3M4OI

Rna polymerase ii elongation complex b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m4oI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m4oI02
1Y1VI 1TWHI 2DE6A 3S2DI 4BY1I 3D6WA 2DE7A 4BBSI 4BY7I 3M4OI 2F4OA 3EERA 4NBCA 4NB8A 3S15I 2JA7I 4QTTA 2NVQI 2JA8I 4XX2A 4NBEA 1K83I 3S14I 3S2HI 4A3LI 4NBAA 2J6AA 3HOVI 3RZOI 1TWAI 2E2JI 3GTGI 3HOWI 3S17I 4A3JI 3FKII 2JA6I 1L1OC 2HF1A 1USPA 2DE5A 3GTQI 2R7ZI 2E2II 5IP7I 2R93I 1ZB9A 4BBRI 4A3DI 2NVYI 1I50I 1WW9A 3VMHA 4QTUA 2JS4A 2VUMI 1QYPA 1ZB8A 3HOZI 1TWCI 3VMGA 3M3YI 5C3EI 3RZDI 1RLYA 3U50C 2P3YA 4Y52I 4NBHA 3K7AI 2PK7A 3GKQA 4BXXI 5C4JI 4NBDA 2E2HI 3S1MI 3GTMS 1SFOI 1N2FA 1LQLA 3I4MI 1I3QI 4NB9A 4A3FI 3GTMI 3S16I 5CM2M 2JA5I 1YUAA 3LUSA 1I6HI 1TFIA 3HOYI 3I4NI 4A3KI 2KPIA 4MH4A 4Y7NI 3S1NI 5FLMI 3I07A 2NVTI 1TWFI 4NBBA 3GTJI 3S1QI 2RBLA 2F4MA 2AKLA 2BJOA 4A3II 4A3GI 1ML8A 5IP9I 2JR6A 3S1RI 2R92I 2YU9I 3H0GI 3VB9A 3GTPI 1DL6A 4A3EI 1VLAA 1TWGI 3Q87A 1NUIA 3HOXI 4X6AI 3GTKI 3GCFA 4A93I 1USPB 2JNYA 1PFTA 1X3ZA 3HOUI 2B63I 1Y1WI 3PO3S 4NBFA 3H3VJ 5C44I 4A3BI 3CQZI 3VMIA 3PO3I 5C4XI 3GTOI 4A3MI 3GTLI 3PO2I 3ESWA 1WCMI 2K5RA 4A3CI 4NBGA 1Y1VS 1R9TI 1X3WA 4NOZA 2NVXI 1RO4A
chains in the Genus database with same CATH superfamily
3CCV1 1Y1VI 4BY1I 3D6WA 2V8KA 1Y8CA 1WZNA 2JIOA 1RO0A 4NFRA 3M4OI 1Z02A 2F4OA 4NB8A 3NDJA 3S15I 1VQ61 4XX2A 1K83I 4A3LI 4NBAA 3MONA 2O4HA 3TE5B 4CL1A 3CCQ1 2EGTA 2OTJ1 1L1OC 2NAPA 2R6MA 4RVGA 1M1K2 5AN9F 1JJ2Y 1KRLA 4E2XA 1VQP1 2E2II 3CCVZ 3CCUZ 3KIFA 1YI21 1I50I 3VMHA 5T67A 1QYPA 1VQ81 3TDHB 3RZDI 1RLYA 1K8A2 4Y52I 1YJ91 1KC82 2LFUA 1YIT1 3JAMb 1SIWA 5C4JI 2JIMA 3CCL1 1Q861 1VQL1 3G711 1VQK1 2PM9A 1JJ2Z 1I3QI 2LIYA 4E32A 2QRDB 3HKZA 3NDIA 1KD12 2OTJZ 1K732 2QREB 2KPIA 3CPWY 4Y7NI 3S1NI 1YHQZ 4E33A 4MD8A 2F4MA 2AKLA 3OW2Y 3MZKB 1Q7Y2 2IV2X 3I551 4A3GI 1VQM1 2ZAEB 3D9XA 2YU9I 3VB9A 3GTPI 1DL6A 1WJ2A 2Y0SA 5A2Qf 1KQSZ 3HOXI 1AA6A 3CXCZ 3KIHA 3P5JB 4X6AI 3CCLZ 1VQLZ 1RNIA 3CME1 4E30A 3CPWZ 1K9M2 1FDIA 3H3VJ 5C44I 3CQZI 3OW2Z 3CC4Z 2LEXA 3PO2I 3FQMA 1M1K1 4A3CI 2AYDA 4E31A 1R9TI 1X3WA 4NOZA 4HGZA 3G6EZ 2DE6A 2PMZA 1Q822 1YJW1 4RVFA 2DE7A 4BBSI 5D1OB 4MD7A 3CCM1 1QF8A 1Z01A 4QTTA 2VF1A 5T6BA 3NH5A 4E2YA 3FQQA 3S2HI 2J6AA 1TWAI 2QA41 3GTGI 3HOWI 4A3JI 2JMOA 1P9NA 4NH1C 5LL6f 1Z03A 2HF1A 2DE5A 2R7ZI 3CC71 4E2ZA 5IP7I 5FLXb 4S1TA 1WW9A 1Q7Y1 2JS4A 2VUMI 1WIIA 1ZB8A 3J80f 3CCR1 3U50C 1JWHC 2P3YA 3CD61 3F3FC 3K7AI 1M902 1N8R2 4BXXI 3S1MI 3GTMS 1SFOI 1N2FA 3MZLB 3NH8A 1VQ9Z 2QA4Z 1VQ41 2GTHA 5D1OA 3GTMI 3S16I 2JA5I 1VQ71 1TFIA 3HOYI 2GU2A 3CC7Z 2YADA 2VUGA 3IF8A 5FLMI 3I07A 1Q16A 2NVTI 3CCE1 1TWFI 3T4NB 4NBBA 3S1QI 2QR1B 3G4S1 2BJOA 3NH4A 4RV9A 5IP9I 2JR6A 3CCRZ 1VQN1 1VQ6Z 4EWCA 1Q812 4A3EI 3IX0A 1NUIA 2KI7B 2OTL1 1KQSY 1W2BY 2QEX1 3CXCY 3CCQZ 4A93I 3GCFA 1VQ4Z 2JIQA 1USPB 1NP6A 2JNYA 1PFTA 2OZKA 3I561 4DGLA 1VQPZ 1VQO1 1VQ7Z 4DQYB 4NBFA 1YI2Z 2Q4ZA 5C4XI 3CCEZ 2K5RA 2Q51A 1VQ8Z 2RHBA 4NBGA 3CC21 2VPYA 1QXFA 1RQFA 1RO4A 1YJ9Z 1YITZ 1FDOA 4E2WA 1W2BZ 2QRCB 2OTLZ 3G71Z 2QLVB 1VQKZ 4BY7I 1QVFY 1X0TA 4NBCA 1YUKA 2JA7I 4RVHA 2NVQI 1M901 4DK1A 5A2Qb 4NBEA 2RIQA 1YIJ1 3RZOI 2VPZA 2E2JI 2IZ3A 3FKII 3CCJ1 3CMA1 3F3PC 1YJN1 3I55Z 1VQMZ 1USPA 3GTQI 3CCS1 1ZB9A 4BBRI 1VQ51 4A3DI 2I3CA 1QVFZ 2NVYI 2JIRA 1K8A1 1KC81 3VMGA 3CMEZ 5C3EI 3M3YI 2O53A 5IT9f 1S7MA 4NBHA 2PK7A 3GKQA 3IR7A 2P28A 1KD11 1K731 4MONA 3I4MI 4NB9A 1Q862 3CMAZ 5CM2M 1YUAA 3I4NI 5IT9b 4A3KI 2RT9A 5D1PA 1YJWZ 1RO2A 3GTJI 3CCMZ 4RVDA 2RBLA 2V8JA 3VTNA 4A3II 2OOYB 1S721 1ML8A 2M6NA 2R92I 2W03A 3H0GI 2VPXA 2QKDA 1TWGI 3CCU1 2M48A 4HGYA 2E7ZA 1K9M1 3J80b 1X3ZA 3HOUI 5T64A 3D2LA 1Y1WI 3PO3S 2WB1A 2V8IA 1NJI2 3VMIA 3PO3I 4MD9A 2H85A 4A3MI 3EEDA 1Q821 2RPRA 2NVXI 3CD6Z 1S72Z 1QVGY 1TWHI 4HH4A 3S2DI 3QWUA 3JAMf 2WAQA 1YHQ1 3EERA 2JA8I 1ZH1A 3S14I 3HOVI 3S17I 4AYBA 3G4SZ 2JA6I 1QVGZ 4TNUA 1VQNZ 2R93I 2IZ4A 2GTIA 2OOXB 2W04A 3CC41 3J81f 2QEXZ 4QTUA 2E9HA 3NFZA 3HOZI 1TWCI 4MRIA 1N8R1 3I56Z 2G2KA 1VQOZ 3G6E1 4NBDA 2E2HI 1LQLA 3J81b 4A3FI 3CC2Z 4RS4A 3LUSA 2VPWA 1I6HI 3J7A4 2V45A 4MH4A 1NJI1 4MXUA 1Q811 3BG0B 2JUBA 3S1RI 1VLAA 1YIJZ 2HU9A 3Q87A 3IFUA 2V3VA 3CCJZ 3GTKI 1YJNZ 3CCSZ 2B63I 2K3RA 1VQ5Z 4A3BI 2JIPA 5FLXf 3GTOI 1VQ91 3GTLI 3ESWA 1WCMI 3BG1B 1Y1VS
chains in the Genus database with same CATH topology
3CCV1 1Y1VI 4BY1I 3D6WA 2V8KA 1RO0A 4NFRA 3M4OI 1Z02A 2F4OA 4NB8A 3NDJA 3S15I 1VQ61 4XX2A 1K83I 4A3LI 4NBAA 3MONA 2O4HA 3TE5B 4CL1A 3CCQ1 2EGTA 2OTJ1 1L1OC 2R6MA 4RVGA 1M1K2 5AN9F 1JJ2Y 1KRLA 4E2XA 1VQP1 2E2II 3CCVZ 3CCUZ 3KIFA 1YI21 1I50I 3VMHA 5T67A 1QYPA 1VQ81 3TDHB 3RZDI 1RLYA 1K8A2 4Y52I 1YJ91 1KC82 2LFUA 1YIT1 3JAMb 5C4JI 3CCL1 1Q861 1VQL1 3G711 1VQK1 2PM9A 1JJ2Z 1I3QI 2LIYA 4E32A 2QRDB 3HKZA 3NDIA 1KD12 2OTJZ 1K732 2QREB 2KPIA 3CPWY 4Y7NI 3S1NI 1YHQZ 4E33A 4MD8A 2F4MA 2AKLA 3OW2Y 3MZKB 1Q7Y2 3I551 4A3GI 1VQM1 2ZAEB 3D9XA 2YU9I 3VB9A 3GTPI 1DL6A 2Y0SA 5A2Qf 1KQSZ 3HOXI 3CXCZ 3KIHA 3P5JB 4X6AI 3CCLZ 1VQLZ 1RNIA 3CME1 4E30A 3CPWZ 1K9M2 3H3VJ 5C44I 3CQZI 3OW2Z 3CC4Z 3PO2I 3FQMA 1M1K1 4A3CI 4E31A 1R9TI 1X3WA 4NOZA 4HGZA 3G6EZ 2DE6A 2PMZA 1Q822 1YJW1 4RVFA 2DE7A 4BBSI 5D1OB 4MD7A 3CCM1 1QF8A 1Z01A 4QTTA 2VF1A 5T6BA 3NH5A 4E2YA 3FQQA 3S2HI 2J6AA 1TWAI 2QA41 3GTGI 3HOWI 4A3JI 2JMOA 1P9NA 4NH1C 5LL6f 1Z03A 2HF1A 2DE5A 2R7ZI 3CC71 4E2ZA 5IP7I 5FLXb 4S1TA 1WW9A 1Q7Y1 2JS4A 2VUMI 1WIIA 1ZB8A 3J80f 3CCR1 3U50C 1JWHC 2P3YA 3CD61 3F3FC 3K7AI 1M902 1N8R2 4BXXI 3S1MI 3GTMS 1SFOI 1N2FA 3MZLB 3NH8A 1VQ9Z 2QA4Z 1VQ41 2GTHA 5D1OA 3GTMI 3S16I 2JA5I 1VQ71 1TFIA 3HOYI 2GU2A 3CC7Z 2YADA 2VUGA 3IF8A 5FLMI 3I07A 2NVTI 3CCE1 1TWFI 3T4NB 4NBBA 3S1QI 2QR1B 3G4S1 2BJOA 3NH4A 4RV9A 5IP9I 2JR6A 3CCRZ 1VQN1 1VQ6Z 4EWCA 1Q812 4A3EI 3IX0A 1NUIA 2KI7B 2OTL1 1KQSY 1W2BY 2QEX1 3CXCY 3CCQZ 4A93I 3GCFA 1VQ4Z 1USPB 1NP6A 2JNYA 1PFTA 2OZKA 3I561 4DGLA 1VQPZ 1VQO1 1VQ7Z 4DQYB 4NBFA 1YI2Z 2Q4ZA 5C4XI 3CCEZ 2K5RA 2Q51A 1VQ8Z 2RHBA 4NBGA 3CC21 1RQFA 1RO4A 1YJ9Z 1YITZ 4E2WA 1W2BZ 2QRCB 2OTLZ 3G71Z 2QLVB 1VQKZ 4BY7I 1QVFY 1X0TA 4NBCA 1YUKA 2JA7I 4RVHA 2NVQI 1M901 4DK1A 5A2Qb 4NBEA 2RIQA 1YIJ1 3RZOI 2E2JI 2IZ3A 3FKII 3CCJ1 3CMA1 3F3PC 1YJN1 3I55Z 1VQMZ 1USPA 3GTQI 3CCS1 1ZB9A 4BBRI 1VQ51 4A3DI 2I3CA 1QVFZ 2NVYI 1K8A1 1KC81 3VMGA 3CMEZ 5C3EI 3M3YI 2O53A 5IT9f 1S7MA 4NBHA 2PK7A 3GKQA 2P28A 1KD11 1K731 4MONA 3I4MI 4NB9A 1Q862 3CMAZ 5CM2M 1YUAA 3I4NI 5IT9b 4A3KI 2RT9A 5D1PA 1YJWZ 1RO2A 3GTJI 3CCMZ 4RVDA 2RBLA 2V8JA 3VTNA 4A3II 2OOYB 1S721 1ML8A 2M6NA 2R92I 2W03A 3H0GI 2QKDA 1TWGI 3CCU1 2M48A 4HGYA 1K9M1 3J80b 1X3ZA 3HOUI 5T64A 1Y1WI 3PO3S 2WB1A 2V8IA 1NJI2 3VMIA 3PO3I 4MD9A 2H85A 4A3MI 3EEDA 1Q821 2RPRA 2NVXI 3CD6Z 1S72Z 1QVGY 1TWHI 4HH4A 3S2DI 3QWUA 3JAMf 2WAQA 1YHQ1 3EERA 2JA8I 1ZH1A 3S14I 3HOVI 3S17I 4AYBA 3G4SZ 2JA6I 1QVGZ 4TNUA 1VQNZ 2R93I 2IZ4A 2GTIA 2OOXB 2W04A 3CC41 3J81f 2QEXZ 4QTUA 2E9HA 3NFZA 3HOZI 1TWCI 4MRIA 1N8R1 3I56Z 2G2KA 1VQOZ 3G6E1 4NBDA 2E2HI 1LQLA 3J81b 4A3FI 3CC2Z 4RS4A 3LUSA 1I6HI 3J7A4 4MH4A 1NJI1 4MXUA 1Q811 3BG0B 2JUBA 3S1RI 1VLAA 1YIJZ 2HU9A 3Q87A 3IFUA 3CCJZ 3GTKI 1YJNZ 3CCSZ 2B63I 2K3RA 1VQ5Z 4A3BI 5FLXf 3GTOI 1VQ91 3GTLI 3ESWA 1WCMI 3BG1B 1Y1VS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V I;  1TWH I;  2DE6 A;  3S2D I;  4BY1 I;  3D6W A;  2DE7 A;  4BBS I;  4BY7 I;  3M4O I;  2F4O A;  3EER A;  4NBC A;  4NB8 A;  3S15 I;  2JA7 I;  4QTT A;  2NVQ I;  2JA8 I;  4XX2 A;  4NBE A;  1K83 I;  3S14 I;  3S2H I;  4A3L I;  4NBA A;  2J6A A;  3HOV I;  3RZO I;  1TWA I;  2E2J I;  3GTG I;  3HOW I;  3S17 I;  4A3J I;  3FKI I;  2JA6 I;  1L1O C;  2HF1 A;  1USP A;  2DE5 A;  3GTQ I;  2R7Z I;  2E2I I;  5IP7 I;  2R93 I;  1ZB9 A;  4BBR I;  4A3D I;  2NVY I;  1I50 I;  1WW9 A;  3VMH A;  4QTU A;  2JS4 A;  2VUM I;  1QYP A;  1ZB8 A;  3HOZ I;  1TWC I;  3VMG A;  3M3Y I;  5C3E I;  3RZD I;  1RLY A;  3U50 C;  2P3Y A;  4Y52 I;  4NBH A;  3K7A I;  2PK7 A;  3GKQ A;  4BXX I;  5C4J I;  4NBD A;  2E2H I;  3S1M I;  3GTM S;  1SFO I;  1N2F A;  1LQL A;  3I4M I;  1I3Q I;  4NB9 A;  4A3F I;  3GTM I;  3S16 I;  5CM2 M;  2JA5 I;  1YUA A;  3LUS A;  1I6H I;  1TFI A;  3HOY I;  3I4N I;  4A3K I;  2KPI A;  4MH4 A;  4Y7N I;  3S1N I;  5FLM I;  3I07 A;  2NVT I;  1TWF I;  4NBB A;  3GTJ I;  3S1Q I;  2RBL A;  2F4M A;  2AKL A;  2BJO A;  4A3I I;  4A3G I;  1ML8 A;  5IP9 I;  2JR6 A;  3S1R I;  2R92 I;  2YU9 I;  3H0G I;  3VB9 A;  3GTP I;  1DL6 A;  4A3E I;  1VLA A;  1TWG I;  3Q87 A;  1NUI A;  3HOX I;  4X6A I;  3GTK I;  3GCF A;  4A93 I;  1USP B;  2JNY A;  1PFT A;  1X3Z A;  3HOU I;  2B63 I;  1Y1W I;  3PO3 S;  4NBF A;  3H3V J;  5C44 I;  4A3B I;  3CQZ I;  3VMI A;  3PO3 I;  5C4X I;  3GTO I;  4A3M I;  3GTL I;  3PO2 I;  3ESW A;  1WCM I;  2K5R A;  4A3C I;  4NBG A;  1Y1V S;  1R9T I;  1X3W A;  4NOZ A;  2NVX I;  1RO4 A; 
#chains in the Genus database with same CATH topology
 3CCV 1;  1Y1V I;  4BY1 I;  3D6W A;  2V8K A;  1Y8C A;  1WZN A;  2JIO A;  1RO0 A;  4NFR A;  3M4O I;  1Z02 A;  2F4O A;  4NB8 A;  3NDJ A;  3S15 I;  1VQ6 1;  4XX2 A;  1K83 I;  4A3L I;  4NBA A;  3MON A;  2O4H A;  3TE5 B;  4CL1 A;  3CCQ 1;  2EGT A;  2OTJ 1;  1L1O C;  2NAP A;  2R6M A;  4RVG A;  1M1K 2;  5AN9 F;  1JJ2 Y;  1KRL A;  4E2X A;  1VQP 1;  2E2I I;  3CCV Z;  3CCU Z;  3KIF A;  1YI2 1;  1I50 I;  3VMH A;  5T67 A;  1QYP A;  1VQ8 1;  3TDH B;  3RZD I;  1RLY A;  1K8A 2;  4Y52 I;  1YJ9 1;  1KC8 2;  2LFU A;  1YIT 1;  3JAM b;  1SIW A;  5C4J I;  2JIM A;  3CCL 1;  1Q86 1;  1VQL 1;  3G71 1;  1VQK 1;  2PM9 A;  1JJ2 Z;  1I3Q I;  2LIY A;  4E32 A;  2QRD B;  3HKZ A;  3NDI A;  1KD1 2;  2OTJ Z;  1K73 2;  2QRE B;  2KPI A;  3CPW Y;  4Y7N I;  3S1N I;  1YHQ Z;  4E33 A;  4MD8 A;  2F4M A;  2AKL A;  3OW2 Y;  3MZK B;  1Q7Y 2;  2IV2 X;  3I55 1;  4A3G I;  1VQM 1;  2ZAE B;  3D9X A;  2YU9 I;  3VB9 A;  3GTP I;  1DL6 A;  1WJ2 A;  2Y0S A;  5A2Q f;  1KQS Z;  3HOX I;  1AA6 A;  3CXC Z;  3KIH A;  3P5J B;  4X6A I;  3CCL Z;  1VQL Z;  1RNI A;  3CME 1;  4E30 A;  3CPW Z;  1K9M 2;  1FDI A;  3H3V J;  5C44 I;  3CQZ I;  3OW2 Z;  3CC4 Z;  2LEX A;  3PO2 I;  3FQM A;  1M1K 1;  4A3C I;  2AYD A;  4E31 A;  1R9T I;  1X3W A;  4NOZ A;  4HGZ A;  3G6E Z;  2DE6 A;  2PMZ A;  1Q82 2;  1YJW 1;  4RVF A;  2DE7 A;  4BBS I;  5D1O B;  4MD7 A;  3CCM 1;  1QF8 A;  1Z01 A;  4QTT A;  2VF1 A;  5T6B A;  3NH5 A;  4E2Y A;  3FQQ A;  3S2H I;  2J6A A;  1TWA I;  2QA4 1;  3GTG I;  3HOW I;  4A3J I;  2JMO A;  1P9N A;  4NH1 C;  5LL6 f;  1Z03 A;  2HF1 A;  2DE5 A;  2R7Z I;  3CC7 1;  4E2Z A;  5IP7 I;  5FLX b;  4S1T A;  1WW9 A;  1Q7Y 1;  2JS4 A;  2VUM I;  1WII A;  1ZB8 A;  3J80 f;  3CCR 1;  3U50 C;  1JWH C;  2P3Y A;  3CD6 1;  3F3F C;  3K7A I;  1M90 2;  1N8R 2;  4BXX I;  3S1M I;  3GTM S;  1SFO I;  1N2F A;  3MZL B;  3NH8 A;  1VQ9 Z;  2QA4 Z;  1VQ4 1;  2GTH A;  5D1O A;  3GTM I;  3S16 I;  2JA5 I;  1VQ7 1;  1TFI A;  3HOY I;  2GU2 A;  3CC7 Z;  2YAD A;  2VUG A;  3IF8 A;  5FLM I;  3I07 A;  1Q16 A;  2NVT I;  3CCE 1;  1TWF I;  3T4N B;  4NBB A;  3S1Q I;  2QR1 B;  3G4S 1;  2BJO A;  3NH4 A;  4RV9 A;  5IP9 I;  2JR6 A;  3CCR Z;  1VQN 1;  1VQ6 Z;  4EWC A;  1Q81 2;  4A3E I;  3IX0 A;  1NUI A;  2KI7 B;  2OTL 1;  1KQS Y;  1W2B Y;  2QEX 1;  3CXC Y;  3CCQ Z;  4A93 I;  3GCF A;  1VQ4 Z;  2JIQ A;  1USP B;  1NP6 A;  2JNY A;  1PFT A;  2OZK A;  3I56 1;  4DGL A;  1VQP Z;  1VQO 1;  1VQ7 Z;  4DQY B;  4NBF A;  1YI2 Z;  2Q4Z A;  5C4X I;  3CCE Z;  2K5R A;  2Q51 A;  1VQ8 Z;  2RHB A;  4NBG A;  3CC2 1;  2VPY A;  1QXF A;  1RQF A;  1RO4 A;  1YJ9 Z;  1YIT Z;  1FDO A;  4E2W A;  1W2B Z;  2QRC B;  2OTL Z;  3G71 Z;  2QLV B;  1VQK Z;  4BY7 I;  1QVF Y;  1X0T A;  4NBC A;  1YUK A;  2JA7 I;  4RVH A;  2NVQ I;  1M90 1;  4DK1 A;  5A2Q b;  4NBE A;  2RIQ A;  1YIJ 1;  3RZO I;  2VPZ A;  2E2J I;  2IZ3 A;  3FKI I;  3CCJ 1;  3CMA 1;  3F3P C;  1YJN 1;  3I55 Z;  1VQM Z;  1USP A;  3GTQ I;  3CCS 1;  1ZB9 A;  4BBR I;  1VQ5 1;  4A3D I;  2I3C A;  1QVF Z;  2NVY I;  2JIR A;  1K8A 1;  1KC8 1;  3VMG A;  3CME Z;  5C3E I;  3M3Y I;  2O53 A;  5IT9 f;  1S7M A;  4NBH A;  2PK7 A;  3GKQ A;  3IR7 A;  2P28 A;  1KD1 1;  1K73 1;  4MON A;  3I4M I;  4NB9 A;  1Q86 2;  3CMA Z;  5CM2 M;  1YUA A;  3I4N I;  5IT9 b;  4A3K I;  2RT9 A;  5D1P A;  1YJW Z;  1RO2 A;  3GTJ I;  3CCM Z;  4RVD A;  2RBL A;  2V8J A;  3VTN A;  4A3I I;  2OOY B;  1S72 1;  1ML8 A;  2M6N A;  2R92 I;  2W03 A;  3H0G I;  2VPX A;  2QKD A;  1TWG I;  3CCU 1;  2M48 A;  4HGY A;  2E7Z A;  1K9M 1;  3J80 b;  1X3Z A;  3HOU I;  5T64 A;  3D2L A;  1Y1W I;  3PO3 S;  2WB1 A;  2V8I A;  1NJI 2;  3VMI A;  3PO3 I;  4MD9 A;  2H85 A;  4A3M I;  3EED A;  1Q82 1;  2RPR A;  2NVX I;  3CD6 Z;  1S72 Z;  1QVG Y;  1TWH I;  4HH4 A;  3S2D I;  3QWU A;  3JAM f;  2WAQ A;  1YHQ 1;  3EER A;  2JA8 I;  1ZH1 A;  3S14 I;  3HOV I;  3S17 I;  4AYB A;  3G4S Z;  2JA6 I;  1QVG Z;  4TNU A;  1VQN Z;  2R93 I;  2IZ4 A;  2GTI A;  2OOX B;  2W04 A;  3CC4 1;  3J81 f;  2QEX Z;  4QTU A;  2E9H A;  3NFZ A;  3HOZ I;  1TWC I;  4MRI A;  1N8R 1;  3I56 Z;  2G2K A;  1VQO Z;  3G6E 1;  4NBD A;  2E2H I;  1LQL A;  3J81 b;  4A3F I;  3CC2 Z;  4RS4 A;  3LUS A;  2VPW A;  1I6H I;  3J7A 4;  2V45 A;  4MH4 A;  1NJI 1;  4MXU A;  1Q81 1;  3BG0 B;  2JUB A;  3S1R I;  1VLA A;  1YIJ Z;  2HU9 A;  3Q87 A;  3IFU A;  2V3V A;  3CCJ Z;  3GTK I;  1YJN Z;  3CCS Z;  2B63 I;  2K3R A;  1VQ5 Z;  4A3B I;  2JIP A;  5FLX f;  3GTO I;  1VQ9 1;  3GTL I;  3ESW A;  1WCM I;  3BG1 B;  1Y1V S; 
#chains in the Genus database with same CATH homology
 3CCV 1;  1Y1V I;  4BY1 I;  3D6W A;  2V8K A;  1RO0 A;  4NFR A;  3M4O I;  1Z02 A;  2F4O A;  4NB8 A;  3NDJ A;  3S15 I;  1VQ6 1;  4XX2 A;  1K83 I;  4A3L I;  4NBA A;  3MON A;  2O4H A;  3TE5 B;  4CL1 A;  3CCQ 1;  2EGT A;  2OTJ 1;  1L1O C;  2R6M A;  4RVG A;  1M1K 2;  5AN9 F;  1JJ2 Y;  1KRL A;  4E2X A;  1VQP 1;  2E2I I;  3CCV Z;  3CCU Z;  3KIF A;  1YI2 1;  1I50 I;  3VMH A;  5T67 A;  1QYP A;  1VQ8 1;  3TDH B;  3RZD I;  1RLY A;  1K8A 2;  4Y52 I;  1YJ9 1;  1KC8 2;  2LFU A;  1YIT 1;  3JAM b;  5C4J I;  3CCL 1;  1Q86 1;  1VQL 1;  3G71 1;  1VQK 1;  2PM9 A;  1JJ2 Z;  1I3Q I;  2LIY A;  4E32 A;  2QRD B;  3HKZ A;  3NDI A;  1KD1 2;  2OTJ Z;  1K73 2;  2QRE B;  2KPI A;  3CPW Y;  4Y7N I;  3S1N I;  1YHQ Z;  4E33 A;  4MD8 A;  2F4M A;  2AKL A;  3OW2 Y;  3MZK B;  1Q7Y 2;  3I55 1;  4A3G I;  1VQM 1;  2ZAE B;  3D9X A;  2YU9 I;  3VB9 A;  3GTP I;  1DL6 A;  2Y0S A;  5A2Q f;  1KQS Z;  3HOX I;  3CXC Z;  3KIH A;  3P5J B;  4X6A I;  3CCL Z;  1VQL Z;  1RNI A;  3CME 1;  4E30 A;  3CPW Z;  1K9M 2;  3H3V J;  5C44 I;  3CQZ I;  3OW2 Z;  3CC4 Z;  3PO2 I;  3FQM A;  1M1K 1;  4A3C I;  4E31 A;  1R9T I;  1X3W A;  4NOZ A;  4HGZ A;  3G6E Z;  2DE6 A;  2PMZ A;  1Q82 2;  1YJW 1;  4RVF A;  2DE7 A;  4BBS I;  5D1O B;  4MD7 A;  3CCM 1;  1QF8 A;  1Z01 A;  4QTT A;  2VF1 A;  5T6B A;  3NH5 A;  4E2Y A;  3FQQ A;  3S2H I;  2J6A A;  1TWA I;  2QA4 1;  3GTG I;  3HOW I;  4A3J I;  2JMO A;  1P9N A;  4NH1 C;  5LL6 f;  1Z03 A;  2HF1 A;  2DE5 A;  2R7Z I;  3CC7 1;  4E2Z A;  5IP7 I;  5FLX b;  4S1T A;  1WW9 A;  1Q7Y 1;  2JS4 A;  2VUM I;  1WII A;  1ZB8 A;  3J80 f;  3CCR 1;  3U50 C;  1JWH C;  2P3Y A;  3CD6 1;  3F3F C;  3K7A I;  1M90 2;  1N8R 2;  4BXX I;  3S1M I;  3GTM S;  1SFO I;  1N2F A;  3MZL B;  3NH8 A;  1VQ9 Z;  2QA4 Z;  1VQ4 1;  2GTH A;  5D1O A;  3GTM I;  3S16 I;  2JA5 I;  1VQ7 1;  1TFI A;  3HOY I;  2GU2 A;  3CC7 Z;  2YAD A;  2VUG A;  3IF8 A;  5FLM I;  3I07 A;  2NVT I;  3CCE 1;  1TWF I;  3T4N B;  4NBB A;  3S1Q I;  2QR1 B;  3G4S 1;  2BJO A;  3NH4 A;  4RV9 A;  5IP9 I;  2JR6 A;  3CCR Z;  1VQN 1;  1VQ6 Z;  4EWC A;  1Q81 2;  4A3E I;  3IX0 A;  1NUI A;  2KI7 B;  2OTL 1;  1KQS Y;  1W2B Y;  2QEX 1;  3CXC Y;  3CCQ Z;  4A93 I;  3GCF A;  1VQ4 Z;  1USP B;  1NP6 A;  2JNY A;  1PFT A;  2OZK A;  3I56 1;  4DGL A;  1VQP Z;  1VQO 1;  1VQ7 Z;  4DQY B;  4NBF A;  1YI2 Z;  2Q4Z A;  5C4X I;  3CCE Z;  2K5R A;  2Q51 A;  1VQ8 Z;  2RHB A;  4NBG A;  3CC2 1;  1RQF A;  1RO4 A;  1YJ9 Z;  1YIT Z;  4E2W A;  1W2B Z;  2QRC B;  2OTL Z;  3G71 Z;  2QLV B;  1VQK Z;  4BY7 I;  1QVF Y;  1X0T A;  4NBC A;  1YUK A;  2JA7 I;  4RVH A;  2NVQ I;  1M90 1;  4DK1 A;  5A2Q b;  4NBE A;  2RIQ A;  1YIJ 1;  3RZO I;  2E2J I;  2IZ3 A;  3FKI I;  3CCJ 1;  3CMA 1;  3F3P C;  1YJN 1;  3I55 Z;  1VQM Z;  1USP A;  3GTQ I;  3CCS 1;  1ZB9 A;  4BBR I;  1VQ5 1;  4A3D I;  2I3C A;  1QVF Z;  2NVY I;  1K8A 1;  1KC8 1;  3VMG A;  3CME Z;  5C3E I;  3M3Y I;  2O53 A;  5IT9 f;  1S7M A;  4NBH A;  2PK7 A;  3GKQ A;  2P28 A;  1KD1 1;  1K73 1;  4MON A;  3I4M I;  4NB9 A;  1Q86 2;  3CMA Z;  5CM2 M;  1YUA A;  3I4N I;  5IT9 b;  4A3K I;  2RT9 A;  5D1P A;  1YJW Z;  1RO2 A;  3GTJ I;  3CCM Z;  4RVD A;  2RBL A;  2V8J A;  3VTN A;  4A3I I;  2OOY B;  1S72 1;  1ML8 A;  2M6N A;  2R92 I;  2W03 A;  3H0G I;  2QKD A;  1TWG I;  3CCU 1;  2M48 A;  4HGY A;  1K9M 1;  3J80 b;  1X3Z A;  3HOU I;  5T64 A;  1Y1W I;  3PO3 S;  2WB1 A;  2V8I A;  1NJI 2;  3VMI A;  3PO3 I;  4MD9 A;  2H85 A;  4A3M I;  3EED A;  1Q82 1;  2RPR A;  2NVX I;  3CD6 Z;  1S72 Z;  1QVG Y;  1TWH I;  4HH4 A;  3S2D I;  3QWU A;  3JAM f;  2WAQ A;  1YHQ 1;  3EER A;  2JA8 I;  1ZH1 A;  3S14 I;  3HOV I;  3S17 I;  4AYB A;  3G4S Z;  2JA6 I;  1QVG Z;  4TNU A;  1VQN Z;  2R93 I;  2IZ4 A;  2GTI A;  2OOX B;  2W04 A;  3CC4 1;  3J81 f;  2QEX Z;  4QTU A;  2E9H A;  3NFZ A;  3HOZ I;  1TWC I;  4MRI A;  1N8R 1;  3I56 Z;  2G2K A;  1VQO Z;  3G6E 1;  4NBD A;  2E2H I;  1LQL A;  3J81 b;  4A3F I;  3CC2 Z;  4RS4 A;  3LUS A;  1I6H I;  3J7A 4;  4MH4 A;  1NJI 1;  4MXU A;  1Q81 1;  3BG0 B;  2JUB A;  3S1R I;  1VLA A;  1YIJ Z;  2HU9 A;  3Q87 A;  3IFU A;  3CCJ Z;  3GTK I;  1YJN Z;  3CCS Z;  2B63 I;  2K3R A;  1VQ5 Z;  4A3B I;  5FLX f;  3GTO I;  1VQ9 1;  3GTL I;  3ESW A;  1WCM I;  3BG1 B;  1Y1V S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...