2JA5I

Cpd lesion containing rna polymerase ii elongation complex a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
116
structure length
116
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 9
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2ja5I02
4NBHA 1ZB8A 3H3VJ 3H0GI 3I07A 4QTTA 3VMGA 3GTMS 1K83I 4NBAA 2JA8I 3PO2I 3GTKI 5C4XI 1I6HI 2NVYI 3S1RI 2JA6I 1DL6A 2NVQI 5FLMI 4MH4A 4A3JI 2RBLA 4NB8A 3GTOI 2AKLA 2F4OA 2J6AA 1VLAA 1USPB 2R93I 3S2HI 1TWHI 4BXXI 1TWAI 3S2DI 3U50C 3GTPI 2JA5I 3RZDI 4A3EI 3S1NI 2NVTI 4A3CI 1R9TI 1SFOI 3HOVI 1TFIA 3ESWA 3PO3I 3Q87A 2JNYA 3EERA 4NOZA 3VMHA 2PK7A 1RLYA 3VMIA 4A3FI 3GKQA 1WCMI 1ML8A 5CM2M 3GTQI 1RO4A 2JR6A 2R7ZI 2F4MA 1QYPA 2DE7A 4Y7NI 2E2HI 2KPIA 4NBCA 3FKII 3GTGI 1X3ZA 4NBDA 1Y1VI 5C4JI 4A3MI 2HF1A 4X6AI 1L1OC 2JS4A 3HOZI 1N2FA 2DE6A 3I4MI 3M3YI 4BBRI 3PO3S 3S14I 4A3KI 4XX2A 3S16I 2YU9I 2E2II 2VUMI 1USPA 1YUAA 3S15I 4NBFA 3K7AI 4Y52I 3VB9A 2E2JI 1I3QI 1I50I 4QTUA 3HOYI 3HOUI 1X3WA 3LUSA 1WW9A 1ZB9A 3CQZI 1Y1VS 4NBBA 1NUIA 3GTJI 3HOXI 3HOWI 2BJOA 4A3BI 4A3LI 1PFTA 4BBSI 2B63I 4NB9A 3D6WA 3GTMI 5IP9I 4NBEA 3GTLI 5C44I 3S1QI 1TWFI 2R92I 3S1MI 4A3DI 5C3EI 1Y1WI 3RZOI 4BY1I 3GCFA 5IP7I 1TWGI 2DE5A 4A93I 4NBGA 4A3GI 1TWCI 3S17I 4A3II 3M4OI 1LQLA 4BY7I 2P3YA 2NVXI 2JA7I 3I4NI 2K5RA
chains in the Genus database with same CATH superfamily
3I07A 3I56Z 3CCJZ 3GTKI 4RV9A 3FQQA 2NVYI 3S1RI 3CCEZ 3CC71 2NVQI 3NH5A 4A3JI 2QR1B 4NB8A 3CPWZ 2AKLA 2F4OA 3IX0A 3CCU1 1USPB 1VLAA 2H85A 2PM9A 2OZKA 1TWHI 2NVTI 1FDOA 4MD8A 3HOVI 3CCQZ 4HGZA 1RNIA 4DGLA 3PO3I 3D2LA 2PK7A 3QWUA 1VQMZ 4RVHA 1Z02A 3GTQI 5T64A 2F4MA 1QYPA 5AN9F 2DE7A 4Y7NI 2E2HI 1VQ6Z 2JIMA 3CCL1 2VF1A 2Y0SA 3FKII 3GTGI 1X3ZA 2QRCB 2HF1A 2LFUA 4DQYB 3CCS1 2JS4A 3M3YI 4BBRI 2M6NA 1JJ2Y 3S14I 1YITZ 2YU9I 2VUMI 1USPA 5T67A 2P28A 4NBFA 2O53A 3KIFA 3CME1 1X3WA 4NFRA 1YIT1 2WB1A 2G2KA 1Q861 3F3PC 1NUIA 4NBBA 2BJOA 1VQ91 1P9NA 1PFTA 3GTMI 3GTLI 1TWFI 4A3DI 1VQ51 5IP7I 3IR7A 2DE5A 4EWCA 1KD12 2GU2A 3M4OI 4E2XA 2OTLZ 2E7ZA 2KI7B 1LQLA 2V3VA 1VQ8Z 3CCM1 4QTTA 3P5JB 2LEXA 4NBAA 1YUKA 2I3CA 1N8R2 1Q812 1K9M2 5FLMI 3CMAZ 1JWHC 2WAQA 4E2WA 2O4HA 1K732 3GTOI 1Q16A 1Q822 2QKDA 3U50C 4E31A 1YJ9Z 4A3EI 4A3CI 2QREB 4DK1A 1VQ41 3J7A4 3KIHA 1VQL1 3EERA 1SIWA 4E32A 4A3FI 3TE5B 1ML8A 2JR6A 4RVDA 2GTIA 1NJI2 1WZNA 2RHBA 3D9XA 1Y1VI 4A3MI 1VQ61 2E9HA 2EGTA 3I4MI 1M1K1 3TDHB 3I561 2OOXB 3NDJA 1I3QI 1KRLA 2IZ4A 1VQOZ 3CCRZ 1Q862 1ZB9A 5T6BA 4A3LI 4MD9A 2IV2X 2RIQA 1KC82 3NDIA 5IP9I 3S1QI 3CC4Z 1Y1WI 2OTL1 1VQNZ 2LIYA 2JIQA 1TWGI 1KQSZ 3CXCZ 4A93I 1TWCI 3CCMZ 3I551 4A3II 4TNUA 3CPWY 1WIIA 5D1PA 4CL1A 1Q7Y2 3J80f 3IFUA 4NH1C 4BY7I 3EEDA 4NBHA 1ZB8A 3H3VJ 2OOYB 1Y8CA 3H0GI 1JJ2Z 2QRDB 1K83I 2JA8I 1K8A1 3CCVZ 4MD7A 3VTNA 2JA6I 4HH4A 4MH4A 1VQ7Z 1M902 2RBLA 2JMOA 2J6AA 1VQ4Z 2R93I 3S2HI 3G4SZ 4BXXI 1YIJZ 1TWAI 3GTPI 2JA5I 1VQPZ 1VQP1 1KQSY 2QEXZ 3S1NI 2V8IA 3G6E1 1VQ71 3ESWA 4E2ZA 4S1TA 1RLYA 2QLVB 2W04A 3VMIA 1RO0A 1WCMI 1RO4A 3CMA1 2R7ZI 1YHQ1 1VQ81 2QEX1 1YJW1 1NP6A 2KPIA 4NBCA 3CD6Z 4NBDA 2JIRA 1QF8A 1VQM1 3NH4A 2Q51A 1N2FA 3G711 3CC21 2RT9A 1VQLZ 2W03A 3CCV1 4XX2A 1VQK1 5FLXb 2E2II 3J80b 3MONA 3CC41 3S15I 3K7AI 3VB9A 1I50I 4QTUA 3HOYI 1S7MA 1QVFY 2NAPA 3NH8A 3LUSA 4RVFA 1YIJ1 1S72Z 3GTJI 3HOWI 1VQ9Z 1M901 1YJNZ 4MONA 1FDIA 1VQO1 4NB9A 3MZLB 5C44I 1K8A2 3FQMA 1AA6A 3CMEZ 3J81f 3S1MI 2OTJZ 2HU9A 1QVGY 1ZH1A 1S721 3GCFA 2VPYA 2VPZA 4NBGA 3OW2Z 1Q7Y1 4RVGA 3S17I 3CCUZ 1Z01A 2M48A 1WJ2A 3MZKB 2Q4ZA 4E33A 2P3YA 2QA41 1M1K2 3VMGA 3CCLZ 3GTMS 3CXCY 3PO2I 1QVFZ 5C4XI 1I6HI 1NJI1 2R6MA 1DL6A 1X0TA 1KC81 2JUBA 5FLXf 3OW2Y 3CD61 3CCR1 2V8JA 3HKZA 3J81b 3S2DI 3RZDI 1YJ91 2ZAEB 1RO2A 1Z03A 1R9TI 1SFOI 3BG1B 1TFIA 3JAMf 2V45A 3JAMb 3BG0B 3Q87A 2JNYA 4NOZA 3VMHA 4E30A 1W2BY 2VPXA 1Q821 3I55Z 1QVGZ 5A2Qf 1VQKZ 3CCE1 3G6EZ 2AYDA 1K731 3GKQA 1RQFA 5CM2M 5D1OA 5IT9b 1VQN1 1YI2Z 1YI21 1Q811 3G4S1 1N8R1 3F3FC 2IZ3A 3CCJ1 4RS4A 5C4JI 3NFZA 2JIPA 3CCQ1 4X6AI 1L1OC 2VUGA 3HOZI 2DE6A 3PO3S 4A3KI 3S16I 5A2Qb 2GTHA 1YUAA 2QA4Z 2OTJ1 3CCSZ 1YHQZ 5IT9f 4AYBA 2PMZA 1VQ5Z 2VPWA 4Y52I 2E2JI 3T4NB 3HOUI 2RPRA 1WW9A 5LL6f 3CQZI 1Y1VS 3HOXI 4A3BI 4BBSI 2B63I 3D6WA 5D1OB 3G71Z 2YADA 3CC2Z 1K9M1 4MRIA 4NBEA 4MXUA 1YJN1 2R92I 5C3EI 3RZOI 4BY1I 2K3RA 2JIOA 1W2BZ 1YJWZ 4A3GI 1QXFA 4E2YA 3IF8A 3CC7Z 1KD11 2NVXI 2JA7I 2V8KA 3I4NI 4HGYA 2K5RA
chains in the Genus database with same CATH topology
3I07A 3I56Z 3CCJZ 3GTKI 4RV9A 3FQQA 2NVYI 3S1RI 3CCEZ 3CC71 2NVQI 3NH5A 4A3JI 2QR1B 4NB8A 1Q862 2AKLA 2F4OA 3IX0A 3CCU1 1USPB 1VLAA 2H85A 2PM9A 3CPWZ 2OZKA 1TWHI 2NVTI 4MD8A 3HOVI 3CCQZ 4HGZA 1RNIA 4DGLA 3PO3I 2PK7A 3QWUA 1VQMZ 4RVHA 1Z02A 3GTQI 5T64A 2F4MA 1QYPA 5AN9F 2DE7A 4Y7NI 2E2HI 1VQ6Z 3FKII 2VF1A 2Y0SA 3CCL1 3GTGI 1X3ZA 2QRCB 2HF1A 2LFUA 4DQYB 3CCS1 2JS4A 3M3YI 4BBRI 2M6NA 1JJ2Y 3S14I 1YITZ 2YU9I 2VUMI 1USPA 5T67A 2P28A 4NBFA 2O53A 3KIFA 3CME1 1X3WA 4NFRA 1YIT1 2WB1A 1Q861 2G2KA 3F3PC 1NUIA 4NBBA 2BJOA 1VQ91 1P9NA 1PFTA 3GTMI 3GTLI 1TWFI 4A3DI 1VQ51 5IP7I 2DE5A 4EWCA 1KD12 2GU2A 3M4OI 4E2XA 2OTLZ 2KI7B 1LQLA 1VQ8Z 3CCM1 4QTTA 3P5JB 4NBAA 1YUKA 2I3CA 1N8R2 1Q812 1K9M2 5FLMI 3CMAZ 1JWHC 2WAQA 4E2WA 2O4HA 1K732 3GTOI 1Q822 2QKDA 3U50C 4E31A 1YJ9Z 4A3EI 4A3CI 2QREB 4DK1A 1VQ41 3J7A4 3KIHA 1VQL1 3EERA 4E32A 4A3FI 3TE5B 1ML8A 2JR6A 4RVDA 2GTIA 1NJI2 2RHBA 3D9XA 1Y1VI 4A3MI 1VQ61 2E9HA 2EGTA 3I4MI 1M1K1 3TDHB 3I561 2OOXB 3NDJA 1I3QI 1KRLA 2IZ4A 1VQOZ 3CCRZ 1ZB9A 5T6BA 4A3LI 4MD9A 2RIQA 1KC82 3NDIA 5IP9I 3S1QI 3CC4Z 1Y1WI 2OTL1 1VQNZ 2LIYA 1TWGI 1KQSZ 3CXCZ 4A93I 1TWCI 3CCMZ 3I551 4A3II 4TNUA 3CPWY 1WIIA 5D1PA 4CL1A 1Q7Y2 3J80f 3IFUA 4NH1C 4BY7I 3EEDA 4NBHA 1ZB8A 3H3VJ 2OOYB 3H0GI 1JJ2Z 2QRDB 1K83I 2JA8I 1K8A1 3CCVZ 4MD7A 3VTNA 2JA6I 4HH4A 4MH4A 1VQ7Z 1M902 2RBLA 2JMOA 2J6AA 1VQ4Z 2R93I 3S2HI 3G4SZ 4BXXI 1YIJZ 1TWAI 3GTPI 2JA5I 1VQPZ 1VQP1 1KQSY 2QEXZ 3S1NI 2V8IA 3G6E1 1VQ71 3ESWA 4E2ZA 4S1TA 1RLYA 2QLVB 2W04A 3VMIA 1RO0A 1WCMI 1RO4A 3CMA1 2R7ZI 1YHQ1 1VQ81 2QEX1 1YJW1 1NP6A 2KPIA 4NBCA 3CD6Z 4NBDA 1QF8A 1VQM1 3NH4A 2Q51A 1N2FA 3G711 3CC21 2RT9A 1VQLZ 2W03A 3CCV1 4XX2A 1VQK1 5FLXb 2E2II 3J80b 3MONA 3CC41 3S15I 3K7AI 3VB9A 1I50I 4QTUA 3HOYI 1S7MA 1QVFY 3NH8A 3LUSA 4RVFA 1YIJ1 1S72Z 3GTJI 3HOWI 1VQ9Z 1M901 1YJNZ 4MONA 1VQO1 4NB9A 3MZLB 5C44I 1K8A2 3FQMA 3CMEZ 3J81f 3S1MI 2OTJZ 2HU9A 1QVGY 1ZH1A 1S721 3GCFA 4NBGA 3OW2Z 1Q7Y1 4RVGA 3S17I 3CCUZ 1Z01A 2M48A 3MZKB 2Q4ZA 4E33A 2P3YA 2QA41 1M1K2 3VMGA 3CCLZ 3GTMS 3CXCY 3PO2I 1QVFZ 5C4XI 1I6HI 1NJI1 2R6MA 1DL6A 1X0TA 1KC81 2JUBA 5FLXf 3OW2Y 3CD61 3CCR1 2V8JA 3HKZA 3J81b 3S2DI 3RZDI 1YJ91 2ZAEB 1RO2A 1Z03A 1R9TI 1SFOI 3BG1B 1TFIA 3JAMf 3BG0B 3JAMb 3Q87A 2JNYA 4NOZA 3VMHA 4E30A 1W2BY 1Q821 3I55Z 1QVGZ 5A2Qf 1VQKZ 3CCE1 3G6EZ 1K731 3GKQA 1RQFA 5CM2M 5D1OA 5IT9b 1VQN1 1YI2Z 1YI21 1Q811 3G4S1 1N8R1 3F3FC 2IZ3A 3CCJ1 4RS4A 5C4JI 3NFZA 3CCQ1 4X6AI 1L1OC 2VUGA 3HOZI 2DE6A 3PO3S 4A3KI 3S16I 5A2Qb 2GTHA 1YUAA 2QA4Z 2OTJ1 3CCSZ 1YHQZ 5IT9f 4AYBA 2PMZA 1VQ5Z 4Y52I 2E2JI 3T4NB 3HOUI 2RPRA 1WW9A 5LL6f 3CQZI 1Y1VS 3HOXI 4A3BI 4BBSI 2B63I 3D6WA 5D1OB 3G71Z 2YADA 3CC2Z 1K9M1 4MRIA 4NBEA 4MXUA 1YJN1 2R92I 5C3EI 3RZOI 4BY1I 2K3RA 1W2BZ 1YJWZ 4A3GI 4E2YA 3IF8A 3CC7Z 1KD11 2NVXI 2JA7I 2V8KA 3I4NI 4HGYA 2K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBH A;  1ZB8 A;  3H3V J;  3H0G I;  3I07 A;  4QTT A;  3VMG A;  3GTM S;  1K83 I;  4NBA A;  2JA8 I;  3PO2 I;  3GTK I;  5C4X I;  1I6H I;  2NVY I;  3S1R I;  2JA6 I;  1DL6 A;  2NVQ I;  5FLM I;  4MH4 A;  4A3J I;  2RBL A;  4NB8 A;  3GTO I;  2AKL A;  2F4O A;  2J6A A;  1VLA A;  1USP B;  2R93 I;  3S2H I;  1TWH I;  4BXX I;  1TWA I;  3S2D I;  3U50 C;  3GTP I;  2JA5 I;  3RZD I;  4A3E I;  3S1N I;  2NVT I;  4A3C I;  1R9T I;  1SFO I;  3HOV I;  1TFI A;  3ESW A;  3PO3 I;  3Q87 A;  2JNY A;  3EER A;  4NOZ A;  3VMH A;  2PK7 A;  1RLY A;  3VMI A;  4A3F I;  3GKQ A;  1WCM I;  1ML8 A;  5CM2 M;  3GTQ I;  1RO4 A;  2JR6 A;  2R7Z I;  2F4M A;  1QYP A;  2DE7 A;  4Y7N I;  2E2H I;  2KPI A;  4NBC A;  3FKI I;  3GTG I;  1X3Z A;  4NBD A;  1Y1V I;  5C4J I;  4A3M I;  2HF1 A;  4X6A I;  1L1O C;  2JS4 A;  3HOZ I;  1N2F A;  2DE6 A;  3I4M I;  3M3Y I;  4BBR I;  3PO3 S;  3S14 I;  4A3K I;  4XX2 A;  3S16 I;  2YU9 I;  2E2I I;  2VUM I;  1USP A;  1YUA A;  3S15 I;  4NBF A;  3K7A I;  4Y52 I;  3VB9 A;  2E2J I;  1I3Q I;  1I50 I;  4QTU A;  3HOY I;  3HOU I;  1X3W A;  3LUS A;  1WW9 A;  1ZB9 A;  3CQZ I;  1Y1V S;  4NBB A;  1NUI A;  3GTJ I;  3HOX I;  3HOW I;  2BJO A;  4A3B I;  4A3L I;  1PFT A;  4BBS I;  2B63 I;  4NB9 A;  3D6W A;  3GTM I;  5IP9 I;  4NBE A;  3GTL I;  5C44 I;  3S1Q I;  1TWF I;  2R92 I;  3S1M I;  4A3D I;  5C3E I;  1Y1W I;  3RZO I;  4BY1 I;  3GCF A;  5IP7 I;  1TWG I;  2DE5 A;  4A93 I;  4NBG A;  4A3G I;  1TWC I;  3S17 I;  4A3I I;  3M4O I;  1LQL A;  4BY7 I;  2P3Y A;  2NVX I;  2JA7 I;  3I4N I;  2K5R A; 
#chains in the Genus database with same CATH topology
 3I07 A;  3I56 Z;  3CCJ Z;  3GTK I;  4RV9 A;  3FQQ A;  2NVY I;  3S1R I;  3CCE Z;  3CC7 1;  2NVQ I;  3NH5 A;  4A3J I;  2QR1 B;  4NB8 A;  3CPW Z;  2AKL A;  2F4O A;  3IX0 A;  3CCU 1;  1USP B;  1VLA A;  2H85 A;  2PM9 A;  2OZK A;  1TWH I;  2NVT I;  1FDO A;  4MD8 A;  3HOV I;  3CCQ Z;  4HGZ A;  1RNI A;  4DGL A;  3PO3 I;  3D2L A;  2PK7 A;  3QWU A;  1VQM Z;  4RVH A;  1Z02 A;  3GTQ I;  5T64 A;  2F4M A;  1QYP A;  5AN9 F;  2DE7 A;  4Y7N I;  2E2H I;  1VQ6 Z;  2JIM A;  3CCL 1;  2VF1 A;  2Y0S A;  3FKI I;  3GTG I;  1X3Z A;  2QRC B;  2HF1 A;  2LFU A;  4DQY B;  3CCS 1;  2JS4 A;  3M3Y I;  4BBR I;  2M6N A;  1JJ2 Y;  3S14 I;  1YIT Z;  2YU9 I;  2VUM I;  1USP A;  5T67 A;  2P28 A;  4NBF A;  2O53 A;  3KIF A;  3CME 1;  1X3W A;  4NFR A;  1YIT 1;  2WB1 A;  2G2K A;  1Q86 1;  3F3P C;  1NUI A;  4NBB A;  2BJO A;  1VQ9 1;  1P9N A;  1PFT A;  3GTM I;  3GTL I;  1TWF I;  4A3D I;  1VQ5 1;  5IP7 I;  3IR7 A;  2DE5 A;  4EWC A;  1KD1 2;  2GU2 A;  3M4O I;  4E2X A;  2OTL Z;  2E7Z A;  2KI7 B;  1LQL A;  2V3V A;  1VQ8 Z;  3CCM 1;  4QTT A;  3P5J B;  2LEX A;  4NBA A;  1YUK A;  2I3C A;  1N8R 2;  1Q81 2;  1K9M 2;  5FLM I;  3CMA Z;  1JWH C;  2WAQ A;  4E2W A;  2O4H A;  1K73 2;  3GTO I;  1Q16 A;  1Q82 2;  2QKD A;  3U50 C;  4E31 A;  1YJ9 Z;  4A3E I;  4A3C I;  2QRE B;  4DK1 A;  1VQ4 1;  3J7A 4;  3KIH A;  1VQL 1;  3EER A;  1SIW A;  4E32 A;  4A3F I;  3TE5 B;  1ML8 A;  2JR6 A;  4RVD A;  2GTI A;  1NJI 2;  1WZN A;  2RHB A;  3D9X A;  1Y1V I;  4A3M I;  1VQ6 1;  2E9H A;  2EGT A;  3I4M I;  1M1K 1;  3TDH B;  3I56 1;  2OOX B;  3NDJ A;  1I3Q I;  1KRL A;  2IZ4 A;  1VQO Z;  3CCR Z;  1Q86 2;  1ZB9 A;  5T6B A;  4A3L I;  4MD9 A;  2IV2 X;  2RIQ A;  1KC8 2;  3NDI A;  5IP9 I;  3S1Q I;  3CC4 Z;  1Y1W I;  2OTL 1;  1VQN Z;  2LIY A;  2JIQ A;  1TWG I;  1KQS Z;  3CXC Z;  4A93 I;  1TWC I;  3CCM Z;  3I55 1;  4A3I I;  4TNU A;  3CPW Y;  1WII A;  5D1P A;  4CL1 A;  1Q7Y 2;  3J80 f;  3IFU A;  4NH1 C;  4BY7 I;  3EED A;  4NBH A;  1ZB8 A;  3H3V J;  2OOY B;  1Y8C A;  3H0G I;  1JJ2 Z;  2QRD B;  1K83 I;  2JA8 I;  1K8A 1;  3CCV Z;  4MD7 A;  3VTN A;  2JA6 I;  4HH4 A;  4MH4 A;  1VQ7 Z;  1M90 2;  2RBL A;  2JMO A;  2J6A A;  1VQ4 Z;  2R93 I;  3S2H I;  3G4S Z;  4BXX I;  1YIJ Z;  1TWA I;  3GTP I;  2JA5 I;  1VQP Z;  1VQP 1;  1KQS Y;  2QEX Z;  3S1N I;  2V8I A;  3G6E 1;  1VQ7 1;  3ESW A;  4E2Z A;  4S1T A;  1RLY A;  2QLV B;  2W04 A;  3VMI A;  1RO0 A;  1WCM I;  1RO4 A;  3CMA 1;  2R7Z I;  1YHQ 1;  1VQ8 1;  2QEX 1;  1YJW 1;  1NP6 A;  2KPI A;  4NBC A;  3CD6 Z;  4NBD A;  2JIR A;  1QF8 A;  1VQM 1;  3NH4 A;  2Q51 A;  1N2F A;  3G71 1;  3CC2 1;  2RT9 A;  1VQL Z;  2W03 A;  3CCV 1;  4XX2 A;  1VQK 1;  5FLX b;  2E2I I;  3J80 b;  3MON A;  3CC4 1;  3S15 I;  3K7A I;  3VB9 A;  1I50 I;  4QTU A;  3HOY I;  1S7M A;  1QVF Y;  2NAP A;  3NH8 A;  3LUS A;  4RVF A;  1YIJ 1;  1S72 Z;  3GTJ I;  3HOW I;  1VQ9 Z;  1M90 1;  1YJN Z;  4MON A;  1FDI A;  1VQO 1;  4NB9 A;  3MZL B;  5C44 I;  1K8A 2;  3FQM A;  1AA6 A;  3CME Z;  3J81 f;  3S1M I;  2OTJ Z;  2HU9 A;  1QVG Y;  1ZH1 A;  1S72 1;  3GCF A;  2VPY A;  2VPZ A;  4NBG A;  3OW2 Z;  1Q7Y 1;  4RVG A;  3S17 I;  3CCU Z;  1Z01 A;  2M48 A;  1WJ2 A;  3MZK B;  2Q4Z A;  4E33 A;  2P3Y A;  2QA4 1;  1M1K 2;  3VMG A;  3CCL Z;  3GTM S;  3CXC Y;  3PO2 I;  1QVF Z;  5C4X I;  1I6H I;  1NJI 1;  2R6M A;  1DL6 A;  1X0T A;  1KC8 1;  2JUB A;  5FLX f;  3OW2 Y;  3CD6 1;  3CCR 1;  2V8J A;  3HKZ A;  3J81 b;  3S2D I;  3RZD I;  1YJ9 1;  2ZAE B;  1RO2 A;  1Z03 A;  1R9T I;  1SFO I;  3BG1 B;  1TFI A;  3JAM f;  2V45 A;  3JAM b;  3BG0 B;  3Q87 A;  2JNY A;  4NOZ A;  3VMH A;  4E30 A;  1W2B Y;  2VPX A;  1Q82 1;  3I55 Z;  1QVG Z;  5A2Q f;  1VQK Z;  3CCE 1;  3G6E Z;  2AYD A;  1K73 1;  3GKQ A;  1RQF A;  5CM2 M;  5D1O A;  5IT9 b;  1VQN 1;  1YI2 Z;  1YI2 1;  1Q81 1;  3G4S 1;  1N8R 1;  3F3F C;  2IZ3 A;  3CCJ 1;  4RS4 A;  5C4J I;  3NFZ A;  2JIP A;  3CCQ 1;  4X6A I;  1L1O C;  2VUG A;  3HOZ I;  2DE6 A;  3PO3 S;  4A3K I;  3S16 I;  5A2Q b;  2GTH A;  1YUA A;  2QA4 Z;  2OTJ 1;  3CCS Z;  1YHQ Z;  5IT9 f;  4AYB A;  2PMZ A;  1VQ5 Z;  2VPW A;  4Y52 I;  2E2J I;  3T4N B;  3HOU I;  2RPR A;  1WW9 A;  5LL6 f;  3CQZ I;  1Y1V S;  3HOX I;  4A3B I;  4BBS I;  2B63 I;  3D6W A;  5D1O B;  3G71 Z;  2YAD A;  3CC2 Z;  1K9M 1;  4MRI A;  4NBE A;  4MXU A;  1YJN 1;  2R92 I;  5C3E I;  3RZO I;  4BY1 I;  2K3R A;  2JIO A;  1W2B Z;  1YJW Z;  4A3G I;  1QXF A;  4E2Y A;  3IF8 A;  3CC7 Z;  1KD1 1;  2NVX I;  2JA7 I;  2V8K A;  3I4N I;  4HGY A;  2K5R A; 
#chains in the Genus database with same CATH homology
 3I07 A;  3I56 Z;  3CCJ Z;  3GTK I;  4RV9 A;  3FQQ A;  2NVY I;  3S1R I;  3CCE Z;  3CC7 1;  2NVQ I;  3NH5 A;  4A3J I;  2QR1 B;  4NB8 A;  1Q86 2;  2AKL A;  2F4O A;  3IX0 A;  3CCU 1;  1USP B;  1VLA A;  2H85 A;  2PM9 A;  3CPW Z;  2OZK A;  1TWH I;  2NVT I;  4MD8 A;  3HOV I;  3CCQ Z;  4HGZ A;  1RNI A;  4DGL A;  3PO3 I;  2PK7 A;  3QWU A;  1VQM Z;  4RVH A;  1Z02 A;  3GTQ I;  5T64 A;  2F4M A;  1QYP A;  5AN9 F;  2DE7 A;  4Y7N I;  2E2H I;  1VQ6 Z;  3FKI I;  2VF1 A;  2Y0S A;  3CCL 1;  3GTG I;  1X3Z A;  2QRC B;  2HF1 A;  2LFU A;  4DQY B;  3CCS 1;  2JS4 A;  3M3Y I;  4BBR I;  2M6N A;  1JJ2 Y;  3S14 I;  1YIT Z;  2YU9 I;  2VUM I;  1USP A;  5T67 A;  2P28 A;  4NBF A;  2O53 A;  3KIF A;  3CME 1;  1X3W A;  4NFR A;  1YIT 1;  2WB1 A;  1Q86 1;  2G2K A;  3F3P C;  1NUI A;  4NBB A;  2BJO A;  1VQ9 1;  1P9N A;  1PFT A;  3GTM I;  3GTL I;  1TWF I;  4A3D I;  1VQ5 1;  5IP7 I;  2DE5 A;  4EWC A;  1KD1 2;  2GU2 A;  3M4O I;  4E2X A;  2OTL Z;  2KI7 B;  1LQL A;  1VQ8 Z;  3CCM 1;  4QTT A;  3P5J B;  4NBA A;  1YUK A;  2I3C A;  1N8R 2;  1Q81 2;  1K9M 2;  5FLM I;  3CMA Z;  1JWH C;  2WAQ A;  4E2W A;  2O4H A;  1K73 2;  3GTO I;  1Q82 2;  2QKD A;  3U50 C;  4E31 A;  1YJ9 Z;  4A3E I;  4A3C I;  2QRE B;  4DK1 A;  1VQ4 1;  3J7A 4;  3KIH A;  1VQL 1;  3EER A;  4E32 A;  4A3F I;  3TE5 B;  1ML8 A;  2JR6 A;  4RVD A;  2GTI A;  1NJI 2;  2RHB A;  3D9X A;  1Y1V I;  4A3M I;  1VQ6 1;  2E9H A;  2EGT A;  3I4M I;  1M1K 1;  3TDH B;  3I56 1;  2OOX B;  3NDJ A;  1I3Q I;  1KRL A;  2IZ4 A;  1VQO Z;  3CCR Z;  1ZB9 A;  5T6B A;  4A3L I;  4MD9 A;  2RIQ A;  1KC8 2;  3NDI A;  5IP9 I;  3S1Q I;  3CC4 Z;  1Y1W I;  2OTL 1;  1VQN Z;  2LIY A;  1TWG I;  1KQS Z;  3CXC Z;  4A93 I;  1TWC I;  3CCM Z;  3I55 1;  4A3I I;  4TNU A;  3CPW Y;  1WII A;  5D1P A;  4CL1 A;  1Q7Y 2;  3J80 f;  3IFU A;  4NH1 C;  4BY7 I;  3EED A;  4NBH A;  1ZB8 A;  3H3V J;  2OOY B;  3H0G I;  1JJ2 Z;  2QRD B;  1K83 I;  2JA8 I;  1K8A 1;  3CCV Z;  4MD7 A;  3VTN A;  2JA6 I;  4HH4 A;  4MH4 A;  1VQ7 Z;  1M90 2;  2RBL A;  2JMO A;  2J6A A;  1VQ4 Z;  2R93 I;  3S2H I;  3G4S Z;  4BXX I;  1YIJ Z;  1TWA I;  3GTP I;  2JA5 I;  1VQP Z;  1VQP 1;  1KQS Y;  2QEX Z;  3S1N I;  2V8I A;  3G6E 1;  1VQ7 1;  3ESW A;  4E2Z A;  4S1T A;  1RLY A;  2QLV B;  2W04 A;  3VMI A;  1RO0 A;  1WCM I;  1RO4 A;  3CMA 1;  2R7Z I;  1YHQ 1;  1VQ8 1;  2QEX 1;  1YJW 1;  1NP6 A;  2KPI A;  4NBC A;  3CD6 Z;  4NBD A;  1QF8 A;  1VQM 1;  3NH4 A;  2Q51 A;  1N2F A;  3G71 1;  3CC2 1;  2RT9 A;  1VQL Z;  2W03 A;  3CCV 1;  4XX2 A;  1VQK 1;  5FLX b;  2E2I I;  3J80 b;  3MON A;  3CC4 1;  3S15 I;  3K7A I;  3VB9 A;  1I50 I;  4QTU A;  3HOY I;  1S7M A;  1QVF Y;  3NH8 A;  3LUS A;  4RVF A;  1YIJ 1;  1S72 Z;  3GTJ I;  3HOW I;  1VQ9 Z;  1M90 1;  1YJN Z;  4MON A;  1VQO 1;  4NB9 A;  3MZL B;  5C44 I;  1K8A 2;  3FQM A;  3CME Z;  3J81 f;  3S1M I;  2OTJ Z;  2HU9 A;  1QVG Y;  1ZH1 A;  1S72 1;  3GCF A;  4NBG A;  3OW2 Z;  1Q7Y 1;  4RVG A;  3S17 I;  3CCU Z;  1Z01 A;  2M48 A;  3MZK B;  2Q4Z A;  4E33 A;  2P3Y A;  2QA4 1;  1M1K 2;  3VMG A;  3CCL Z;  3GTM S;  3CXC Y;  3PO2 I;  1QVF Z;  5C4X I;  1I6H I;  1NJI 1;  2R6M A;  1DL6 A;  1X0T A;  1KC8 1;  2JUB A;  5FLX f;  3OW2 Y;  3CD6 1;  3CCR 1;  2V8J A;  3HKZ A;  3J81 b;  3S2D I;  3RZD I;  1YJ9 1;  2ZAE B;  1RO2 A;  1Z03 A;  1R9T I;  1SFO I;  3BG1 B;  1TFI A;  3JAM f;  3BG0 B;  3JAM b;  3Q87 A;  2JNY A;  4NOZ A;  3VMH A;  4E30 A;  1W2B Y;  1Q82 1;  3I55 Z;  1QVG Z;  5A2Q f;  1VQK Z;  3CCE 1;  3G6E Z;  1K73 1;  3GKQ A;  1RQF A;  5CM2 M;  5D1O A;  5IT9 b;  1VQN 1;  1YI2 Z;  1YI2 1;  1Q81 1;  3G4S 1;  1N8R 1;  3F3F C;  2IZ3 A;  3CCJ 1;  4RS4 A;  5C4J I;  3NFZ A;  3CCQ 1;  4X6A I;  1L1O C;  2VUG A;  3HOZ I;  2DE6 A;  3PO3 S;  4A3K I;  3S16 I;  5A2Q b;  2GTH A;  1YUA A;  2QA4 Z;  2OTJ 1;  3CCS Z;  1YHQ Z;  5IT9 f;  4AYB A;  2PMZ A;  1VQ5 Z;  4Y52 I;  2E2J I;  3T4N B;  3HOU I;  2RPR A;  1WW9 A;  5LL6 f;  3CQZ I;  1Y1V S;  3HOX I;  4A3B I;  4BBS I;  2B63 I;  3D6W A;  5D1O B;  3G71 Z;  2YAD A;  3CC2 Z;  1K9M 1;  4MRI A;  4NBE A;  4MXU A;  1YJN 1;  2R92 I;  5C3E I;  3RZO I;  4BY1 I;  2K3R A;  1W2B Z;  1YJW Z;  4A3G I;  4E2Y A;  3IF8 A;  3CC7 Z;  1KD1 1;  2NVX I;  2JA7 I;  2V8K A;  3I4N I;  4HGY A;  2K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...