCZ 3CCR1 1YJWZ 3VTNA 2JS4A 1WW9A 2O53A 1JWHC 3ESWA 1M1K2 1KQSZ 1Q822 3GTPI 1QXFA 2V8KA 2JA8I 1NJI1 3I561 4QTTA 5IP9I 2IZ4A 2JIPA 4E2ZA 2VPWA 3IR7A 3Q87A 4RVHA 4NBGA 4A3EI 2QRCB 3CCMZ 3HOUI 3CC4Z 2O4HA 1VQL1 2OOYB 4RVFA 1K8A2 1VQ6Z 2PMZA 4NBHA 2RBLA 4NBFA 2M48A 1AA6A 2QLVB 2R7ZI 3H0GI 5C3EI 1KC81 2V8JA 1I50I 1NUIA 4BBSI 4NBAA 3CCEZ 3CCQ1 4DQYB 3J7A4 2LEXA 1QVFZ 3S1QI 4XX2A 5C4JI 2OTL1 1RO2A 1VQ8Z 4S1TA 5AN9F 1I3QI 1TWFI 3M3YI 2E2II 1X3WA 2PK7A 1YJW1 1S7MA 2P3YA 1VQN1 5D1PA 5CM2M 3CCVZ 1YITZ 3HOZI 4BY7I 1PFTA 3J81b 1USPB 1VQM1 2WB1A 4NB9A 1VQPZ 3P5JB 1WCMI 1WIIA 3NH5A 1YIJZ 1K731 1S72Z 2GTIA 1RQFA 3CC41 2E7ZA 2J6AA 3G711 2JMOA 2K5RA 1YI2Z 5T67A 3S17I 1P9NA 1YUAA 1YJ91 1VQ4Z 1VQ61 1Q7Y2 3D2LA 1N2FA 2JUBA 3KIHA 2QR1B 5D1OA 4MXUA 1VQKZ 1NP6A 2NVXI 3GTQI 3I55Z 2JR6A 3IX0A 1X0TA 3LUSA 1N8R1 1L1OC 1ZB9A 3CMAZ 2GU2A 3J81f 3CCU1 3CCV1 2QRDB 1YIT1 2OZKA 3KIFA 4NFRA 2KPIA 3CCS1 2Q51A 2JIMA 3CD6Z 1VQP1 1Y1VI 3T4NB 4TNUA 1RO0A 3CC21 2HF1A 1YIJ1 4MD9A 3GTMS 1Y1WI 4RVGA 1VQ5Z 3GTOI 2VUGA 1RNIA 2QREB 3NDIA 1VQO1 1X3ZA 3CQZI 2QA41 1K83I 3PO3S 1Q16A 2YADA 1ZH1A 1WJ2A 3PO2I 2OTJZ 4A3BI 5T6BA 1M902 3G4S1 2BJOA 3CME1 3HKZA 4QTUA 4CL1A 1DL6A 3FKII 3I551 4MONA 3CXCY 1Z03A 3S15I 2E2JI 3K7AI 4BXXI 1VLAA 4A3CI 1VQ7Z 2DE7A 3VMGA 4MRIA 2RIQA 3RZDI 1VQ9Z 1KQSY 2W03A 1Y8CA 5IT9b 5C4XI 1YHQZ 4BY1I 2RPRA 4HGZA 1LQLA 1FDOA 2W04A 3H3VJ 3EERA 2P28A 1Q861 2Q4ZA 2NVTI 1K9M2 2QEXZ 4HH4A 2JIRA 4A3KI 3BG1B 3G6EZ 5A2Qb 2JIOA 3CC7Z 2JIQA 3TDHB 3QWUA 3CCM1 1SIWA 2QKDA 2VF1A 1NJI2 2K3RA 1M1K1 3U50C 2OTJ1 4Y7NI 3CCRZ 4A3JI 1Q821 2KI7B 1W2BZ 1QVFY 2Y0SA 3GKQA 3OW2Z 3NH8A 3HOYI 2E9HA 4BBRI 3NH4A 3VMIA 3CPWZ 3CCE1 2I3CA 1TWAI 1TWGI 3I4NI 4Y52I 1USPA 3CCJZ 4HGYA 2M6NA 1K8A1 5IP7I 5IT9f 4MH4A 1VQ81 1QVGZ 1KC82 4A3LI 4RV9A 1VQ91 1VQLZ 3FQQA 1YJNZ 3JAMb 1JJ2Z 4EWCA 3MONA 4X6AI 4RVDA 2JA6I 5A2Qf 3RZOI 3GTKI 2DE6A 3HOWI 3J80b 3M4OI 1QYPA 3CCLZ 3VB9A 3G6E1 3CCQZ 4A3MI 1W2BY 2IZ3A 2OTLZ 1S721 4E33A 3TE5B 2LFUA 1YI21 2EGTA 3GTMI 2RHBA 3NDJA 2G2KA 1VQ41 3I4MI 1KD12 2OOXB 1K9M1 4DGLA 1VQNZ 1K732 2PM9A 3PO3I 3D6WA 4E32A 1QVGY 4DK1A 1I6HI 2GTHA 3S1NI 3S16I 2YU9I 2DE5A 2R6MA 1VQMZ 1VQK1 1FDIA 4E2XA 1JJ2Y 3CCJ1 3MZKB 1Q7Y1 2JA5I 3JAMf 2NVQI 3HOVI 1Z02A 3I07A 3G71Z 2VPYA 1RLYA 3MZLB 3CMA1 1YJN1 1YJ9Z 4A3FI 2AKLA 2NVYI 3J80f 2VPXA 1SFOI 4RS4A 1N8R2 4NBCA 3CD61 1Q812 3D9XA 3CCL1 1TWCI 1YUKA 2B63I 2R93I 2NAPA 3S2DI 4E31A 4AYBA 5FLXb 2H85A 5C44I 4A3DI 2HU9A 1VQ51 4NOZA 3S14I
chains in the Genus database with same CATH topology
1KRLA 1TFIA 1ML8A 3IFUA 3GTJI 4NH1C 2F4MA 4E30A 3CCUZ 1TWHI 3F3FC 5D1OB 3HOXI 1RO4A 2F4OA 3CCSZ 4MD8A 2R92I 3CC2Z 4NB8A 4E2WA 1Z01A 1KD11 3BG0B 3IF8A 4NBEA 3S1MI 5FLMI 3S2HI 3I56Z 3S1RI 2QA4Z 1VQOZ 3NFZA 1M901 1VQ71 2JA7I 3VMHA 5T64A 1QF8A 4E2YA 5LL6f 1YHQ1 4A93I 5FLXf 2ZAEB 3G4SZ 3CMEZ 4NBBA 2WAQA 2RT9A 3GTGI 2VUMI 1R9TI 2QEX1 2V8IA 3CC71 4NBDA 2LIYA 3FQMA 4A3II 2E2HI 1Q811 4A3GI 1Q862 3OW2Y 2JNYA 3EEDA 1ZB8A 4MD7A 3F3PC 3GCFA 1Y1VS 3CPWY 3GTLI 3CXCZ 3CCR1 1YJWZ 3VTNA 2JS4A 1WW9A 2O53A 1JWHC 3ESWA 1M1K2 1KQSZ 1Q822 3GTPI 2V8KA 2JA8I 1NJI1 3I561 4QTTA 5IP9I 2IZ4A 4E2ZA 3Q87A 4RVHA 4NBGA 4A3EI 2QRCB 3CCMZ 3HOUI 3CC4Z 2O4HA 1VQL1 2OOYB 4RVFA 1K8A2 1VQ6Z 2PMZA 4NBHA 2RBLA 4NBFA 2M48A 2QLVB 2R7ZI 3H0GI 5C3EI 1KC81 2V8JA 1I50I 1NUIA 4BBSI 4NBAA 3CCEZ 3CCQ1 4DQYB 3J7A4 1QVFZ 3S1QI 4XX2A 5C4JI 2OTL1 1RO2A 1VQ8Z 4S1TA 5AN9F 1I3QI 1TWFI 3M3YI 2E2II 1X3WA 2PK7A 1YJW1 1S7MA 2P3YA 1VQN1 5D1PA 5CM2M 3CCVZ 1YITZ 3HOZI 4BY7I 1PFTA 3J81b 1USPB 1VQM1 2WB1A 4NB9A 1VQPZ 3P5JB 1WCMI 1WIIA 3NH5A 1YIJZ 1K731 1S72Z 2GTIA 1RQFA 3CC41 2J6AA 3G711 2JMOA 2K5RA 1YI2Z 5T67A 3S17I 1P9NA 1YUAA 1YJ91 1VQ4Z 1VQ61 1Q7Y2 1N2FA 2JUBA 3KIHA 2QR1B 5D1OA 4MXUA 1VQKZ 1NP6A 2NVXI 3GTQI 3I55Z 2JR6A 3IX0A 1X0TA 3LUSA 1N8R1 1L1OC 1ZB9A 3CMAZ 2GU2A 3J81f 3CCU1 3CCV1 2QRDB 1YIT1 2OZKA 3KIFA 4NFRA 2KPIA 3CCS1 2Q51A 3CD6Z 1VQP1 1Y1VI 3T4NB 4TNUA 1RO0A 3CC21 2HF1A 1YIJ1 4MD9A 3GTMS 1Y1WI 4RVGA 1VQ5Z 3GTOI 2VUGA 1RNIA 2QREB 3NDIA 1VQO1 1X3ZA 3CQZI 2QA41 1K83I 3PO3S 2YADA 1ZH1A 3PO2I 2OTJZ 4A3BI 5T6BA 1M902 3G4S1 2BJOA 3CME1 3HKZA 4QTUA 4CL1A 1DL6A 3FKII 3I551 4MONA 3CXCY 1Z03A 3S15I 2E2JI 3K7AI 4BXXI 1VLAA 4A3CI 1VQ7Z 2DE7A 3VMGA 4MRIA 2RIQA 3RZDI 1VQ9Z 1KQSY 2W03A 5IT9b 5C4XI 1YHQZ 4BY1I 2RPRA 4HGZA 1LQLA 2W04A 3H3VJ 3EERA 2P28A 1Q861 2Q4ZA 2NVTI 1K9M2 2QEXZ 4HH4A 4A3KI 3BG1B 3G6EZ 5A2Qb 3CC7Z 3TDHB 3QWUA 3CCM1 2QKDA 2VF1A 1NJI2 2K3RA 1M1K1 3U50C 2OTJ1 4Y7NI 3CCRZ 4A3JI 1Q821 2KI7B 1W2BZ 1QVFY 2Y0SA 3GKQA 3OW2Z 3NH8A 3HOYI 2E9HA 4BBRI 3NH4A 3VMIA 3CPWZ 3CCE1 2I3CA 1TWAI 1TWGI 3I4NI 4Y52I 1USPA 3CCJZ 4HGYA 2M6NA 1K8A1 5IP7I 5IT9f 4MH4A 1VQ81 1QVGZ 1KC82 4A3LI 4RV9A 1VQ91 1VQLZ 3FQQA 1YJNZ 3JAMb 1JJ2Z 4EWCA 3MONA 4X6AI 4RVDA 2JA6I 5A2Qf 3RZOI 3GTKI 2DE6A 3HOWI 3J80b 3M4OI 1QYPA 3CCLZ 3VB9A 3G6E1 3CCQZ 4A3MI 1W2BY 2IZ3A 2OTLZ 1S721 4E33A 3TE5B 2LFUA 1YI21 2EGTA 3GTMI 2RHBA 3NDJA 2G2KA 1VQ41 3I4MI 1KD12 2OOXB 1K9M1 4DGLA 1VQNZ 1K732 2PM9A 3PO3I 3D6WA 4E32A 1QVGY 4DK1A 1I6HI 2GTHA 3S1NI 3S16I 2YU9I 2DE5A 2R6MA 1VQMZ 1VQK1 4E2XA 1JJ2Y 3CCJ1 3MZKB 1Q7Y1 2JA5I 3JAMf 2NVQI 3HOVI 1Z02A 3I07A 3G71Z 1RLYA 3MZLB 3CMA1 1YJN1 1YJ9Z 4A3FI 2AKLA 2NVYI 3J80f 1SFOI 4RS4A 1N8R2 4NBCA 3CD61 1Q812 3D9XA 3CCL1 1TWCI 1YUKA 2B63I 2R93I 3S2DI 4E31A 4AYBA 5FLXb 2H85A 5C44I 4A3DI 2HU9A 1VQ51 4NOZA 3S14I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA I;  1TWG I;  3I4N I;  1TFI A;  4Y52 I;  1USP A;  1ML8 A;  3GTJ I;  5IP7 I;  4MH4 A;  2F4M A;  4NBH A;  2RBL A;  4NBF A;  2HF1 A;  1TWH I;  2R7Z I;  4A3L I;  3H0G I;  5C3E I;  1RO4 A;  3HOX I;  1Y1W I;  3GTM S;  3GTO I;  1I50 I;  2F4O A;  1NUI A;  4BBS I;  4NBA A;  1X3Z A;  3CQZ I;  2R92 I;  1K83 I;  3S1Q I;  4XX2 A;  5C4J I;  3PO3 S;  4X6A I;  4NB8 A;  2JA6 I;  1I3Q I;  3PO2 I;  1TWF I;  3RZO I;  3GTK I;  2DE6 A;  4NBE A;  3M3Y I;  3HOW I;  3S1M I;  2E2I I;  5FLM I;  3M4O I;  1QYP A;  4A3B I;  1X3W A;  3VB9 A;  2PK7 A;  3S2H I;  2P3Y A;  3S1R I;  4A3M I;  2BJO A;  4QTU A;  2JA7 I;  5CM2 M;  3VMH A;  3HOZ I;  4BY7 I;  1DL6 A;  3FKI I;  1PFT A;  4A93 I;  1USP B;  3GTM I;  4NB9 A;  3S15 I;  2E2J I;  3K7A I;  1WCM I;  3I4M I;  4NBB A;  4BXX I;  1VLA A;  4A3C I;  2DE7 A;  3GTG I;  3VMG A;  2VUM I;  3PO3 I;  3D6W A;  3RZD I;  1R9T I;  1I6H I;  3S1N I;  3S16 I;  2YU9 I;  2DE5 A;  2J6A A;  5C4X I;  2K5R A;  4BY1 I;  3S17 I;  4NBD A;  1LQL A;  1YUA A;  4A3I I;  2E2H I;  4A3G I;  3H3V J;  3EER A;  2JNY A;  1N2F A;  1ZB8 A;  2JA5 I;  3GCF A;  2NVT I;  2NVQ I;  3HOV I;  3I07 A;  1Y1V S;  3GTL I;  4A3K I;  1RLY A;  2JS4 A;  1WW9 A;  4A3F I;  2NVX I;  3GTQ I;  2AKL A;  2NVY I;  3ESW A;  2JR6 A;  1SFO I;  3GTP I;  4NBC A;  2JA8 I;  3U50 C;  3LUS A;  4Y7N I;  4A3J I;  1L1O C;  1ZB9 A;  1TWC I;  2B63 I;  2R93 I;  3GKQ A;  4QTT A;  5IP9 I;  3S2D I;  3Q87 A;  4NBG A;  5C44 I;  4A3E I;  3HOY I;  4A3D I;  3HOU I;  4BBR I;  4NOZ A;  2KPI A;  3VMI A;  3S14 I;  1Y1V I; 
#chains in the Genus database with same CATH topology
 1KRL A;  1TFI A;  1ML8 A;  3IFU A;  3GTJ I;  4NH1 C;  2AYD A;  2F4M A;  4E30 A;  3CCU Z;  1TWH I;  3F3F C;  5D1O B;  3HOX I;  1RO4 A;  2F4O A;  3CCS Z;  4MD8 A;  2R92 I;  3CC2 Z;  4NB8 A;  4E2W A;  1Z01 A;  1KD1 1;  3BG0 B;  3IF8 A;  2VPZ A;  4NBE A;  3S1M I;  5FLM I;  3S2H I;  3I56 Z;  3S1R I;  2QA4 Z;  1VQO Z;  3NFZ A;  2IV2 X;  1M90 1;  1VQ7 1;  2JA7 I;  3VMH A;  5T64 A;  1QF8 A;  4E2Y A;  5LL6 f;  2V3V A;  1YHQ 1;  4A93 I;  5FLX f;  2ZAE B;  3G4S Z;  3CME Z;  4NBB A;  2WAQ A;  2RT9 A;  3GTG I;  2V45 A;  2VUM I;  1R9T I;  2QEX 1;  2V8I A;  3CC7 1;  4NBD A;  2LIY A;  3FQM A;  4A3I I;  2E2H I;  1Q81 1;  4A3G I;  1Q86 2;  3OW2 Y;  2JNY A;  3EED A;  1WZN A;  1ZB8 A;  4MD7 A;  3F3P C;  3GCF A;  1Y1V S;  3CPW Y;  3GTL I;  3CXC Z;  3CCR 1;  1YJW Z;  3VTN A;  2JS4 A;  1WW9 A;  2O53 A;  1JWH C;  3ESW A;  1M1K 2;  1KQS Z;  1Q82 2;  3GTP I;  1QXF A;  2V8K A;  2JA8 I;  1NJI 1;  3I56 1;  4QTT A;  5IP9 I;  2IZ4 A;  2JIP A;  4E2Z A;  2VPW A;  3IR7 A;  3Q87 A;  4RVH A;  4NBG A;  4A3E I;  2QRC B;  3CCM Z;  3HOU I;  3CC4 Z;  2O4H A;  1VQL 1;  2OOY B;  4RVF A;  1K8A 2;  1VQ6 Z;  2PMZ A;  4NBH A;  2RBL A;  4NBF A;  2M48 A;  1AA6 A;  2QLV B;  2R7Z I;  3H0G I;  5C3E I;  1KC8 1;  2V8J A;  1I50 I;  1NUI A;  4BBS I;  4NBA A;  3CCE Z;  3CCQ 1;  4DQY B;  3J7A 4;  2LEX A;  1QVF Z;  3S1Q I;  4XX2 A;  5C4J I;  2OTL 1;  1RO2 A;  1VQ8 Z;  4S1T A;  5AN9 F;  1I3Q I;  1TWF I;  3M3Y I;  2E2I I;  1X3W A;  2PK7 A;  1YJW 1;  1S7M A;  2P3Y A;  1VQN 1;  5D1P A;  5CM2 M;  3CCV Z;  1YIT Z;  3HOZ I;  4BY7 I;  1PFT A;  3J81 b;  1USP B;  1VQM 1;  2WB1 A;  4NB9 A;  1VQP Z;  3P5J B;  1WCM I;  1WII A;  3NH5 A;  1YIJ Z;  1K73 1;  1S72 Z;  2GTI A;  1RQF A;  3CC4 1;  2E7Z A;  2J6A A;  3G71 1;  2JMO A;  2K5R A;  1YI2 Z;  5T67 A;  3S17 I;  1P9N A;  1YUA A;  1YJ9 1;  1VQ4 Z;  1VQ6 1;  1Q7Y 2;  3D2L A;  1N2F A;  2JUB A;  3KIH A;  2QR1 B;  5D1O A;  4MXU A;  1VQK Z;  1NP6 A;  2NVX I;  3GTQ I;  3I55 Z;  2JR6 A;  3IX0 A;  1X0T A;  3LUS A;  1N8R 1;  1L1O C;  1ZB9 A;  3CMA Z;  2GU2 A;  3J81 f;  3CCU 1;  3CCV 1;  2QRD B;  1YIT 1;  2OZK A;  3KIF A;  4NFR A;  2KPI A;  3CCS 1;  2Q51 A;  2JIM A;  3CD6 Z;  1VQP 1;  1Y1V I;  3T4N B;  4TNU A;  1RO0 A;  3CC2 1;  2HF1 A;  1YIJ 1;  4MD9 A;  3GTM S;  1Y1W I;  4RVG A;  1VQ5 Z;  3GTO I;  2VUG A;  1RNI A;  2QRE B;  3NDI A;  1VQO 1;  1X3Z A;  3CQZ I;  2QA4 1;  1K83 I;  3PO3 S;  1Q16 A;  2YAD A;  1ZH1 A;  1WJ2 A;  3PO2 I;  2OTJ Z;  4A3B I;  5T6B A;  1M90 2;  3G4S 1;  2BJO A;  3CME 1;  3HKZ A;  4QTU A;  4CL1 A;  1DL6 A;  3FKI I;  3I55 1;  4MON A;  3CXC Y;  1Z03 A;  3S15 I;  2E2J I;  3K7A I;  4BXX I;  1VLA A;  4A3C I;  1VQ7 Z;  2DE7 A;  3VMG A;  4MRI A;  2RIQ A;  3RZD I;  1VQ9 Z;  1KQS Y;  2W03 A;  1Y8C A;  5IT9 b;  5C4X I;  1YHQ Z;  4BY1 I;  2RPR A;  4HGZ A;  1LQL A;  1FDO A;  2W04 A;  3H3V J;  3EER A;  2P28 A;  1Q86 1;  2Q4Z A;  2NVT I;  1K9M 2;  2QEX Z;  4HH4 A;  2JIR A;  4A3K I;  3BG1 B;  3G6E Z;  5A2Q b;  2JIO A;  3CC7 Z;  2JIQ A;  3TDH B;  3QWU A;  3CCM 1;  1SIW A;  2QKD A;  2VF1 A;  1NJI 2;  2K3R A;  1M1K 1;  3U50 C;  2OTJ 1;  4Y7N I;  3CCR Z;  4A3J I;  1Q82 1;  2KI7 B;  1W2B Z;  1QVF Y;  2Y0S A;  3GKQ A;  3OW2 Z;  3NH8 A;  3HOY I;  2E9H A;  4BBR I;  3NH4 A;  3VMI A;  3CPW Z;  3CCE 1;  2I3C A;  1TWA I;  1TWG I;  3I4N I;  4Y52 I;  1USP A;  3CCJ Z;  4HGY A;  2M6N A;  1K8A 1;  5IP7 I;  5IT9 f;  4MH4 A;  1VQ8 1;  1QVG Z;  1KC8 2;  4A3L I;  4RV9 A;  1VQ9 1;  1VQL Z;  3FQQ A;  1YJN Z;  3JAM b;  1JJ2 Z;  4EWC A;  3MON A;  4X6A I;  4RVD A;  2JA6 I;  5A2Q f;  3RZO I;  3GTK I;  2DE6 A;  3HOW I;  3J80 b;  3M4O I;  1QYP A;  3CCL Z;  3VB9 A;  3G6E 1;  3CCQ Z;  4A3M I;  1W2B Y;  2IZ3 A;  2OTL Z;  1S72 1;  4E33 A;  3TE5 B;  2LFU A;  1YI2 1;  2EGT A;  3GTM I;  2RHB A;  3NDJ A;  2G2K A;  1VQ4 1;  3I4M I;  1KD1 2;  2OOX B;  1K9M 1;  4DGL A;  1VQN Z;  1K73 2;  2PM9 A;  3PO3 I;  3D6W A;  4E32 A;  1QVG Y;  4DK1 A;  1I6H I;  2GTH A;  3S1N I;  3S16 I;  2YU9 I;  2DE5 A;  2R6M A;  1VQM Z;  1VQK 1;  1FDI A;  4E2X A;  1JJ2 Y;  3CCJ 1;  3MZK B;  1Q7Y 1;  2JA5 I;  3JAM f;  2NVQ I;  3HOV I;  1Z02 A;  3I07 A;  3G71 Z;  2VPY A;  1RLY A;  3MZL B;  3CMA 1;  1YJN 1;  1YJ9 Z;  4A3F I;  2AKL A;  2NVY I;  3J80 f;  2VPX A;  1SFO I;  4RS4 A;  1N8R 2;  4NBC A;  3CD6 1;  1Q81 2;  3D9X A;  3CCL 1;  1TWC I;  1YUK A;  2B63 I;  2R93 I;  2NAP A;  3S2D I;  4E31 A;  4AYB A;  5FLX b;  2H85 A;  5C44 I;  4A3D I;  2HU9 A;  1VQ5 1;  4NOZ A;  3S14 I; 
#chains in the Genus database with same CATH homology
 1KRL A;  1TFI A;  1ML8 A;  3IFU A;  3GTJ I;  4NH1 C;  2F4M A;  4E30 A;  3CCU Z;  1TWH I;  3F3F C;  5D1O B;  3HOX I;  1RO4 A;  2F4O A;  3CCS Z;  4MD8 A;  2R92 I;  3CC2 Z;  4NB8 A;  4E2W A;  1Z01 A;  1KD1 1;  3BG0 B;  3IF8 A;  4NBE A;  3S1M I;  5FLM I;  3S2H I;  3I56 Z;  3S1R I;  2QA4 Z;  1VQO Z;  3NFZ A;  1M90 1;  1VQ7 1;  2JA7 I;  3VMH A;  5T64 A;  1QF8 A;  4E2Y A;  5LL6 f;  1YHQ 1;  4A93 I;  5FLX f;  2ZAE B;  3G4S Z;  3CME Z;  4NBB A;  2WAQ A;  2RT9 A;  3GTG I;  2VUM I;  1R9T I;  2QEX 1;  2V8I A;  3CC7 1;  4NBD A;  2LIY A;  3FQM A;  4A3I I;  2E2H I;  1Q81 1;  4A3G I;  1Q86 2;  3OW2 Y;  2JNY A;  3EED A;  1ZB8 A;  4MD7 A;  3F3P C;  3GCF A;  1Y1V S;  3CPW Y;  3GTL I;  3CXC Z;  3CCR 1;  1YJW Z;  3VTN A;  2JS4 A;  1WW9 A;  2O53 A;  1JWH C;  3ESW A;  1M1K 2;  1KQS Z;  1Q82 2;  3GTP I;  2V8K A;  2JA8 I;  1NJI 1;  3I56 1;  4QTT A;  5IP9 I;  2IZ4 A;  4E2Z A;  3Q87 A;  4RVH A;  4NBG A;  4A3E I;  2QRC B;  3CCM Z;  3HOU I;  3CC4 Z;  2O4H A;  1VQL 1;  2OOY B;  4RVF A;  1K8A 2;  1VQ6 Z;  2PMZ A;  4NBH A;  2RBL A;  4NBF A;  2M48 A;  2QLV B;  2R7Z I;  3H0G I;  5C3E I;  1KC8 1;  2V8J A;  1I50 I;  1NUI A;  4BBS I;  4NBA A;  3CCE Z;  3CCQ 1;  4DQY B;  3J7A 4;  1QVF Z;  3S1Q I;  4XX2 A;  5C4J I;  2OTL 1;  1RO2 A;  1VQ8 Z;  4S1T A;  5AN9 F;  1I3Q I;  1TWF I;  3M3Y I;  2E2I I;  1X3W A;  2PK7 A;  1YJW 1;  1S7M A;  2P3Y A;  1VQN 1;  5D1P A;  5CM2 M;  3CCV Z;  1YIT Z;  3HOZ I;  4BY7 I;  1PFT A;  3J81 b;  1USP B;  1VQM 1;  2WB1 A;  4NB9 A;  1VQP Z;  3P5J B;  1WCM I;  1WII A;  3NH5 A;  1YIJ Z;  1K73 1;  1S72 Z;  2GTI A;  1RQF A;  3CC4 1;  2J6A A;  3G71 1;  2JMO A;  2K5R A;  1YI2 Z;  5T67 A;  3S17 I;  1P9N A;  1YUA A;  1YJ9 1;  1VQ4 Z;  1VQ6 1;  1Q7Y 2;  1N2F A;  2JUB A;  3KIH A;  2QR1 B;  5D1O A;  4MXU A;  1VQK Z;  1NP6 A;  2NVX I;  3GTQ I;  3I55 Z;  2JR6 A;  3IX0 A;  1X0T A;  3LUS A;  1N8R 1;  1L1O C;  1ZB9 A;  3CMA Z;  2GU2 A;  3J81 f;  3CCU 1;  3CCV 1;  2QRD B;  1YIT 1;  2OZK A;  3KIF A;  4NFR A;  2KPI A;  3CCS 1;  2Q51 A;  3CD6 Z;  1VQP 1;  1Y1V I;  3T4N B;  4TNU A;  1RO0 A;  3CC2 1;  2HF1 A;  1YIJ 1;  4MD9 A;  3GTM S;  1Y1W I;  4RVG A;  1VQ5 Z;  3GTO I;  2VUG A;  1RNI A;  2QRE B;  3NDI A;  1VQO 1;  1X3Z A;  3CQZ I;  2QA4 1;  1K83 I;  3PO3 S;  2YAD A;  1ZH1 A;  3PO2 I;  2OTJ Z;  4A3B I;  5T6B A;  1M90 2;  3G4S 1;  2BJO A;  3CME 1;  3HKZ A;  4QTU A;  4CL1 A;  1DL6 A;  3FKI I;  3I55 1;  4MON A;  3CXC Y;  1Z03 A;  3S15 I;  2E2J I;  3K7A I;  4BXX I;  1VLA A;  4A3C I;  1VQ7 Z;  2DE7 A;  3VMG A;  4MRI A;  2RIQ A;  3RZD I;  1VQ9 Z;  1KQS Y;  2W03 A;  5IT9 b;  5C4X I;  1YHQ Z;  4BY1 I;  2RPR A;  4HGZ A;  1LQL A;  2W04 A;  3H3V J;  3EER A;  2P28 A;  1Q86 1;  2Q4Z A;  2NVT I;  1K9M 2;  2QEX Z;  4HH4 A;  4A3K I;  3BG1 B;  3G6E Z;  5A2Q b;  3CC7 Z;  3TDH B;  3QWU A;  3CCM 1;  2QKD A;  2VF1 A;  1NJI 2;  2K3R A;  1M1K 1;  3U50 C;  2OTJ 1;  4Y7N I;  3CCR Z;  4A3J I;  1Q82 1;  2KI7 B;  1W2B Z;  1QVF Y;  2Y0S A;  3GKQ A;  3OW2 Z;  3NH8 A;  3HOY I;  2E9H A;  4BBR I;  3NH4 A;  3VMI A;  3CPW Z;  3CCE 1;  2I3C A;  1TWA I;  1TWG I;  3I4N I;  4Y52 I;  1USP A;  3CCJ Z;  4HGY A;  2M6N A;  1K8A 1;  5IP7 I;  5IT9 f;  4MH4 A;  1VQ8 1;  1QVG Z;  1KC8 2;  4A3L I;  4RV9 A;  1VQ9 1;  1VQL Z;  3FQQ A;  1YJN Z;  3JAM b;  1JJ2 Z;  4EWC A;  3MON A;  4X6A I;  4RVD A;  2JA6 I;  5A2Q f;  3RZO I;  3GTK I;  2DE6 A;  3HOW I;  3J80 b;  3M4O I;  1QYP A;  3CCL Z;  3VB9 A;  3G6E 1;  3CCQ Z;  4A3M I;  1W2B Y;  2IZ3 A;  2OTL Z;  1S72 1;  4E33 A;  3TE5 B;  2LFU A;  1YI2 1;  2EGT A;  3GTM I;  2RHB A;  3NDJ A;  2G2K A;  1VQ4 1;  3I4M I;  1KD1 2;  2OOX B;  1K9M 1;  4DGL A;  1VQN Z;  1K73 2;  2PM9 A;  3PO3 I;  3D6W A;  4E32 A;  1QVG Y;  4DK1 A;  1I6H I;  2GTH A;  3S1N I;  3S16 I;  2YU9 I;  2DE5 A;  2R6M A;  1VQM Z;  1VQK 1;  4E2X A;  1JJ2 Y;  3CCJ 1;  3MZK B;  1Q7Y 1;  2JA5 I;  3JAM f;  2NVQ I;  3HOV I;  1Z02 A;  3I07 A;  3G71 Z;  1RLY A;  3MZL B;  3CMA 1;  1YJN 1;  1YJ9 Z;  4A3F I;  2AKL A;  2NVY I;  3J80 f;  1SFO I;  4RS4 A;  1N8R 2;  4NBC A;  3CD6 1;  1Q81 2;  3D9X A;  3CCL 1;  1TWC I;  1YUK A;  2B63 I;  2R93 I;  3S2D I;  4E31 A;  4AYB A;  5FLX b;  2H85 A;  5C44 I;  4A3D I;  2HU9 A;  1VQ5 1;  4NOZ A;  3S14 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...