3M4OI

Rna polymerase ii elongation complex b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m4oI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m4oI02
2JA6I 1YUAA 3GTMS 2AKLA 4Y7NI 1TWAI 4NBAA 2P3YA 1N2FA 3PO3S 3S2DI 4A3FI 3S1NI 3RZOI 1RLYA 1K83I 3I07A 2KPIA 3U50C 2E2JI 4NBGA 4NBHA 1Y1VI 1TWHI 3HOVI 2DE7A 3H0GI 4BY1I 3M4OI 3S16I 4NBCA 5CM2M 3VB9A 4A3GI 3GTKI 1USPA 2E2II 3GTJI 4QTUA 3HOUI 1X3ZA 1DL6A 1I3QI 2RBLA 1ML8A 1X3WA 3GTOI 1TWCI 1WCMI 1LQLA 3S14I 2R92I 1TWFI 3Q87A 3GTPI 3PO2I 3ESWA 3HOYI 3K7AI 2K5RA 1ZB8A 1L1OC 1I50I 1PFTA 4A3BI 2DE5A 4A93I 1I6HI 2JNYA 3CQZI 3GTMI 5IP9I 4NBDA 1QYPA 3HOWI 4A3MI 1USPB 2NVYI 3PO3I 4NBFA 4A3KI 1Y1WI 1SFOI 4A3DI 2R93I 4BBRI 4A3LI 3GTQI 3GKQA 4BBSI 3S1MI 1NUIA 2R7ZI 3HOXI 1RO4A 2BJOA 1ZB9A 2HF1A 3LUSA 3FKII 4Y52I 4NBBA 2B63I 2PK7A 4BXXI 2JA8I 5IP7I 3M3YI 3GTLI 5C3EI 4X6AI 1Y1VS 2E2HI 1TWGI 4A3CI 3S1RI 1VLAA 2VUMI 3S2HI 2F4MA 4NB8A 2JA5I 1WW9A 5C4JI 3S17I 3VMHA 2JR6A 2YU9I 4A3JI 2J6AA 1R9TI 4BY7I 3RZDI 5C4XI 3S1QI 2NVTI 4NOZA 5FLMI 4NB9A 3EERA 3VMGA 4A3II 3H3VJ 3I4NI 3I4MI 2JS4A 3GCFA 5C44I 2NVXI 2DE6A 4NBEA 3D6WA 2NVQI 3S15I 2JA7I 2F4OA 4XX2A 3VMIA 3HOZI 4QTTA 4A3EI 4MH4A 3GTGI 1TFIA
chains in the Genus database with same CATH superfamily
4RVHA 2OTJ1 5IT9f 2AKLA 3FQQA 3NFZA 1N2FA 2JUBA 2Q51A 3CC71 5T64A 3S1NI 1ZH1A 2KPIA 3CMEZ 3CPWZ 2OOYB 3CCM1 3CD61 1K731 4RS4A 2EGTA 4E2ZA 5CM2M 1JJ2Y 4A3GI 1VQO1 3HOUI 5T67A 3TDHB 3CCJZ 3CCUZ 1I3QI 2RBLA 3GTOI 2WAQA 1WCMI 3FQMA 2R92I 2H85A 1YIJ1 1X0TA 3ESWA 2IZ3A 4RVDA 1K9M2 5T6BA 2K5RA 2DE5A 2JNYA 3IFUA 5D1OB 2JMOA 3F3PC 4NBDA 1QYPA 2AYDA 4A3MI 2KI7B 4A3KI 2R93I 4E30A 2QR1B 2E7ZA 2R7ZI 1YI21 1QVGZ 4RVGA 2Y0SA 3LUSA 1N8R2 2B63I 1VQ91 3MZKB 1S72Z 5IP7I 3VTNA 3CCRZ 3M3YI 3NDJA 1Q16A 1TWGI 1VLAA 3CCU1 2VUMI 3S2HI 4NB8A 3S17I 1WW9A 3OW2Z 1VQ61 4BY7I 4MD7A 1FDOA 3S1QI 2RHBA 3NDIA 3CC41 4DQYB 1RO0A 3EERA 2I3CA 1VQ7Z 3VMGA 1Q7Y1 4A3II 1Q861 1AA6A 1Z02A 1M1K1 2OZKA 1S7MA 1QXFA 2DE6A 2V8KA 2Q4ZA 2V8IA 3KIFA 1VQ4Z 4NBEA 1YITZ 2NVQI 3IR7A 2LEXA 2M48A 3IX0A 2W04A 3CCMZ 3CD6Z 1KC81 4Y7NI 4HGZA 1YHQZ 3CCR1 1W2BY 4DGLA 2QRDB 3I07A 3F3FC 1KRLA 1YJ91 4E31A 2JIQA 4NBCA 4E32A 1USPA 1VQ51 2E2II 2O4HA 1VQ71 1RQFA 1DL6A 3NH8A 4RV9A 1Q811 3S14I 1TWFI 3Q87A 1VQ41 3PO2I 1YIT1 2V45A 1JWHC 1KQSY 1NJI2 1ZB8A 4S1TA 1YI2Z 2QKDA 1I50I 2ZAEB 1VQ8Z 3J81f 1VQ9Z 3GTMI 4AYBA 5IP9I 1JJ2Z 3P5JB 3CMA1 1YHQ1 2NVYI 1NP6A 2IZ4A 4BBRI 4A3LI 1KD11 3JAMf 3J7A4 3HOXI 1VQ6Z 2GU2A 2HF1A 2GTHA 4Y52I 4HH4A 3KIHA 1VQPZ 3CPWY 2PK7A 1P9NA 3G6E1 3CC4Z 3IF8A 3GTLI 5C3EI 4X6AI 3S1RI 5FLXb 2JA5I 2QA41 2OOXB 5C4XI 2JIRA 1VQK1 5FLMI 2JIPA 1QF8A 3I4NI 1N8R1 3I4MI 1VQ81 4E2WA 2GTIA 2QEX1 2M6NA 2P28A 1VQMZ 5A2Qb 3HKZA 1YJW1 3J80b 1K8A2 1TWHI 1TFIA 2RIQA 3S1MI 1YJ9Z 3GTMS 1TWAI 2JIOA 2QLVB 1VQP1 1QVGY 1VQ5Z 3S2DI 4A3FI 2OTLZ 3T4NB 1RLYA 1M901 3U50C 2VPWA 5IT9b 2K3RA 3H0GI 1QVFZ 4BY1I 3S16I 2VUGA 2RPRA 2VPXA 2PMZA 3GTKI 3GTJI 4QTUA 3CCSZ 1X3WA 1TWCI 3CMAZ 1LQLA 1VQM1 1Z03A 1M1K2 3HOYI 3D2LA 3CCV1 2G2KA 3NH4A 1L1OC 1FDIA 1I6HI 3CQZI 3G6EZ 2LIYA 3I56Z 2VPYA 3HOWI 1USPB 1KC82 3PO3I 4E2XA 1SFOI 4A3DI 1Z01A 2OTL1 3I55Z 3CC21 2QA4Z 1RO4A 1ZB9A 4TNUA 1YUKA 3FKII 4NBBA 2NAPA 1KQSZ 1VQKZ 4EWCA 4BXXI 1Q822 3CCQ1 1VQN1 3CCL1 4A3CI 3CCS1 3CXCY 2IV2X 2QEXZ 4MD9A 5C4JI 3BG1B 3VMHA 2JR6A 4A3JI 2J6AA 1YJWZ 2QRCB 2NVTI 4NH1C 1Q812 1WIIA 3EEDA 3H3VJ 3GCFA 1K9M1 4MONA 5C44I 3G71Z 1K732 2NVXI 3I561 3BG0B 3D6WA 2RT9A 4MH4A 3I551 2JA6I 2E9HA 1YUAA 4NBAA 3CCE1 1VQL1 2P3YA 1KD12 3QWUA 3PO3S 2JIMA 2V8JA 3RZOI 1K83I 4MRIA 2E2JI 4NBGA 4NBHA 1Y1VI 3MONA 1SIWA 3HOVI 2DE7A 4HGYA 4RVFA 3M4OI 5D1OA 3CCVZ 3VB9A 3TE5B 1K8A1 1WZNA 1X3ZA 3CME1 1ML8A 2R6MA 3G4SZ 3G711 3GTPI 1WJ2A 3K7AI 3CC2Z 4NFRA 1PFTA 4A3BI 4A93I 4MD8A 3CCJ1 2W03A 1YJNZ 4E2YA 3CCQZ 2V3VA 1VQNZ 3OW2Y 4NBFA 1Y1WI 3CCLZ 3GTQI 3GKQA 4BBSI 4DK1A 1NUIA 1RO2A 3J81b 5FLXf 2OTJZ 1Q7Y2 2BJOA 1M902 1Y8CA 4E33A 1W2BZ 1Q862 3CC7Z 2JA8I 1QVFY 1RNIA 2PM9A 1Y1VS 2E2HI 3JAMb 2LFUA 2F4MA 5AN9F 3G4S1 2YU9I 2WB1A 1R9TI 5D1PA 3RZDI 5A2Qf 3MZLB 4NOZA 1VQOZ 4NB9A 1S721 3J80f 2QREB 1VQLZ 3CCEZ 2JS4A 2VPZA 1Q821 1NJI1 1YJN1 5LL6f 2YADA 1YIJZ 3D9XA 2HU9A 3S15I 2O53A 3NH5A 2VF1A 2JA7I 2F4OA 4XX2A 3VMIA 3HOZI 4CL1A 4QTTA 3CXCZ 4A3EI 4MXUA 3GTGI
chains in the Genus database with same CATH topology
4RVHA 2OTJ1 5IT9f 2AKLA 3FQQA 3NFZA 1N2FA 2JUBA 2Q51A 3CC71 5T64A 3S1NI 1ZH1A 2KPIA 3CMEZ 3CPWZ 2OOYB 3CCM1 3CD61 1K731 4RS4A 2EGTA 4E2ZA 5CM2M 1JJ2Y 4A3GI 1VQO1 3HOUI 5T67A 3TDHB 3CCJZ 3CCUZ 1I3QI 2RBLA 3GTOI 2WAQA 1WCMI 3FQMA 2R92I 2H85A 1YIJ1 1X0TA 3ESWA 2IZ3A 4RVDA 1K9M2 5T6BA 2K5RA 2DE5A 2JNYA 3IFUA 5D1OB 2JMOA 3F3PC 4NBDA 1QYPA 4A3MI 2KI7B 4A3KI 2R93I 4E30A 2QR1B 2R7ZI 1YI21 1QVGZ 4RVGA 2Y0SA 3LUSA 1N8R2 2B63I 1VQ91 3MZKB 1S72Z 5IP7I 3VTNA 3CCRZ 3M3YI 3NDJA 1TWGI 1VLAA 3CCU1 2VUMI 3S2HI 4NB8A 3S17I 1WW9A 3OW2Z 1VQ61 4BY7I 4MD7A 3S1QI 2RHBA 3NDIA 3CC41 4DQYB 1RO0A 3EERA 2I3CA 1VQ7Z 3VMGA 1Q7Y1 4A3II 1Q861 1Z02A 1M1K1 2OZKA 1S7MA 2DE6A 2V8KA 2Q4ZA 2V8IA 3KIFA 1VQ4Z 4NBEA 1YITZ 2NVQI 2M48A 3IX0A 2W04A 3CCMZ 3CD6Z 1KC81 4Y7NI 4HGZA 1YHQZ 3CCR1 1W2BY 4DGLA 2QRDB 3I07A 3F3FC 1KRLA 1YJ91 4E31A 4NBCA 4E32A 1USPA 1VQ51 2E2II 2O4HA 1VQ71 1RQFA 1DL6A 3NH8A 4RV9A 1Q811 3S14I 1TWFI 3Q87A 1VQ41 3PO2I 1YIT1 1JWHC 1KQSY 1NJI2 1ZB8A 4S1TA 1YI2Z 2QKDA 1I50I 2ZAEB 1VQ8Z 3J81f 1VQ9Z 3GTMI 4AYBA 5IP9I 1JJ2Z 3P5JB 3CMA1 1YHQ1 2NVYI 1NP6A 2IZ4A 4BBRI 4A3LI 1KD11 3JAMf 3J7A4 3HOXI 1VQ6Z 2GU2A 2HF1A 2GTHA 4Y52I 4HH4A 3KIHA 1VQPZ 3CPWY 2PK7A 1P9NA 3G6E1 3CC4Z 3IF8A 3GTLI 5C3EI 4X6AI 3S1RI 5FLXb 2JA5I 2QA41 2OOXB 5C4XI 1VQK1 5FLMI 1QF8A 3I4NI 1N8R1 3I4MI 1VQ81 4E2WA 2GTIA 2QEX1 2M6NA 1VQMZ 2P28A 5A2Qb 3HKZA 1YJW1 3J80b 1K8A2 1TWHI 1TFIA 2RIQA 3S1MI 1YJ9Z 3GTMS 1TWAI 2QLVB 1VQP1 1QVGY 1VQ5Z 3S2DI 4A3FI 2OTLZ 3T4NB 1RLYA 1M901 3U50C 5IT9b 2K3RA 3H0GI 1QVFZ 4BY1I 3S16I 2VUGA 2RPRA 2PMZA 3GTKI 3GTJI 4QTUA 3CCSZ 1X3WA 1TWCI 3CMAZ 1LQLA 1VQM1 1Z03A 1M1K2 3HOYI 3CCV1 2G2KA 3NH4A 1L1OC 1I6HI 3CQZI 3G6EZ 2LIYA 3I56Z 3HOWI 1USPB 1KC82 3PO3I 4E2XA 1SFOI 4A3DI 1Z01A 2OTL1 3I55Z 3CC21 2QA4Z 1RO4A 1ZB9A 4TNUA 1YUKA 3FKII 4NBBA 1VQKZ 1KQSZ 4BXXI 4EWCA 1Q822 3CCQ1 1VQN1 3CCL1 4A3CI 3CCS1 3CXCY 2QEXZ 4MD9A 5C4JI 3BG1B 3VMHA 2JR6A 4A3JI 2J6AA 1YJWZ 2QRCB 2NVTI 4NH1C 1Q812 1WIIA 3EEDA 3H3VJ 3GCFA 1K9M1 4MONA 5C44I 3G71Z 1K732 2NVXI 3I561 3BG0B 3D6WA 2RT9A 4MH4A 3I551 2JA6I 2E9HA 1YUAA 4NBAA 3CCE1 1VQL1 2P3YA 1KD12 3QWUA 3PO3S 2V8JA 3RZOI 1K83I 4MRIA 2E2JI 4NBGA 4NBHA 1Y1VI 3MONA 3HOVI 2DE7A 4HGYA 4RVFA 3M4OI 5D1OA 3CCVZ 3VB9A 3TE5B 1K8A1 1X3ZA 3CME1 1ML8A 2R6MA 3G4SZ 3G711 3GTPI 3K7AI 3CC2Z 4NFRA 1PFTA 4A3BI 4A93I 4MD8A 3CCJ1 2W03A 1YJNZ 4E2YA 3CCQZ 1VQNZ 3OW2Y 4NBFA 1Y1WI 3CCLZ 3GTQI 3GKQA 4BBSI 4DK1A 1NUIA 1RO2A 3J81b 5FLXf 2OTJZ 1Q7Y2 2BJOA 1M902 4E33A 1W2BZ 1Q862 3CC7Z 2JA8I 1QVFY 1RNIA 2PM9A 1Y1VS 2E2HI 3JAMb 2LFUA 2F4MA 5AN9F 3G4S1 2YU9I 2WB1A 1R9TI 5D1PA 3RZDI 5A2Qf 3MZLB 4NOZA 1VQOZ 4NB9A 1S721 3J80f 2QREB 1VQLZ 3CCEZ 2JS4A 1Q821 1NJI1 1YJN1 5LL6f 2YADA 1YIJZ 3D9XA 2HU9A 3S15I 2O53A 3NH5A 2VF1A 2JA7I 2F4OA 4XX2A 3VMIA 3HOZI 4CL1A 4QTTA 3CXCZ 4A3EI 4MXUA 3GTGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 I;  1YUA A;  3GTM S;  2AKL A;  4Y7N I;  1TWA I;  4NBA A;  2P3Y A;  1N2F A;  3PO3 S;  3S2D I;  4A3F I;  3S1N I;  3RZO I;  1RLY A;  1K83 I;  3I07 A;  2KPI A;  3U50 C;  2E2J I;  4NBG A;  4NBH A;  1Y1V I;  1TWH I;  3HOV I;  2DE7 A;  3H0G I;  4BY1 I;  3M4O I;  3S16 I;  4NBC A;  5CM2 M;  3VB9 A;  4A3G I;  3GTK I;  1USP A;  2E2I I;  3GTJ I;  4QTU A;  3HOU I;  1X3Z A;  1DL6 A;  1I3Q I;  2RBL A;  1ML8 A;  1X3W A;  3GTO I;  1TWC I;  1WCM I;  1LQL A;  3S14 I;  2R92 I;  1TWF I;  3Q87 A;  3GTP I;  3PO2 I;  3ESW A;  3HOY I;  3K7A I;  2K5R A;  1ZB8 A;  1L1O C;  1I50 I;  1PFT A;  4A3B I;  2DE5 A;  4A93 I;  1I6H I;  2JNY A;  3CQZ I;  3GTM I;  5IP9 I;  4NBD A;  1QYP A;  3HOW I;  4A3M I;  1USP B;  2NVY I;  3PO3 I;  4NBF A;  4A3K I;  1Y1W I;  1SFO I;  4A3D I;  2R93 I;  4BBR I;  4A3L I;  3GTQ I;  3GKQ A;  4BBS I;  3S1M I;  1NUI A;  2R7Z I;  3HOX I;  1RO4 A;  2BJO A;  1ZB9 A;  2HF1 A;  3LUS A;  3FKI I;  4Y52 I;  4NBB A;  2B63 I;  2PK7 A;  4BXX I;  2JA8 I;  5IP7 I;  3M3Y I;  3GTL I;  5C3E I;  4X6A I;  1Y1V S;  2E2H I;  1TWG I;  4A3C I;  3S1R I;  1VLA A;  2VUM I;  3S2H I;  2F4M A;  4NB8 A;  2JA5 I;  1WW9 A;  5C4J I;  3S17 I;  3VMH A;  2JR6 A;  2YU9 I;  4A3J I;  2J6A A;  1R9T I;  4BY7 I;  3RZD I;  5C4X I;  3S1Q I;  2NVT I;  4NOZ A;  5FLM I;  4NB9 A;  3EER A;  3VMG A;  4A3I I;  3H3V J;  3I4N I;  3I4M I;  2JS4 A;  3GCF A;  5C44 I;  2NVX I;  2DE6 A;  4NBE A;  3D6W A;  2NVQ I;  3S15 I;  2JA7 I;  2F4O A;  4XX2 A;  3VMI A;  3HOZ I;  4QTT A;  4A3E I;  4MH4 A;  3GTG I;  1TFI A; 
#chains in the Genus database with same CATH topology
 4RVH A;  2OTJ 1;  5IT9 f;  2AKL A;  3FQQ A;  3NFZ A;  1N2F A;  2JUB A;  2Q51 A;  3CC7 1;  5T64 A;  3S1N I;  1ZH1 A;  2KPI A;  3CME Z;  3CPW Z;  2OOY B;  3CCM 1;  3CD6 1;  1K73 1;  4RS4 A;  2EGT A;  4E2Z A;  5CM2 M;  1JJ2 Y;  4A3G I;  1VQO 1;  3HOU I;  5T67 A;  3TDH B;  3CCJ Z;  3CCU Z;  1I3Q I;  2RBL A;  3GTO I;  2WAQ A;  1WCM I;  3FQM A;  2R92 I;  2H85 A;  1YIJ 1;  1X0T A;  3ESW A;  2IZ3 A;  4RVD A;  1K9M 2;  5T6B A;  2K5R A;  2DE5 A;  2JNY A;  3IFU A;  5D1O B;  2JMO A;  3F3P C;  4NBD A;  1QYP A;  2AYD A;  4A3M I;  2KI7 B;  4A3K I;  2R93 I;  4E30 A;  2QR1 B;  2E7Z A;  2R7Z I;  1YI2 1;  1QVG Z;  4RVG A;  2Y0S A;  3LUS A;  1N8R 2;  2B63 I;  1VQ9 1;  3MZK B;  1S72 Z;  5IP7 I;  3VTN A;  3CCR Z;  3M3Y I;  3NDJ A;  1Q16 A;  1TWG I;  1VLA A;  3CCU 1;  2VUM I;  3S2H I;  4NB8 A;  3S17 I;  1WW9 A;  3OW2 Z;  1VQ6 1;  4BY7 I;  4MD7 A;  1FDO A;  3S1Q I;  2RHB A;  3NDI A;  3CC4 1;  4DQY B;  1RO0 A;  3EER A;  2I3C A;  1VQ7 Z;  3VMG A;  1Q7Y 1;  4A3I I;  1Q86 1;  1AA6 A;  1Z02 A;  1M1K 1;  2OZK A;  1S7M A;  1QXF A;  2DE6 A;  2V8K A;  2Q4Z A;  2V8I A;  3KIF A;  1VQ4 Z;  4NBE A;  1YIT Z;  2NVQ I;  3IR7 A;  2LEX A;  2M48 A;  3IX0 A;  2W04 A;  3CCM Z;  3CD6 Z;  1KC8 1;  4Y7N I;  4HGZ A;  1YHQ Z;  3CCR 1;  1W2B Y;  4DGL A;  2QRD B;  3I07 A;  3F3F C;  1KRL A;  1YJ9 1;  4E31 A;  2JIQ A;  4NBC A;  4E32 A;  1USP A;  1VQ5 1;  2E2I I;  2O4H A;  1VQ7 1;  1RQF A;  1DL6 A;  3NH8 A;  4RV9 A;  1Q81 1;  3S14 I;  1TWF I;  3Q87 A;  1VQ4 1;  3PO2 I;  1YIT 1;  2V45 A;  1JWH C;  1KQS Y;  1NJI 2;  1ZB8 A;  4S1T A;  1YI2 Z;  2QKD A;  1I50 I;  2ZAE B;  1VQ8 Z;  3J81 f;  1VQ9 Z;  3GTM I;  4AYB A;  5IP9 I;  1JJ2 Z;  3P5J B;  3CMA 1;  1YHQ 1;  2NVY I;  1NP6 A;  2IZ4 A;  4BBR I;  4A3L I;  1KD1 1;  3JAM f;  3J7A 4;  3HOX I;  1VQ6 Z;  2GU2 A;  2HF1 A;  2GTH A;  4Y52 I;  4HH4 A;  3KIH A;  1VQP Z;  3CPW Y;  2PK7 A;  1P9N A;  3G6E 1;  3CC4 Z;  3IF8 A;  3GTL I;  5C3E I;  4X6A I;  3S1R I;  5FLX b;  2JA5 I;  2QA4 1;  2OOX B;  5C4X I;  2JIR A;  1VQK 1;  5FLM I;  2JIP A;  1QF8 A;  3I4N I;  1N8R 1;  3I4M I;  1VQ8 1;  4E2W A;  2GTI A;  2QEX 1;  2M6N A;  2P28 A;  1VQM Z;  5A2Q b;  3HKZ A;  1YJW 1;  3J80 b;  1K8A 2;  1TWH I;  1TFI A;  2RIQ A;  3S1M I;  1YJ9 Z;  3GTM S;  1TWA I;  2JIO A;  2QLV B;  1VQP 1;  1QVG Y;  1VQ5 Z;  3S2D I;  4A3F I;  2OTL Z;  3T4N B;  1RLY A;  1M90 1;  3U50 C;  2VPW A;  5IT9 b;  2K3R A;  3H0G I;  1QVF Z;  4BY1 I;  3S16 I;  2VUG A;  2RPR A;  2VPX A;  2PMZ A;  3GTK I;  3GTJ I;  4QTU A;  3CCS Z;  1X3W A;  1TWC I;  3CMA Z;  1LQL A;  1VQM 1;  1Z03 A;  1M1K 2;  3HOY I;  3D2L A;  3CCV 1;  2G2K A;  3NH4 A;  1L1O C;  1FDI A;  1I6H I;  3CQZ I;  3G6E Z;  2LIY A;  3I56 Z;  2VPY A;  3HOW I;  1USP B;  1KC8 2;  3PO3 I;  4E2X A;  1SFO I;  4A3D I;  1Z01 A;  2OTL 1;  3I55 Z;  3CC2 1;  2QA4 Z;  1RO4 A;  1ZB9 A;  4TNU A;  1YUK A;  3FKI I;  4NBB A;  2NAP A;  1KQS Z;  1VQK Z;  4EWC A;  4BXX I;  1Q82 2;  3CCQ 1;  1VQN 1;  3CCL 1;  4A3C I;  3CCS 1;  3CXC Y;  2IV2 X;  2QEX Z;  4MD9 A;  5C4J I;  3BG1 B;  3VMH A;  2JR6 A;  4A3J I;  2J6A A;  1YJW Z;  2QRC B;  2NVT I;  4NH1 C;  1Q81 2;  1WII A;  3EED A;  3H3V J;  3GCF A;  1K9M 1;  4MON A;  5C44 I;  3G71 Z;  1K73 2;  2NVX I;  3I56 1;  3BG0 B;  3D6W A;  2RT9 A;  4MH4 A;  3I55 1;  2JA6 I;  2E9H A;  1YUA A;  4NBA A;  3CCE 1;  1VQL 1;  2P3Y A;  1KD1 2;  3QWU A;  3PO3 S;  2JIM A;  2V8J A;  3RZO I;  1K83 I;  4MRI A;  2E2J I;  4NBG A;  4NBH A;  1Y1V I;  3MON A;  1SIW A;  3HOV I;  2DE7 A;  4HGY A;  4RVF A;  3M4O I;  5D1O A;  3CCV Z;  3VB9 A;  3TE5 B;  1K8A 1;  1WZN A;  1X3Z A;  3CME 1;  1ML8 A;  2R6M A;  3G4S Z;  3G71 1;  3GTP I;  1WJ2 A;  3K7A I;  3CC2 Z;  4NFR A;  1PFT A;  4A3B I;  4A93 I;  4MD8 A;  3CCJ 1;  2W03 A;  1YJN Z;  4E2Y A;  3CCQ Z;  2V3V A;  1VQN Z;  3OW2 Y;  4NBF A;  1Y1W I;  3CCL Z;  3GTQ I;  3GKQ A;  4BBS I;  4DK1 A;  1NUI A;  1RO2 A;  3J81 b;  5FLX f;  2OTJ Z;  1Q7Y 2;  2BJO A;  1M90 2;  1Y8C A;  4E33 A;  1W2B Z;  1Q86 2;  3CC7 Z;  2JA8 I;  1QVF Y;  1RNI A;  2PM9 A;  1Y1V S;  2E2H I;  3JAM b;  2LFU A;  2F4M A;  5AN9 F;  3G4S 1;  2YU9 I;  2WB1 A;  1R9T I;  5D1P A;  3RZD I;  5A2Q f;  3MZL B;  4NOZ A;  1VQO Z;  4NB9 A;  1S72 1;  3J80 f;  2QRE B;  1VQL Z;  3CCE Z;  2JS4 A;  2VPZ A;  1Q82 1;  1NJI 1;  1YJN 1;  5LL6 f;  2YAD A;  1YIJ Z;  3D9X A;  2HU9 A;  3S15 I;  2O53 A;  3NH5 A;  2VF1 A;  2JA7 I;  2F4O A;  4XX2 A;  3VMI A;  3HOZ I;  4CL1 A;  4QTT A;  3CXC Z;  4A3E I;  4MXU A;  3GTG I; 
#chains in the Genus database with same CATH homology
 4RVH A;  2OTJ 1;  5IT9 f;  2AKL A;  3FQQ A;  3NFZ A;  1N2F A;  2JUB A;  2Q51 A;  3CC7 1;  5T64 A;  3S1N I;  1ZH1 A;  2KPI A;  3CME Z;  3CPW Z;  2OOY B;  3CCM 1;  3CD6 1;  1K73 1;  4RS4 A;  2EGT A;  4E2Z A;  5CM2 M;  1JJ2 Y;  4A3G I;  1VQO 1;  3HOU I;  5T67 A;  3TDH B;  3CCJ Z;  3CCU Z;  1I3Q I;  2RBL A;  3GTO I;  2WAQ A;  1WCM I;  3FQM A;  2R92 I;  2H85 A;  1YIJ 1;  1X0T A;  3ESW A;  2IZ3 A;  4RVD A;  1K9M 2;  5T6B A;  2K5R A;  2DE5 A;  2JNY A;  3IFU A;  5D1O B;  2JMO A;  3F3P C;  4NBD A;  1QYP A;  4A3M I;  2KI7 B;  4A3K I;  2R93 I;  4E30 A;  2QR1 B;  2R7Z I;  1YI2 1;  1QVG Z;  4RVG A;  2Y0S A;  3LUS A;  1N8R 2;  2B63 I;  1VQ9 1;  3MZK B;  1S72 Z;  5IP7 I;  3VTN A;  3CCR Z;  3M3Y I;  3NDJ A;  1TWG I;  1VLA A;  3CCU 1;  2VUM I;  3S2H I;  4NB8 A;  3S17 I;  1WW9 A;  3OW2 Z;  1VQ6 1;  4BY7 I;  4MD7 A;  3S1Q I;  2RHB A;  3NDI A;  3CC4 1;  4DQY B;  1RO0 A;  3EER A;  2I3C A;  1VQ7 Z;  3VMG A;  1Q7Y 1;  4A3I I;  1Q86 1;  1Z02 A;  1M1K 1;  2OZK A;  1S7M A;  2DE6 A;  2V8K A;  2Q4Z A;  2V8I A;  3KIF A;  1VQ4 Z;  4NBE A;  1YIT Z;  2NVQ I;  2M48 A;  3IX0 A;  2W04 A;  3CCM Z;  3CD6 Z;  1KC8 1;  4Y7N I;  4HGZ A;  1YHQ Z;  3CCR 1;  1W2B Y;  4DGL A;  2QRD B;  3I07 A;  3F3F C;  1KRL A;  1YJ9 1;  4E31 A;  4NBC A;  4E32 A;  1USP A;  1VQ5 1;  2E2I I;  2O4H A;  1VQ7 1;  1RQF A;  1DL6 A;  3NH8 A;  4RV9 A;  1Q81 1;  3S14 I;  1TWF I;  3Q87 A;  1VQ4 1;  3PO2 I;  1YIT 1;  1JWH C;  1KQS Y;  1NJI 2;  1ZB8 A;  4S1T A;  1YI2 Z;  2QKD A;  1I50 I;  2ZAE B;  1VQ8 Z;  3J81 f;  1VQ9 Z;  3GTM I;  4AYB A;  5IP9 I;  1JJ2 Z;  3P5J B;  3CMA 1;  1YHQ 1;  2NVY I;  1NP6 A;  2IZ4 A;  4BBR I;  4A3L I;  1KD1 1;  3JAM f;  3J7A 4;  3HOX I;  1VQ6 Z;  2GU2 A;  2HF1 A;  2GTH A;  4Y52 I;  4HH4 A;  3KIH A;  1VQP Z;  3CPW Y;  2PK7 A;  1P9N A;  3G6E 1;  3CC4 Z;  3IF8 A;  3GTL I;  5C3E I;  4X6A I;  3S1R I;  5FLX b;  2JA5 I;  2QA4 1;  2OOX B;  5C4X I;  1VQK 1;  5FLM I;  1QF8 A;  3I4N I;  1N8R 1;  3I4M I;  1VQ8 1;  4E2W A;  2GTI A;  2QEX 1;  2M6N A;  1VQM Z;  2P28 A;  5A2Q b;  3HKZ A;  1YJW 1;  3J80 b;  1K8A 2;  1TWH I;  1TFI A;  2RIQ A;  3S1M I;  1YJ9 Z;  3GTM S;  1TWA I;  2QLV B;  1VQP 1;  1QVG Y;  1VQ5 Z;  3S2D I;  4A3F I;  2OTL Z;  3T4N B;  1RLY A;  1M90 1;  3U50 C;  5IT9 b;  2K3R A;  3H0G I;  1QVF Z;  4BY1 I;  3S16 I;  2VUG A;  2RPR A;  2PMZ A;  3GTK I;  3GTJ I;  4QTU A;  3CCS Z;  1X3W A;  1TWC I;  3CMA Z;  1LQL A;  1VQM 1;  1Z03 A;  1M1K 2;  3HOY I;  3CCV 1;  2G2K A;  3NH4 A;  1L1O C;  1I6H I;  3CQZ I;  3G6E Z;  2LIY A;  3I56 Z;  3HOW I;  1USP B;  1KC8 2;  3PO3 I;  4E2X A;  1SFO I;  4A3D I;  1Z01 A;  2OTL 1;  3I55 Z;  3CC2 1;  2QA4 Z;  1RO4 A;  1ZB9 A;  4TNU A;  1YUK A;  3FKI I;  4NBB A;  1VQK Z;  1KQS Z;  4BXX I;  4EWC A;  1Q82 2;  3CCQ 1;  1VQN 1;  3CCL 1;  4A3C I;  3CCS 1;  3CXC Y;  2QEX Z;  4MD9 A;  5C4J I;  3BG1 B;  3VMH A;  2JR6 A;  4A3J I;  2J6A A;  1YJW Z;  2QRC B;  2NVT I;  4NH1 C;  1Q81 2;  1WII A;  3EED A;  3H3V J;  3GCF A;  1K9M 1;  4MON A;  5C44 I;  3G71 Z;  1K73 2;  2NVX I;  3I56 1;  3BG0 B;  3D6W A;  2RT9 A;  4MH4 A;  3I55 1;  2JA6 I;  2E9H A;  1YUA A;  4NBA A;  3CCE 1;  1VQL 1;  2P3Y A;  1KD1 2;  3QWU A;  3PO3 S;  2V8J A;  3RZO I;  1K83 I;  4MRI A;  2E2J I;  4NBG A;  4NBH A;  1Y1V I;  3MON A;  3HOV I;  2DE7 A;  4HGY A;  4RVF A;  3M4O I;  5D1O A;  3CCV Z;  3VB9 A;  3TE5 B;  1K8A 1;  1X3Z A;  3CME 1;  1ML8 A;  2R6M A;  3G4S Z;  3G71 1;  3GTP I;  3K7A I;  3CC2 Z;  4NFR A;  1PFT A;  4A3B I;  4A93 I;  4MD8 A;  3CCJ 1;  2W03 A;  1YJN Z;  4E2Y A;  3CCQ Z;  1VQN Z;  3OW2 Y;  4NBF A;  1Y1W I;  3CCL Z;  3GTQ I;  3GKQ A;  4BBS I;  4DK1 A;  1NUI A;  1RO2 A;  3J81 b;  5FLX f;  2OTJ Z;  1Q7Y 2;  2BJO A;  1M90 2;  4E33 A;  1W2B Z;  1Q86 2;  3CC7 Z;  2JA8 I;  1QVF Y;  1RNI A;  2PM9 A;  1Y1V S;  2E2H I;  3JAM b;  2LFU A;  2F4M A;  5AN9 F;  3G4S 1;  2YU9 I;  2WB1 A;  1R9T I;  5D1P A;  3RZD I;  5A2Q f;  3MZL B;  4NOZ A;  1VQO Z;  4NB9 A;  1S72 1;  3J80 f;  2QRE B;  1VQL Z;  3CCE Z;  2JS4 A;  1Q82 1;  1NJI 1;  1YJN 1;  5LL6 f;  2YAD A;  1YIJ Z;  3D9X A;  2HU9 A;  3S15 I;  2O53 A;  3NH5 A;  2VF1 A;  2JA7 I;  2F4O A;  4XX2 A;  3VMI A;  3HOZ I;  4CL1 A;  4QTT A;  3CXC Z;  4A3E I;  4MXU A;  3GTG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...