2JA5I

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I02
2J6AA 2R92I 1LQLA 3LUSA 2AKLA 3PO2I 4Y52I 1I50I 1PFTA 2NVTI 4XX2A 4A3FI 1WCMI 1VLAA 3HOUI 2R7ZI 3RZOI 4NBBA 4A3II 4MH4A 2PK7A 3S2HI 2B63I 1TWAI 4NBCA 1ZB9A 3FKII 1TWFI 2DE5A 2JA8I 3I4NI 3S2DI 1WW9A 1RLYA 4NB9A 2DE7A 2DE6A 1TWCI 1N2FA 4QTTA 3VMHA 3HOXI 1X3ZA 2NVXI 1NUIA 1Y1VI 4Y7NI 1ZB8A 3H0GI 3I4MI 2F4OA 3Q87A 5C4XI 1Y1WI 3S17I 2NVYI 1RO4A 2JNYA 1YUAA 3D6WA 4NBDA 5C3EI 4A3KI 5C44I 1DL6A 3CQZI 2BJOA 3S15I 4BY7I 2RBLA 4QTUA 4A3EI 4NB8A 2P3YA 4X6AI 3M3YI 4NBAA 2JA6I 1R9TI 3VMIA 3GTGI 3GTOI 2JS4A 2E2II 4BBSI 4BBRI 2JR6A 4A3JI 3HOZI 4A3CI 2JA7I 3GTMI 3I07A 4NBHA 3S1RI 3HOWI 1TWGI 3GTLI 1SFOI 3GKQA 1L1OC 4A3BI 1TFIA 3S1MI 3GTJI 1I6HI 3GTKI 2R93I 1Y1VS 3ESWA 4NBFA 3S1QI 4A3GI 3EERA 3RZDI 3S1NI 1I3QI 3GTMS 2YU9I 4A3DI 3H3VJ 3M4OI 2NVQI 5IP7I 5FLMI 4A3MI 4BY1I 1K83I 3GTQI 1TWHI 2VUMI 3PO3I 2F4MA 4A3LI 3GTPI 2K5RA 1ML8A 5IP9I 2HF1A 5CM2M 1QYPA 4NOZA 2JA5I 1USPB 1X3WA 1USPA 4A93I 4NBEA 4NBGA 3S16I 3K7AI 3S14I 2E2JI 3HOVI 2KPIA 3VB9A 2E2HI 3VMGA 3PO3S 3GCFA 5C4JI 4BXXI 3U50C 3HOYI
chains in the Genus database with same CATH superfamily
1VQ61 4Y52I 2R92I 2PMZA 1PFTA 1VQ71 3MZLB 3CXCY 1M902 2QREB 1VLAA 1QVFY 1K8A1 4E33A 3S2HI 1QXFA 1WW9A 1VQO1 1YJNZ 2DE6A 2WB1A 2GTHA 3J7A4 4MD8A 1VQ9Z 3H0GI 1Q821 4RS4A 1YUAA 5C3EI 3CPWY 1M901 2IZ4A 3JAMf 1DL6A 1N8R1 1VQK1 3S15I 3OW2Z 4BY7I 1JJ2Z 1S72Z 4NB8A 1WZNA 3IR7A 3KIHA 3GTGI 3CMEZ 2E2II 1QVGY 2JR6A 3HOZI 3I07A 4NBHA 4NFRA 1KQSY 2E7ZA 4RV9A 1YUKA 3HKZA 1L1OC 4HH4A 1TFIA 2VPYA 3J80b 3GTJI 1VQ8Z 3GTKI 3S1QI 1VQLZ 3S1NI 1I3QI 5IT9f 1S7MA 2Q4ZA 2YU9I 1ZH1A 2JMOA 4BY1I 1YIT1 4A3LI 4DQYB 3GTPI 2K5RA 1ML8A 1KD12 2HF1A 3QWUA 3CD6Z 3G6EZ 1Q812 4E31A 3CCQZ 1USPB 1X3WA 1YITZ 3T4NB 2JUBA 4NBGA 1VQMZ 2E2JI 3HOVI 3NDJA 3VB9A 3CCV1 2E2HI 4E2XA 3VMGA 4DGLA 1VQN1 5D1PA 4RVGA 3NH8A 3HOYI 2J6AA 1LQLA 5A2Qb 3CC4Z 1K9M2 1YI21 2E9HA 2QEX1 2R7ZI 1RO2A 3IF8A 4A3II 3S2DI 4NBCA 2JA8I 3I561 4NB9A 1K8A2 2DE7A 2Q51A 1N2FA 3CCM1 3HOXI 2Y0SA 1X3ZA 2NVXI 1Z01A 1NUIA 4E30A 4NH1C 2GU2A 4HGZA 2F4OA 2OZKA 3Q87A 1AA6A 1Y1WI 4MXUA 1Z03A 3S17I 2H85A 2NAPA 1QF8A 3D9XA 1KRLA 2W04A 4NBDA 1Q822 2V8IA 1W2BY 1YJN1 3CQZI 2BJOA 5FLXf 1VQ91 1N8R2 4A3EI 2VUGA 2OTJZ 2P3YA 1YJ9Z 4NBAA 2JIPA 2JA6I 3VMIA 2JS4A 4BBSI 5D1OA 1Z02A 2RPRA 1VQPZ 4A3JI 2LFUA 3VTNA 4A3CI 3S1RI 4RVHA 1S721 1SFOI 3CMAZ 4E32A 3CME1 1WIIA 2R93I 4NBFA 3EEDA 3EERA 3CPWZ 2KI7B 3GTMS 3OW2Y 3NFZA 1JJ2Y 1NP6A 3M4OI 2WAQA 3J81f 5T6BA 5IP7I 4A3MI 3GTQI 1TWHI 1VQ81 3PO3I 2R6MA 3G4SZ 1JWHC 3CCLZ 1VQL1 1Q862 2LIYA 2JA5I 1P9NA 3S16I 3S14I 2YADA 3FQMA 1WJ2A 2KPIA 2QLVB 1FDIA 3BG0B 2QA4Z 3U50C 4A3GI 2EGTA 3PO2I 3LUSA 2AKLA 3CD61 3G6E1 1I50I 3CC7Z 2NVTI 3CCQ1 1M1K1 2PM9A 3JAMb 1YIJZ 2OOYB 1Q861 4A3FI 3CCJZ 1VQM1 2ZAEB 1WCMI 2RIQA 3HOUI 1YHQZ 3RZOI 4NBBA 2B63I 1ZB9A 3FKII 1TWFI 4MD9A 3IFUA 2M6NA 2JIOA 1K731 1NJI1 3VMHA 2G2KA 1X0TA 4Y7NI 5D1OB 1ZB8A 3CC41 3I4MI 1VQ4Z 3P5JB 5C4XI 2NVYI 2RT9A 5LL6f 4A3KI 2JIQA 2JIRA 5C44I 2V8KA 2QKDA 1YJWZ 5AN9F 2V45A 3M3YI 2OTLZ 1R9TI 5IT9b 2O53A 3GTOI 2GTIA 3CCSZ 1KC81 2JA7I 1Q7Y2 3D2LA 3CC2Z 2OTJ1 3GKQA 1YJ91 4A3BI 3S1MI 3CCRZ 2P28A 1I6HI 1Y1VS 3ESWA 2VPWA 1VQP1 3G71Z 3CCUZ 3RZDI 4A3DI 3CXCZ 4E2ZA 4RVDA 3CMA1 1QVFZ 3MONA 1Q7Y1 3I55Z 2VUMI 5IP9I 3BG1B 3TDHB 2QRCB 1VQ6Z 1QYPA 4NOZA 4MRIA 3J80f 1VQ7Z 1USPA 4A93I 4NBEA 5T67A 3IX0A 4AYBA 1VQ51 3NDIA 3GCFA 1VQOZ 2IZ3A 3G4S1 4BXXI 3CCL1 1VQ5Z 4EWCA 4XX2A 4RVFA 3CCE1 4MD7A 1M1K2 1Y8CA 2V8JA 4MH4A 2PK7A 5FLXb 2VF1A 1TWAI 3I4NI 2QR1B 2DE5A 1QVGZ 1RLYA 2QA41 4E2YA 1TWCI 4QTTA 1KQSZ 1VQKZ 3CCEZ 3CC71 1Y1VI 1K732 1NJI2 1YIJ1 1RNIA 2V3VA 3CCJ1 2AYDA 1RO4A 1YHQ1 2JNYA 3D6WA 3NH4A 5A2Qf 1Q16A 3MZKB 2RBLA 4QTUA 1VQ41 4E2WA 4X6AI 2IV2X 2VPZA 4BBRI 3J81b 3GTMI 3HOWI 1TWGI 1KC82 3GTLI 1SIWA 1YJW1 2LEXA 2OTL1 2OOXB 4CL1A 4TNUA 3NH5A 2M48A 2O4HA 4HGYA 4DK1A 3TE5B 3CCS1 3CC21 2QRDB 3F3PC 3H3VJ 2NVQI 2HU9A 1RQFA 5FLMI 3CCR1 1K83I 3CCVZ 2JIMA 5T64A 2F4MA 1KD11 2RHBA 1VQNZ 3G711 1Q811 3CCU1 1FDOA 3KIFA 2K3RA 2I3CA 4MONA 2VPXA 5CM2M 1YI2Z 2QEXZ 3K7AI 4S1TA 3F3FC 3I551 1W2BZ 3I56Z 2W03A 1RO0A 3FQQA 3PO3S 5C4JI 1K9M1 3CCMZ
chains in the Genus database with same CATH topology
1VQ61 4Y52I 2R92I 2PMZA 1PFTA 1VQ71 3MZLB 3CXCY 1M902 2QREB 1VLAA 1QVFY 1K8A1 4E33A 3S2HI 1WW9A 1VQO1 1YJNZ 2DE6A 2WB1A 2GTHA 3J7A4 4MD8A 1VQ9Z 3H0GI 1Q821 4RS4A 1YUAA 5C3EI 3CPWY 1M901 2IZ4A 3JAMf 1DL6A 1N8R1 1VQK1 3S15I 3OW2Z 4BY7I 1JJ2Z 1S72Z 4NB8A 3KIHA 3GTGI 3CMEZ 2E2II 1QVGY 2JR6A 3HOZI 3I07A 4NBHA 4NFRA 1KQSY 4RV9A 1YUKA 3HKZA 1L1OC 4HH4A 1TFIA 3J80b 3GTJI 1VQ8Z 3GTKI 3S1QI 1VQLZ 3S1NI 1I3QI 5IT9f 1S7MA 2Q4ZA 2YU9I 1ZH1A 2JMOA 4BY1I 1YIT1 4A3LI 4DQYB 3GTPI 2K5RA 1ML8A 1KD12 2HF1A 3QWUA 3CD6Z 3G6EZ 1Q812 4E31A 3CCQZ 1USPB 1X3WA 1YITZ 3T4NB 2JUBA 4NBGA 1VQMZ 2E2JI 3HOVI 3NDJA 3VB9A 3CCV1 2E2HI 4E2XA 3VMGA 4DGLA 1VQN1 5D1PA 4RVGA 3NH8A 3HOYI 2J6AA 1LQLA 5A2Qb 3CC4Z 1K9M2 1YI21 2E9HA 2QEX1 2R7ZI 1RO2A 3IF8A 4A3II 3S2DI 4NBCA 2JA8I 3I561 4NB9A 1K8A2 2DE7A 2Q51A 1N2FA 3CCM1 3HOXI 2Y0SA 1X3ZA 2NVXI 1Z01A 1NUIA 4E30A 4NH1C 2GU2A 4HGZA 2F4OA 2OZKA 3Q87A 1Y1WI 4MXUA 1Z03A 3S17I 2H85A 1QF8A 3D9XA 1KRLA 2W04A 4NBDA 1Q822 2V8IA 1W2BY 1YJN1 3CQZI 2BJOA 5FLXf 1VQ91 1N8R2 4A3EI 2VUGA 2OTJZ 2P3YA 1YJ9Z 4NBAA 2JA6I 3VMIA 2JS4A 4BBSI 5D1OA 1Z02A 2RPRA 1VQPZ 4A3JI 2LFUA 3VTNA 4A3CI 3S1RI 4RVHA 1S721 1SFOI 3CMAZ 4E32A 3CME1 1WIIA 2R93I 4NBFA 3EEDA 3EERA 3CPWZ 2KI7B 3GTMS 3OW2Y 3NFZA 1JJ2Y 1NP6A 3M4OI 2WAQA 3J81f 5T6BA 5IP7I 4A3MI 3GTQI 1TWHI 1VQ81 3PO3I 2R6MA 3G4SZ 1JWHC 3CCLZ 1VQL1 1Q862 2LIYA 2JA5I 1P9NA 3S16I 3S14I 2YADA 3FQMA 2KPIA 2QLVB 3BG0B 2QA4Z 3U50C 4A3GI 2EGTA 3PO2I 3LUSA 2AKLA 3CD61 3G6E1 1I50I 3CC7Z 2NVTI 3CCQ1 1M1K1 2PM9A 3JAMb 1YIJZ 2OOYB 1Q861 4A3FI 3CCJZ 1VQM1 2ZAEB 1WCMI 2RIQA 3HOUI 1YHQZ 3RZOI 4NBBA 2B63I 1ZB9A 3FKII 1TWFI 4MD9A 3IFUA 2M6NA 1K731 1NJI1 3VMHA 2G2KA 1X0TA 4Y7NI 5D1OB 1ZB8A 3CC41 3I4MI 1VQ4Z 3P5JB 5C4XI 2NVYI 2RT9A 5LL6f 4A3KI 5C44I 2V8KA 2QKDA 1YJWZ 5AN9F 3M3YI 2OTLZ 1R9TI 5IT9b 2O53A 3GTOI 2GTIA 3CCSZ 1KC81 2JA7I 1Q7Y2 3CC2Z 2OTJ1 3GKQA 1YJ91 4A3BI 3S1MI 3CCRZ 2P28A 1I6HI 1Y1VS 3ESWA 1VQP1 3G71Z 3CCUZ 3RZDI 4A3DI 3CXCZ 4E2ZA 4RVDA 3CMA1 1QVFZ 3MONA 1Q7Y1 3I55Z 2VUMI 5IP9I 3BG1B 3TDHB 2QRCB 1VQ6Z 1QYPA 4NOZA 4MRIA 3J80f 1VQ7Z 1USPA 4A93I 4NBEA 5T67A 3IX0A 4AYBA 1VQ51 3NDIA 3GCFA 1VQOZ 2IZ3A 3G4S1 4BXXI 3CCL1 1VQ5Z 4EWCA 4XX2A 4RVFA 3CCE1 4MD7A 1M1K2 2V8JA 4MH4A 2PK7A 5FLXb 2VF1A 1TWAI 3I4NI 2QR1B 2DE5A 1QVGZ 1RLYA 2QA41 4E2YA 1TWCI 4QTTA 1KQSZ 1VQKZ 3CCEZ 3CC71 1Y1VI 1K732 1NJI2 1YIJ1 1RNIA 3CCJ1 1RO4A 1YHQ1 2JNYA 3D6WA 3NH4A 5A2Qf 3MZKB 2RBLA 4QTUA 1VQ41 4E2WA 4X6AI 4BBRI 3J81b 3GTMI 3HOWI 1TWGI 1KC82 3GTLI 1YJW1 2OTL1 2OOXB 4CL1A 4TNUA 3NH5A 2M48A 2O4HA 4HGYA 4DK1A 3TE5B 3CCS1 3CC21 2QRDB 3F3PC 3H3VJ 2NVQI 2HU9A 1RQFA 5FLMI 3CCR1 1K83I 3CCVZ 5T64A 2F4MA 1KD11 2RHBA 1VQNZ 3G711 1Q811 3CCU1 3KIFA 2K3RA 2I3CA 4MONA 5CM2M 1YI2Z 2QEXZ 3K7AI 4S1TA 3F3FC 3I551 1W2BZ 3I56Z 2W03A 1RO0A 3FQQA 3PO3S 5C4JI 1K9M1 3CCMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J6A A;  2R92 I;  1LQL A;  3LUS A;  2AKL A;  3PO2 I;  4Y52 I;  1I50 I;  1PFT A;  2NVT I;  4XX2 A;  4A3F I;  1WCM I;  1VLA A;  3HOU I;  2R7Z I;  3RZO I;  4NBB A;  4A3I I;  4MH4 A;  2PK7 A;  3S2H I;  2B63 I;  1TWA I;  4NBC A;  1ZB9 A;  3FKI I;  1TWF I;  2DE5 A;  2JA8 I;  3I4N I;  3S2D I;  1WW9 A;  1RLY A;  4NB9 A;  2DE7 A;  2DE6 A;  1TWC I;  1N2F A;  4QTT A;  3VMH A;  3HOX I;  1X3Z A;  2NVX I;  1NUI A;  1Y1V I;  4Y7N I;  1ZB8 A;  3H0G I;  3I4M I;  2F4O A;  3Q87 A;  5C4X I;  1Y1W I;  3S17 I;  2NVY I;  1RO4 A;  2JNY A;  1YUA A;  3D6W A;  4NBD A;  5C3E I;  4A3K I;  5C44 I;  1DL6 A;  3CQZ I;  2BJO A;  3S15 I;  4BY7 I;  2RBL A;  4QTU A;  4A3E I;  4NB8 A;  2P3Y A;  4X6A I;  3M3Y I;  4NBA A;  2JA6 I;  1R9T I;  3VMI A;  3GTG I;  3GTO I;  2JS4 A;  2E2I I;  4BBS I;  4BBR I;  2JR6 A;  4A3J I;  3HOZ I;  4A3C I;  2JA7 I;  3GTM I;  3I07 A;  4NBH A;  3S1R I;  3HOW I;  1TWG I;  3GTL I;  1SFO I;  3GKQ A;  1L1O C;  4A3B I;  1TFI A;  3S1M I;  3GTJ I;  1I6H I;  3GTK I;  2R93 I;  1Y1V S;  3ESW A;  4NBF A;  3S1Q I;  4A3G I;  3EER A;  3RZD I;  3S1N I;  1I3Q I;  3GTM S;  2YU9 I;  4A3D I;  3H3V J;  3M4O I;  2NVQ I;  5IP7 I;  5FLM I;  4A3M I;  4BY1 I;  1K83 I;  3GTQ I;  1TWH I;  2VUM I;  3PO3 I;  2F4M A;  4A3L I;  3GTP I;  2K5R A;  1ML8 A;  5IP9 I;  2HF1 A;  5CM2 M;  1QYP A;  4NOZ A;  2JA5 I;  1USP B;  1X3W A;  1USP A;  4A93 I;  4NBE A;  4NBG A;  3S16 I;  3K7A I;  3S14 I;  2E2J I;  3HOV I;  2KPI A;  3VB9 A;  2E2H I;  3VMG A;  3PO3 S;  3GCF A;  5C4J I;  4BXX I;  3U50 C;  3HOY I; 
#chains in the Genus database with same CATH topology
 1VQ6 1;  4Y52 I;  2R92 I;  2PMZ A;  1PFT A;  1VQ7 1;  3MZL B;  3CXC Y;  1M90 2;  2QRE B;  1VLA A;  1QVF Y;  1K8A 1;  4E33 A;  3S2H I;  1QXF A;  1WW9 A;  1VQO 1;  1YJN Z;  2DE6 A;  2WB1 A;  2GTH A;  3J7A 4;  4MD8 A;  1VQ9 Z;  3H0G I;  1Q82 1;  4RS4 A;  1YUA A;  5C3E I;  3CPW Y;  1M90 1;  2IZ4 A;  3JAM f;  1DL6 A;  1N8R 1;  1VQK 1;  3S15 I;  3OW2 Z;  4BY7 I;  1JJ2 Z;  1S72 Z;  4NB8 A;  1WZN A;  3IR7 A;  3KIH A;  3GTG I;  3CME Z;  2E2I I;  1QVG Y;  2JR6 A;  3HOZ I;  3I07 A;  4NBH A;  4NFR A;  1KQS Y;  2E7Z A;  4RV9 A;  1YUK A;  3HKZ A;  1L1O C;  4HH4 A;  1TFI A;  2VPY A;  3J80 b;  3GTJ I;  1VQ8 Z;  3GTK I;  3S1Q I;  1VQL Z;  3S1N I;  1I3Q I;  5IT9 f;  1S7M A;  2Q4Z A;  2YU9 I;  1ZH1 A;  2JMO A;  4BY1 I;  1YIT 1;  4A3L I;  4DQY B;  3GTP I;  2K5R A;  1ML8 A;  1KD1 2;  2HF1 A;  3QWU A;  3CD6 Z;  3G6E Z;  1Q81 2;  4E31 A;  3CCQ Z;  1USP B;  1X3W A;  1YIT Z;  3T4N B;  2JUB A;  4NBG A;  1VQM Z;  2E2J I;  3HOV I;  3NDJ A;  3VB9 A;  3CCV 1;  2E2H I;  4E2X A;  3VMG A;  4DGL A;  1VQN 1;  5D1P A;  4RVG A;  3NH8 A;  3HOY I;  2J6A A;  1LQL A;  5A2Q b;  3CC4 Z;  1K9M 2;  1YI2 1;  2E9H A;  2QEX 1;  2R7Z I;  1RO2 A;  3IF8 A;  4A3I I;  3S2D I;  4NBC A;  2JA8 I;  3I56 1;  4NB9 A;  1K8A 2;  2DE7 A;  2Q51 A;  1N2F A;  3CCM 1;  3HOX I;  2Y0S A;  1X3Z A;  2NVX I;  1Z01 A;  1NUI A;  4E30 A;  4NH1 C;  2GU2 A;  4HGZ A;  2F4O A;  2OZK A;  3Q87 A;  1AA6 A;  1Y1W I;  4MXU A;  1Z03 A;  3S17 I;  2H85 A;  2NAP A;  1QF8 A;  3D9X A;  1KRL A;  2W04 A;  4NBD A;  1Q82 2;  2V8I A;  1W2B Y;  1YJN 1;  3CQZ I;  2BJO A;  5FLX f;  1VQ9 1;  1N8R 2;  4A3E I;  2VUG A;  2OTJ Z;  2P3Y A;  1YJ9 Z;  4NBA A;  2JIP A;  2JA6 I;  3VMI A;  2JS4 A;  4BBS I;  5D1O A;  1Z02 A;  2RPR A;  1VQP Z;  4A3J I;  2LFU A;  3VTN A;  4A3C I;  3S1R I;  4RVH A;  1S72 1;  1SFO I;  3CMA Z;  4E32 A;  3CME 1;  1WII A;  2R93 I;  4NBF A;  3EED A;  3EER A;  3CPW Z;  2KI7 B;  3GTM S;  3OW2 Y;  3NFZ A;  1JJ2 Y;  1NP6 A;  3M4O I;  2WAQ A;  3J81 f;  5T6B A;  5IP7 I;  4A3M I;  3GTQ I;  1TWH I;  1VQ8 1;  3PO3 I;  2R6M A;  3G4S Z;  1JWH C;  3CCL Z;  1VQL 1;  1Q86 2;  2LIY A;  2JA5 I;  1P9N A;  3S16 I;  3S14 I;  2YAD A;  3FQM A;  1WJ2 A;  2KPI A;  2QLV B;  1FDI A;  3BG0 B;  2QA4 Z;  3U50 C;  4A3G I;  2EGT A;  3PO2 I;  3LUS A;  2AKL A;  3CD6 1;  3G6E 1;  1I50 I;  3CC7 Z;  2NVT I;  3CCQ 1;  1M1K 1;  2PM9 A;  3JAM b;  1YIJ Z;  2OOY B;  1Q86 1;  4A3F I;  3CCJ Z;  1VQM 1;  2ZAE B;  1WCM I;  2RIQ A;  3HOU I;  1YHQ Z;  3RZO I;  4NBB A;  2B63 I;  1ZB9 A;  3FKI I;  1TWF I;  4MD9 A;  3IFU A;  2M6N A;  2JIO A;  1K73 1;  1NJI 1;  3VMH A;  2G2K A;  1X0T A;  4Y7N I;  5D1O B;  1ZB8 A;  3CC4 1;  3I4M I;  1VQ4 Z;  3P5J B;  5C4X I;  2NVY I;  2RT9 A;  5LL6 f;  4A3K I;  2JIQ A;  2JIR A;  5C44 I;  2V8K A;  2QKD A;  1YJW Z;  5AN9 F;  2V45 A;  3M3Y I;  2OTL Z;  1R9T I;  5IT9 b;  2O53 A;  3GTO I;  2GTI A;  3CCS Z;  1KC8 1;  2JA7 I;  1Q7Y 2;  3D2L A;  3CC2 Z;  2OTJ 1;  3GKQ A;  1YJ9 1;  4A3B I;  3S1M I;  3CCR Z;  2P28 A;  1I6H I;  1Y1V S;  3ESW A;  2VPW A;  1VQP 1;  3G71 Z;  3CCU Z;  3RZD I;  4A3D I;  3CXC Z;  4E2Z A;  4RVD A;  3CMA 1;  1QVF Z;  3MON A;  1Q7Y 1;  3I55 Z;  2VUM I;  5IP9 I;  3BG1 B;  3TDH B;  2QRC B;  1VQ6 Z;  1QYP A;  4NOZ A;  4MRI A;  3J80 f;  1VQ7 Z;  1USP A;  4A93 I;  4NBE A;  5T67 A;  3IX0 A;  4AYB A;  1VQ5 1;  3NDI A;  3GCF A;  1VQO Z;  2IZ3 A;  3G4S 1;  4BXX I;  3CCL 1;  1VQ5 Z;  4EWC A;  4XX2 A;  4RVF A;  3CCE 1;  4MD7 A;  1M1K 2;  1Y8C A;  2V8J A;  4MH4 A;  2PK7 A;  5FLX b;  2VF1 A;  1TWA I;  3I4N I;  2QR1 B;  2DE5 A;  1QVG Z;  1RLY A;  2QA4 1;  4E2Y A;  1TWC I;  4QTT A;  1KQS Z;  1VQK Z;  3CCE Z;  3CC7 1;  1Y1V I;  1K73 2;  1NJI 2;  1YIJ 1;  1RNI A;  2V3V A;  3CCJ 1;  2AYD A;  1RO4 A;  1YHQ 1;  2JNY A;  3D6W A;  3NH4 A;  5A2Q f;  1Q16 A;  3MZK B;  2RBL A;  4QTU A;  1VQ4 1;  4E2W A;  4X6A I;  2IV2 X;  2VPZ A;  4BBR I;  3J81 b;  3GTM I;  3HOW I;  1TWG I;  1KC8 2;  3GTL I;  1SIW A;  1YJW 1;  2LEX A;  2OTL 1;  2OOX B;  4CL1 A;  4TNU A;  3NH5 A;  2M48 A;  2O4H A;  4HGY A;  4DK1 A;  3TE5 B;  3CCS 1;  3CC2 1;  2QRD B;  3F3P C;  3H3V J;  2NVQ I;  2HU9 A;  1RQF A;  5FLM I;  3CCR 1;  1K83 I;  3CCV Z;  2JIM A;  5T64 A;  2F4M A;  1KD1 1;  2RHB A;  1VQN Z;  3G71 1;  1Q81 1;  3CCU 1;  1FDO A;  3KIF A;  2K3R A;  2I3C A;  4MON A;  2VPX A;  5CM2 M;  1YI2 Z;  2QEX Z;  3K7A I;  4S1T A;  3F3F C;  3I55 1;  1W2B Z;  3I56 Z;  2W03 A;  1RO0 A;  3FQQ A;  3PO3 S;  5C4J I;  1K9M 1;  3CCM Z; 
#chains in the Genus database with same CATH homology
 1VQ6 1;  4Y52 I;  2R92 I;  2PMZ A;  1PFT A;  1VQ7 1;  3MZL B;  3CXC Y;  1M90 2;  2QRE B;  1VLA A;  1QVF Y;  1K8A 1;  4E33 A;  3S2H I;  1WW9 A;  1VQO 1;  1YJN Z;  2DE6 A;  2WB1 A;  2GTH A;  3J7A 4;  4MD8 A;  1VQ9 Z;  3H0G I;  1Q82 1;  4RS4 A;  1YUA A;  5C3E I;  3CPW Y;  1M90 1;  2IZ4 A;  3JAM f;  1DL6 A;  1N8R 1;  1VQK 1;  3S15 I;  3OW2 Z;  4BY7 I;  1JJ2 Z;  1S72 Z;  4NB8 A;  3KIH A;  3GTG I;  3CME Z;  2E2I I;  1QVG Y;  2JR6 A;  3HOZ I;  3I07 A;  4NBH A;  4NFR A;  1KQS Y;  4RV9 A;  1YUK A;  3HKZ A;  1L1O C;  4HH4 A;  1TFI A;  3J80 b;  3GTJ I;  1VQ8 Z;  3GTK I;  3S1Q I;  1VQL Z;  3S1N I;  1I3Q I;  5IT9 f;  1S7M A;  2Q4Z A;  2YU9 I;  1ZH1 A;  2JMO A;  4BY1 I;  1YIT 1;  4A3L I;  4DQY B;  3GTP I;  2K5R A;  1ML8 A;  1KD1 2;  2HF1 A;  3QWU A;  3CD6 Z;  3G6E Z;  1Q81 2;  4E31 A;  3CCQ Z;  1USP B;  1X3W A;  1YIT Z;  3T4N B;  2JUB A;  4NBG A;  1VQM Z;  2E2J I;  3HOV I;  3NDJ A;  3VB9 A;  3CCV 1;  2E2H I;  4E2X A;  3VMG A;  4DGL A;  1VQN 1;  5D1P A;  4RVG A;  3NH8 A;  3HOY I;  2J6A A;  1LQL A;  5A2Q b;  3CC4 Z;  1K9M 2;  1YI2 1;  2E9H A;  2QEX 1;  2R7Z I;  1RO2 A;  3IF8 A;  4A3I I;  3S2D I;  4NBC A;  2JA8 I;  3I56 1;  4NB9 A;  1K8A 2;  2DE7 A;  2Q51 A;  1N2F A;  3CCM 1;  3HOX I;  2Y0S A;  1X3Z A;  2NVX I;  1Z01 A;  1NUI A;  4E30 A;  4NH1 C;  2GU2 A;  4HGZ A;  2F4O A;  2OZK A;  3Q87 A;  1Y1W I;  4MXU A;  1Z03 A;  3S17 I;  2H85 A;  1QF8 A;  3D9X A;  1KRL A;  2W04 A;  4NBD A;  1Q82 2;  2V8I A;  1W2B Y;  1YJN 1;  3CQZ I;  2BJO A;  5FLX f;  1VQ9 1;  1N8R 2;  4A3E I;  2VUG A;  2OTJ Z;  2P3Y A;  1YJ9 Z;  4NBA A;  2JA6 I;  3VMI A;  2JS4 A;  4BBS I;  5D1O A;  1Z02 A;  2RPR A;  1VQP Z;  4A3J I;  2LFU A;  3VTN A;  4A3C I;  3S1R I;  4RVH A;  1S72 1;  1SFO I;  3CMA Z;  4E32 A;  3CME 1;  1WII A;  2R93 I;  4NBF A;  3EED A;  3EER A;  3CPW Z;  2KI7 B;  3GTM S;  3OW2 Y;  3NFZ A;  1JJ2 Y;  1NP6 A;  3M4O I;  2WAQ A;  3J81 f;  5T6B A;  5IP7 I;  4A3M I;  3GTQ I;  1TWH I;  1VQ8 1;  3PO3 I;  2R6M A;  3G4S Z;  1JWH C;  3CCL Z;  1VQL 1;  1Q86 2;  2LIY A;  2JA5 I;  1P9N A;  3S16 I;  3S14 I;  2YAD A;  3FQM A;  2KPI A;  2QLV B;  3BG0 B;  2QA4 Z;  3U50 C;  4A3G I;  2EGT A;  3PO2 I;  3LUS A;  2AKL A;  3CD6 1;  3G6E 1;  1I50 I;  3CC7 Z;  2NVT I;  3CCQ 1;  1M1K 1;  2PM9 A;  3JAM b;  1YIJ Z;  2OOY B;  1Q86 1;  4A3F I;  3CCJ Z;  1VQM 1;  2ZAE B;  1WCM I;  2RIQ A;  3HOU I;  1YHQ Z;  3RZO I;  4NBB A;  2B63 I;  1ZB9 A;  3FKI I;  1TWF I;  4MD9 A;  3IFU A;  2M6N A;  1K73 1;  1NJI 1;  3VMH A;  2G2K A;  1X0T A;  4Y7N I;  5D1O B;  1ZB8 A;  3CC4 1;  3I4M I;  1VQ4 Z;  3P5J B;  5C4X I;  2NVY I;  2RT9 A;  5LL6 f;  4A3K I;  5C44 I;  2V8K A;  2QKD A;  1YJW Z;  5AN9 F;  3M3Y I;  2OTL Z;  1R9T I;  5IT9 b;  2O53 A;  3GTO I;  2GTI A;  3CCS Z;  1KC8 1;  2JA7 I;  1Q7Y 2;  3CC2 Z;  2OTJ 1;  3GKQ A;  1YJ9 1;  4A3B I;  3S1M I;  3CCR Z;  2P28 A;  1I6H I;  1Y1V S;  3ESW A;  1VQP 1;  3G71 Z;  3CCU Z;  3RZD I;  4A3D I;  3CXC Z;  4E2Z A;  4RVD A;  3CMA 1;  1QVF Z;  3MON A;  1Q7Y 1;  3I55 Z;  2VUM I;  5IP9 I;  3BG1 B;  3TDH B;  2QRC B;  1VQ6 Z;  1QYP A;  4NOZ A;  4MRI A;  3J80 f;  1VQ7 Z;  1USP A;  4A93 I;  4NBE A;  5T67 A;  3IX0 A;  4AYB A;  1VQ5 1;  3NDI A;  3GCF A;  1VQO Z;  2IZ3 A;  3G4S 1;  4BXX I;  3CCL 1;  1VQ5 Z;  4EWC A;  4XX2 A;  4RVF A;  3CCE 1;  4MD7 A;  1M1K 2;  2V8J A;  4MH4 A;  2PK7 A;  5FLX b;  2VF1 A;  1TWA I;  3I4N I;  2QR1 B;  2DE5 A;  1QVG Z;  1RLY A;  2QA4 1;  4E2Y A;  1TWC I;  4QTT A;  1KQS Z;  1VQK Z;  3CCE Z;  3CC7 1;  1Y1V I;  1K73 2;  1NJI 2;  1YIJ 1;  1RNI A;  3CCJ 1;  1RO4 A;  1YHQ 1;  2JNY A;  3D6W A;  3NH4 A;  5A2Q f;  3MZK B;  2RBL A;  4QTU A;  1VQ4 1;  4E2W A;  4X6A I;  4BBR I;  3J81 b;  3GTM I;  3HOW I;  1TWG I;  1KC8 2;  3GTL I;  1YJW 1;  2OTL 1;  2OOX B;  4CL1 A;  4TNU A;  3NH5 A;  2M48 A;  2O4H A;  4HGY A;  4DK1 A;  3TE5 B;  3CCS 1;  3CC2 1;  2QRD B;  3F3P C;  3H3V J;  2NVQ I;  2HU9 A;  1RQF A;  5FLM I;  3CCR 1;  1K83 I;  3CCV Z;  5T64 A;  2F4M A;  1KD1 1;  2RHB A;  1VQN Z;  3G71 1;  1Q81 1;  3CCU 1;  3KIF A;  2K3R A;  2I3C A;  4MON A;  5CM2 M;  1YI2 Z;  2QEX Z;  3K7A I;  4S1T A;  3F3F C;  3I55 1;  1W2B Z;  3I56 Z;  2W03 A;  1RO0 A;  3FQQ A;  3PO3 S;  5C4J I;  1K9M 1;  3CCM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...