3M4OI

Rna polymerase ii elongation complex b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 10
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m4oI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3m4oI02
3S2HI 4BY1I 1TFIA 4NBAA 4MH4A 4BXXI 3S1QI 1I3QI 3CQZI 3HOZI 4A93I 2E2II 1R9TI 3GTOI 1K83I 3RZOI 3S17I 3PO2I 4NB9A 3I07A 2YU9I 3VMIA 3HOWI 4NBCA 1I50I 1WW9A 1X3ZA 5CM2M 3Q87A 4A3MI 3S14I 2K5RA 2R7ZI 4A3EI 2JA6I 2JS4A 1RO4A 3GKQA 3GTMI 3GCFA 3H0GI 3S2DI 4NBEA 3H3VJ 1Y1VS 3I4MI 3RZDI 3K7AI 2BJOA 1SFOI 3HOUI 3GTMS 3VMGA 4QTTA 4QTUA 5C4JI 2B63I 1QYPA 2NVXI 5C44I 2RBLA 2E2JI 4X6AI 3ESWA 3S1MI 3PO3I 3S15I 2NVTI 2NVQI 4NBGA 3M4OI 3U50C 2JA7I 4A3BI 2F4MA 2R93I 2VUMI 4BBRI 3LUSA 3VB9A 4NOZA 1USPB 5C3EI 1ZB8A 2JA8I 1N2FA 2DE7A 3FKII 1X3WA 3VMHA 4NBBA 5C4XI 2JNYA 2DE6A 5FLMI 1NUIA 3S16I 1DL6A 2JR6A 2PK7A 1VLAA 1RLYA 4Y7NI 2E2HI 3I4NI 4Y52I 3GTPI 2F4OA 1Y1WI 4NBFA 1I6HI 3GTQI 3PO3S 1L1OC 2R92I 1ZB9A 1Y1VI 4A3FI 2AKLA 1TWAI 3GTJI 2KPIA 4A3DI 4A3KI 1TWHI 1YUAA 4A3II 4NBHA 4BY7I 2DE5A 3D6WA 3EERA 4A3GI 5IP9I 3S1NI 5IP7I 4BBSI 4NB8A 2P3YA 2HF1A 1TWCI 1USPA 4NBDA 4A3CI 3M3YI 3GTKI 1TWFI 1TWGI 3GTGI 3HOXI 4A3LI 2NVYI 3S1RI 1ML8A 4A3JI 1PFTA 4XX2A 2JA5I 3HOVI 3GTLI 1WCMI 3HOYI 1LQLA 2J6AA
chains in the Genus database with same CATH superfamily
1VQ6Z 4E30A 1VQP1 3BG1B 3CXCY 2E2II 1YJN1 1KC81 1K731 4NFRA 1M901 3S17I 5D1OB 2O4HA 1Z02A 1I50I 1WW9A 2W03A 1KD11 2JS4A 1ZH1A 1VQ8Z 4EWCA 1Q861 2V45A 2BJOA 1SFOI 2PMZA 3CC4Z 2K3RA 4QTUA 5C4JI 1YI2Z 1VQ51 1QYPA 2RIQA 2LEXA 1YIT1 4DQYB 2B63I 2IZ3A 3ESWA 1M1K1 2QREB 1Y8CA 3CCJ1 3S15I 2NVTI 1KC82 3M4OI 2JA7I 2QRCB 2AYDA 1VQM1 2F4MA 3CC7Z 5C3EI 1USPB 1KD12 1Q862 2DE7A 3CME1 4MONA 2JNYA 2V8KA 2E7ZA 2DE6A 1AA6A 3S16I 2JIMA 2JR6A 3MZKB 1QXFA 2F4OA 1Y1WI 2W04A 4NBFA 1FDOA 3CD61 1WZNA 4E31A 3CXCZ 1YITZ 1VQ5Z 4S1TA 2KPIA 3CCJZ 4BY7I 2VF1A 1RQFA 3G4SZ 3CCL1 5IP9I 2VPXA 1YIJ1 1Z01A 3M3YI 1Q7Y2 1YJ91 5IT9b 2NVYI 2LFUA 1VQ7Z 2EGTA 1K8A2 4A3JI 4XX2A 2JA5I 3D9XA 3GTLI 1Q16A 1RO0A 5IT9f 3OW2Z 2QA41 3S2HI 2OOXB 1TFIA 4MH4A 2IV2X 1I3QI 1QVFY 3JAMf 3MZLB 4MD7A 3HOZI 4A93I 1R9TI 4TNUA 3I07A 2JMOA 1VQK1 4DK1A 4NBCA 1X3ZA 2QRDB 1YIJZ 2M48A 5T67A 2R7ZI 1K8A1 2JA6I 1RO4A 1VQNZ 5FLXf 3NH8A 3I4MI 1Q811 3CCM1 1YJWZ 3CCUZ 5A2Qb 3GTMS 4HH4A 1VQLZ 2R6MA 3NH4A 5LL6f 3CCRZ 4X6AI 3PO3I 2PM9A 2JIRA 1VQ9Z 4MRIA 2R93I 3LUSA 2OOYB 4NOZA 3NDIA 1YHQZ 1ZB8A 3IFUA 4NBBA 1VQN1 3CC2Z 1DL6A 4AYBA 1RNIA 3CCSZ 4Y7NI 1VQPZ 3GTPI 3G711 4CL1A 1I6HI 1S7MA 3J80f 3OW2Y 2RT9A 1L1OC 2R92I 2JIOA 3QWUA 2GTHA 2VPWA 3G6EZ 1VQ41 4A3FI 2AKLA 1QVFZ 3CCR1 4A3DI 4A3KI 2QLVB 4E32A 2VPZA 3S1NI 3IX0A 2HF1A 2Q4ZA 4NBDA 3GTKI 1N8R2 3HOXI 3S1RI 1ML8A 3TE5B 5AN9F 1LQLA 4MXUA 3CCS1 3KIHA 1NP6A 4E2YA 3CCEZ 3J7A4 2JUBA 2WAQA 3MONA 3EEDA 3G6E1 1VQ4Z 3CQZI 2V3VA 3D2LA 4MD8A 3VTNA 3CD6Z 2H85A 1SIWA 2YU9I 3CC21 1W2BY 1VQOZ 3F3FC 3CMEZ 1Q821 4A3EI 3CPWZ 3GTMI 2OZKA 4NBEA 3H3VJ 4RVDA 3RZDI 3K7AI 2ZAEB 2QKDA 1M902 3HKZA 2OTL1 1NJI2 2M6NA 4QTTA 3KIFA 1YJ9Z 1QVGY 2E2JI 2NVQI 3U50C 3JAMb 2P28A 1S721 3VB9A 5D1PA 1FDIA 2JA8I 1N2FA 1QF8A 4MD9A 5C4XI 5FLMI 1NUIA 4E33A 1VLAA 1RLYA 3I4NI 4Y52I 3J80b 1NJI1 5D1OA 2G2KA 3BG0B 5T64A 3NH5A 1JJ2Y 3GTQI 3CC41 1Q7Y1 1TWAI 3J81f 1JJ2Z 3CCMZ 1YJW1 5T6BA 3I55Z 1YUAA 3CCQZ 3D6WA 1VQKZ 3NFZA 3EERA 4A3GI 1VQ81 2QR1B 3TDHB 2RHBA 5IP7I 1VQMZ 2LIYA 2IZ4A 1YUKA 2P3YA 4HGZA 1W2BZ 3NDJA 2OTLZ 1S72Z 1TWFI 1YI21 3CPWY 1TWGI 3GTGI 2KI7B 1PFTA 1WCMI 4DGLA 2V8JA 1YHQ1 4BY1I 2GU2A 4NBAA 4BXXI 3S1QI 2V8IA 2GTIA 1QVGZ 2Q51A 1RO2A 2VUGA 3FQMA 3GTOI 1K83I 4NH1C 3RZOI 3G71Z 2E9HA 3PO2I 3I551 3CCQ1 4NB9A 3G4S1 3CCLZ 3VMIA 3HOWI 4RVFA 1M1K2 5CM2M 3Q87A 4A3MI 3S14I 2K5RA 3GKQA 2QEXZ 3GCFA 3H0GI 3S2DI 1Y1VS 2WB1A 1JWHC 3J81b 2RPRA 3FQQA 3F3PC 5FLXb 3HOUI 3I56Z 3VMGA 4E2XA 2NVXI 5C44I 2RBLA 4RVHA 3S1MI 1Q822 1WIIA 4HGYA 4NBGA 1Q812 1K9M2 3CCVZ 1VQ61 3CMAZ 2NAPA 4A3BI 1VQ71 2OTJ1 2VPYA 2VUMI 1KRLA 4BBRI 2O53A 1YJNZ 2QA4Z 2Y0SA 3FKII 1X3WA 3VMHA 3P5JB 2YADA 1X0TA 2PK7A 1WJ2A 2E2HI 3CCE1 1P9NA 3T4NB 3IR7A 3PO3S 1ZB9A 1Y1VI 3GTJI 1N8R1 1Z03A 1K9M1 1TWHI 4A3II 4NBHA 1KQSY 2DE5A 2QEX1 2JIQA 3CMA1 1K732 4RVGA 1VQO1 4BBSI 4NB8A 2OTJZ 1KQSZ 4RS4A 3CCU1 2JIPA 4E2ZA 1TWCI 1USPA 5A2Qf 3I561 4A3CI 4E2WA 4RV9A 4A3LI 1VQL1 2I3CA 3CC71 3HOVI 1VQ91 3HOYI 2HU9A 3IF8A 2J6AA 3CCV1
chains in the Genus database with same CATH topology
1VQ6Z 4E30A 1VQP1 3BG1B 3CXCY 2E2II 1YJN1 1KC81 1K731 4NFRA 1M901 3S17I 5D1OB 2O4HA 1Z02A 1I50I 1WW9A 2W03A 1KD11 2JS4A 1ZH1A 1VQ8Z 4EWCA 1Q861 2BJOA 1SFOI 2PMZA 3CC4Z 2K3RA 4QTUA 5C4JI 1YI2Z 1VQ51 1QYPA 2RIQA 1YIT1 2B63I 4DQYB 2IZ3A 3ESWA 1M1K1 2QREB 3CCJ1 3S15I 2NVTI 1KC82 3M4OI 2JA7I 2QRCB 1VQM1 2F4MA 3CC7Z 5C3EI 1USPB 1KD12 1Q862 2DE7A 3CME1 4MONA 2JNYA 2V8KA 2DE6A 3S16I 2JR6A 3MZKB 2F4OA 1Y1WI 2W04A 4NBFA 3CD61 4E31A 3CXCZ 1YITZ 1VQ5Z 4S1TA 2KPIA 3CCJZ 4BY7I 2VF1A 1RQFA 3G4SZ 3CCL1 5IP9I 1YIJ1 1Z01A 3M3YI 1Q7Y2 1YJ91 5IT9b 2NVYI 2LFUA 1VQ7Z 2EGTA 1K8A2 4A3JI 4XX2A 2JA5I 3D9XA 3GTLI 1RO0A 5IT9f 3OW2Z 2QA41 3S2HI 2OOXB 1TFIA 4MH4A 1I3QI 1QVFY 3JAMf 3MZLB 4MD7A 3HOZI 4A93I 1R9TI 4TNUA 3I07A 2JMOA 1VQK1 4DK1A 4NBCA 1X3ZA 2QRDB 1YIJZ 2M48A 5T67A 2R7ZI 1K8A1 2JA6I 1RO4A 1VQNZ 5FLXf 3NH8A 3I4MI 1Q811 3CCM1 1YJWZ 3CCUZ 5A2Qb 3GTMS 4HH4A 1VQLZ 2R6MA 3NH4A 5LL6f 3CCRZ 4X6AI 3PO3I 2PM9A 1VQ9Z 4MRIA 2R93I 3LUSA 2OOYB 4NOZA 3NDIA 1YHQZ 1ZB8A 3IFUA 4NBBA 1VQN1 3CC2Z 1DL6A 4AYBA 1RNIA 3CCSZ 4Y7NI 1VQPZ 3GTPI 3G711 4CL1A 1I6HI 1S7MA 3J80f 3OW2Y 2RT9A 1L1OC 2R92I 3QWUA 2GTHA 3G6EZ 1VQ41 4A3FI 2AKLA 1QVFZ 3CCR1 4A3DI 4A3KI 2QLVB 4E32A 3S1NI 3IX0A 2HF1A 2Q4ZA 4NBDA 3GTKI 1N8R2 3HOXI 3S1RI 1ML8A 3TE5B 5AN9F 1LQLA 4MXUA 3CCS1 3KIHA 1NP6A 4E2YA 3CCEZ 3J7A4 2JUBA 2WAQA 3MONA 3EEDA 3G6E1 1VQ4Z 3CQZI 4MD8A 3VTNA 3CD6Z 2H85A 2YU9I 3CC21 1W2BY 1VQOZ 3F3FC 3CMEZ 1Q821 4A3EI 3CPWZ 3GTMI 2OZKA 4NBEA 3H3VJ 4RVDA 3RZDI 3K7AI 2ZAEB 2QKDA 1M902 3HKZA 2OTL1 1NJI2 2M6NA 4QTTA 3KIFA 1YJ9Z 1QVGY 2E2JI 2NVQI 3U50C 3JAMb 2P28A 1S721 3VB9A 5D1PA 2JA8I 1N2FA 1QF8A 4MD9A 5C4XI 5FLMI 1NUIA 4E33A 1VLAA 1RLYA 3I4NI 4Y52I 3J80b 1NJI1 5D1OA 2G2KA 3BG0B 5T64A 3NH5A 1JJ2Y 3GTQI 3CC41 1Q7Y1 1TWAI 3J81f 1JJ2Z 3CCMZ 1YJW1 5T6BA 3I55Z 1YUAA 3CCQZ 3D6WA 1VQKZ 3NFZA 3EERA 4A3GI 1VQ81 2QR1B 3TDHB 2RHBA 5IP7I 1VQMZ 2LIYA 2IZ4A 1YUKA 2P3YA 4HGZA 1W2BZ 3NDJA 2OTLZ 1S72Z 1TWFI 1YI21 3CPWY 1TWGI 3GTGI 2KI7B 1PFTA 1WCMI 4DGLA 2V8JA 1YHQ1 4BY1I 2GU2A 4NBAA 4BXXI 3S1QI 2V8IA 2GTIA 1QVGZ 2Q51A 1RO2A 2VUGA 3FQMA 3GTOI 1K83I 4NH1C 3RZOI 3G71Z 2E9HA 3PO2I 3I551 3CCQ1 4NB9A 3G4S1 3CCLZ 3VMIA 3HOWI 4RVFA 1M1K2 5CM2M 3Q87A 4A3MI 3S14I 2K5RA 3GKQA 2QEXZ 3GCFA 3H0GI 3S2DI 1Y1VS 2WB1A 1JWHC 3J81b 2RPRA 3FQQA 3F3PC 5FLXb 3HOUI 3I56Z 3VMGA 4E2XA 2NVXI 5C44I 2RBLA 4RVHA 3S1MI 1Q822 1WIIA 4HGYA 4NBGA 1Q812 1K9M2 3CCVZ 1VQ61 3CMAZ 4A3BI 1VQ71 2OTJ1 2VUMI 1KRLA 4BBRI 2O53A 1YJNZ 2QA4Z 2Y0SA 3FKII 1X3WA 3VMHA 3P5JB 2YADA 1X0TA 2PK7A 2E2HI 3CCE1 1P9NA 3T4NB 3PO3S 1ZB9A 1Y1VI 3GTJI 1N8R1 1Z03A 1K9M1 1TWHI 4A3II 4NBHA 1KQSY 2DE5A 2QEX1 3CMA1 1K732 4RVGA 1VQO1 4BBSI 4NB8A 2OTJZ 1KQSZ 4RS4A 3CCU1 4E2ZA 1TWCI 1USPA 5A2Qf 3I561 4A3CI 4E2WA 4RV9A 4A3LI 1VQL1 2I3CA 3CC71 3HOVI 1VQ91 3HOYI 2HU9A 3IF8A 2J6AA 3CCV1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H I;  4BY1 I;  1TFI A;  4NBA A;  4MH4 A;  4BXX I;  3S1Q I;  1I3Q I;  3CQZ I;  3HOZ I;  4A93 I;  2E2I I;  1R9T I;  3GTO I;  1K83 I;  3RZO I;  3S17 I;  3PO2 I;  4NB9 A;  3I07 A;  2YU9 I;  3VMI A;  3HOW I;  4NBC A;  1I50 I;  1WW9 A;  1X3Z A;  5CM2 M;  3Q87 A;  4A3M I;  3S14 I;  2K5R A;  2R7Z I;  4A3E I;  2JA6 I;  2JS4 A;  1RO4 A;  3GKQ A;  3GTM I;  3GCF A;  3H0G I;  3S2D I;  4NBE A;  3H3V J;  1Y1V S;  3I4M I;  3RZD I;  3K7A I;  2BJO A;  1SFO I;  3HOU I;  3GTM S;  3VMG A;  4QTT A;  4QTU A;  5C4J I;  2B63 I;  1QYP A;  2NVX I;  5C44 I;  2RBL A;  2E2J I;  4X6A I;  3ESW A;  3S1M I;  3PO3 I;  3S15 I;  2NVT I;  2NVQ I;  4NBG A;  3M4O I;  3U50 C;  2JA7 I;  4A3B I;  2F4M A;  2R93 I;  2VUM I;  4BBR I;  3LUS A;  3VB9 A;  4NOZ A;  1USP B;  5C3E I;  1ZB8 A;  2JA8 I;  1N2F A;  2DE7 A;  3FKI I;  1X3W A;  3VMH A;  4NBB A;  5C4X I;  2JNY A;  2DE6 A;  5FLM I;  1NUI A;  3S16 I;  1DL6 A;  2JR6 A;  2PK7 A;  1VLA A;  1RLY A;  4Y7N I;  2E2H I;  3I4N I;  4Y52 I;  3GTP I;  2F4O A;  1Y1W I;  4NBF A;  1I6H I;  3GTQ I;  3PO3 S;  1L1O C;  2R92 I;  1ZB9 A;  1Y1V I;  4A3F I;  2AKL A;  1TWA I;  3GTJ I;  2KPI A;  4A3D I;  4A3K I;  1TWH I;  1YUA A;  4A3I I;  4NBH A;  4BY7 I;  2DE5 A;  3D6W A;  3EER A;  4A3G I;  5IP9 I;  3S1N I;  5IP7 I;  4BBS I;  4NB8 A;  2P3Y A;  2HF1 A;  1TWC I;  1USP A;  4NBD A;  4A3C I;  3M3Y I;  3GTK I;  1TWF I;  1TWG I;  3GTG I;  3HOX I;  4A3L I;  2NVY I;  3S1R I;  1ML8 A;  4A3J I;  1PFT A;  4XX2 A;  2JA5 I;  3HOV I;  3GTL I;  1WCM I;  3HOY I;  1LQL A;  2J6A A; 
#chains in the Genus database with same CATH topology
 1VQ6 Z;  4E30 A;  1VQP 1;  3BG1 B;  3CXC Y;  2E2I I;  1YJN 1;  1KC8 1;  1K73 1;  4NFR A;  1M90 1;  3S17 I;  5D1O B;  2O4H A;  1Z02 A;  1I50 I;  1WW9 A;  2W03 A;  1KD1 1;  2JS4 A;  1ZH1 A;  1VQ8 Z;  4EWC A;  1Q86 1;  2V45 A;  2BJO A;  1SFO I;  2PMZ A;  3CC4 Z;  2K3R A;  4QTU A;  5C4J I;  1YI2 Z;  1VQ5 1;  1QYP A;  2RIQ A;  2LEX A;  1YIT 1;  4DQY B;  2B63 I;  2IZ3 A;  3ESW A;  1M1K 1;  2QRE B;  1Y8C A;  3CCJ 1;  3S15 I;  2NVT I;  1KC8 2;  3M4O I;  2JA7 I;  2QRC B;  2AYD A;  1VQM 1;  2F4M A;  3CC7 Z;  5C3E I;  1USP B;  1KD1 2;  1Q86 2;  2DE7 A;  3CME 1;  4MON A;  2JNY A;  2V8K A;  2E7Z A;  2DE6 A;  1AA6 A;  3S16 I;  2JIM A;  2JR6 A;  3MZK B;  1QXF A;  2F4O A;  1Y1W I;  2W04 A;  4NBF A;  1FDO A;  3CD6 1;  1WZN A;  4E31 A;  3CXC Z;  1YIT Z;  1VQ5 Z;  4S1T A;  2KPI A;  3CCJ Z;  4BY7 I;  2VF1 A;  1RQF A;  3G4S Z;  3CCL 1;  5IP9 I;  2VPX A;  1YIJ 1;  1Z01 A;  3M3Y I;  1Q7Y 2;  1YJ9 1;  5IT9 b;  2NVY I;  2LFU A;  1VQ7 Z;  2EGT A;  1K8A 2;  4A3J I;  4XX2 A;  2JA5 I;  3D9X A;  3GTL I;  1Q16 A;  1RO0 A;  5IT9 f;  3OW2 Z;  2QA4 1;  3S2H I;  2OOX B;  1TFI A;  4MH4 A;  2IV2 X;  1I3Q I;  1QVF Y;  3JAM f;  3MZL B;  4MD7 A;  3HOZ I;  4A93 I;  1R9T I;  4TNU A;  3I07 A;  2JMO A;  1VQK 1;  4DK1 A;  4NBC A;  1X3Z A;  2QRD B;  1YIJ Z;  2M48 A;  5T67 A;  2R7Z I;  1K8A 1;  2JA6 I;  1RO4 A;  1VQN Z;  5FLX f;  3NH8 A;  3I4M I;  1Q81 1;  3CCM 1;  1YJW Z;  3CCU Z;  5A2Q b;  3GTM S;  4HH4 A;  1VQL Z;  2R6M A;  3NH4 A;  5LL6 f;  3CCR Z;  4X6A I;  3PO3 I;  2PM9 A;  2JIR A;  1VQ9 Z;  4MRI A;  2R93 I;  3LUS A;  2OOY B;  4NOZ A;  3NDI A;  1YHQ Z;  1ZB8 A;  3IFU A;  4NBB A;  1VQN 1;  3CC2 Z;  1DL6 A;  4AYB A;  1RNI A;  3CCS Z;  4Y7N I;  1VQP Z;  3GTP I;  3G71 1;  4CL1 A;  1I6H I;  1S7M A;  3J80 f;  3OW2 Y;  2RT9 A;  1L1O C;  2R92 I;  2JIO A;  3QWU A;  2GTH A;  2VPW A;  3G6E Z;  1VQ4 1;  4A3F I;  2AKL A;  1QVF Z;  3CCR 1;  4A3D I;  4A3K I;  2QLV B;  4E32 A;  2VPZ A;  3S1N I;  3IX0 A;  2HF1 A;  2Q4Z A;  4NBD A;  3GTK I;  1N8R 2;  3HOX I;  3S1R I;  1ML8 A;  3TE5 B;  5AN9 F;  1LQL A;  4MXU A;  3CCS 1;  3KIH A;  1NP6 A;  4E2Y A;  3CCE Z;  3J7A 4;  2JUB A;  2WAQ A;  3MON A;  3EED A;  3G6E 1;  1VQ4 Z;  3CQZ I;  2V3V A;  3D2L A;  4MD8 A;  3VTN A;  3CD6 Z;  2H85 A;  1SIW A;  2YU9 I;  3CC2 1;  1W2B Y;  1VQO Z;  3F3F C;  3CME Z;  1Q82 1;  4A3E I;  3CPW Z;  3GTM I;  2OZK A;  4NBE A;  3H3V J;  4RVD A;  3RZD I;  3K7A I;  2ZAE B;  2QKD A;  1M90 2;  3HKZ A;  2OTL 1;  1NJI 2;  2M6N A;  4QTT A;  3KIF A;  1YJ9 Z;  1QVG Y;  2E2J I;  2NVQ I;  3U50 C;  3JAM b;  2P28 A;  1S72 1;  3VB9 A;  5D1P A;  1FDI A;  2JA8 I;  1N2F A;  1QF8 A;  4MD9 A;  5C4X I;  5FLM I;  1NUI A;  4E33 A;  1VLA A;  1RLY A;  3I4N I;  4Y52 I;  3J80 b;  1NJI 1;  5D1O A;  2G2K A;  3BG0 B;  5T64 A;  3NH5 A;  1JJ2 Y;  3GTQ I;  3CC4 1;  1Q7Y 1;  1TWA I;  3J81 f;  1JJ2 Z;  3CCM Z;  1YJW 1;  5T6B A;  3I55 Z;  1YUA A;  3CCQ Z;  3D6W A;  1VQK Z;  3NFZ A;  3EER A;  4A3G I;  1VQ8 1;  2QR1 B;  3TDH B;  2RHB A;  5IP7 I;  1VQM Z;  2LIY A;  2IZ4 A;  1YUK A;  2P3Y A;  4HGZ A;  1W2B Z;  3NDJ A;  2OTL Z;  1S72 Z;  1TWF I;  1YI2 1;  3CPW Y;  1TWG I;  3GTG I;  2KI7 B;  1PFT A;  1WCM I;  4DGL A;  2V8J A;  1YHQ 1;  4BY1 I;  2GU2 A;  4NBA A;  4BXX I;  3S1Q I;  2V8I A;  2GTI A;  1QVG Z;  2Q51 A;  1RO2 A;  2VUG A;  3FQM A;  3GTO I;  1K83 I;  4NH1 C;  3RZO I;  3G71 Z;  2E9H A;  3PO2 I;  3I55 1;  3CCQ 1;  4NB9 A;  3G4S 1;  3CCL Z;  3VMI A;  3HOW I;  4RVF A;  1M1K 2;  5CM2 M;  3Q87 A;  4A3M I;  3S14 I;  2K5R A;  3GKQ A;  2QEX Z;  3GCF A;  3H0G I;  3S2D I;  1Y1V S;  2WB1 A;  1JWH C;  3J81 b;  2RPR A;  3FQQ A;  3F3P C;  5FLX b;  3HOU I;  3I56 Z;  3VMG A;  4E2X A;  2NVX I;  5C44 I;  2RBL A;  4RVH A;  3S1M I;  1Q82 2;  1WII A;  4HGY A;  4NBG A;  1Q81 2;  1K9M 2;  3CCV Z;  1VQ6 1;  3CMA Z;  2NAP A;  4A3B I;  1VQ7 1;  2OTJ 1;  2VPY A;  2VUM I;  1KRL A;  4BBR I;  2O53 A;  1YJN Z;  2QA4 Z;  2Y0S A;  3FKI I;  1X3W A;  3VMH A;  3P5J B;  2YAD A;  1X0T A;  2PK7 A;  1WJ2 A;  2E2H I;  3CCE 1;  1P9N A;  3T4N B;  3IR7 A;  3PO3 S;  1ZB9 A;  1Y1V I;  3GTJ I;  1N8R 1;  1Z03 A;  1K9M 1;  1TWH I;  4A3I I;  4NBH A;  1KQS Y;  2DE5 A;  2QEX 1;  2JIQ A;  3CMA 1;  1K73 2;  4RVG A;  1VQO 1;  4BBS I;  4NB8 A;  2OTJ Z;  1KQS Z;  4RS4 A;  3CCU 1;  2JIP A;  4E2Z A;  1TWC I;  1USP A;  5A2Q f;  3I56 1;  4A3C I;  4E2W A;  4RV9 A;  4A3L I;  1VQL 1;  2I3C A;  3CC7 1;  3HOV I;  1VQ9 1;  3HOY I;  2HU9 A;  3IF8 A;  2J6A A;  3CCV 1; 
#chains in the Genus database with same CATH homology
 1VQ6 Z;  4E30 A;  1VQP 1;  3BG1 B;  3CXC Y;  2E2I I;  1YJN 1;  1KC8 1;  1K73 1;  4NFR A;  1M90 1;  3S17 I;  5D1O B;  2O4H A;  1Z02 A;  1I50 I;  1WW9 A;  2W03 A;  1KD1 1;  2JS4 A;  1ZH1 A;  1VQ8 Z;  4EWC A;  1Q86 1;  2BJO A;  1SFO I;  2PMZ A;  3CC4 Z;  2K3R A;  4QTU A;  5C4J I;  1YI2 Z;  1VQ5 1;  1QYP A;  2RIQ A;  1YIT 1;  2B63 I;  4DQY B;  2IZ3 A;  3ESW A;  1M1K 1;  2QRE B;  3CCJ 1;  3S15 I;  2NVT I;  1KC8 2;  3M4O I;  2JA7 I;  2QRC B;  1VQM 1;  2F4M A;  3CC7 Z;  5C3E I;  1USP B;  1KD1 2;  1Q86 2;  2DE7 A;  3CME 1;  4MON A;  2JNY A;  2V8K A;  2DE6 A;  3S16 I;  2JR6 A;  3MZK B;  2F4O A;  1Y1W I;  2W04 A;  4NBF A;  3CD6 1;  4E31 A;  3CXC Z;  1YIT Z;  1VQ5 Z;  4S1T A;  2KPI A;  3CCJ Z;  4BY7 I;  2VF1 A;  1RQF A;  3G4S Z;  3CCL 1;  5IP9 I;  1YIJ 1;  1Z01 A;  3M3Y I;  1Q7Y 2;  1YJ9 1;  5IT9 b;  2NVY I;  2LFU A;  1VQ7 Z;  2EGT A;  1K8A 2;  4A3J I;  4XX2 A;  2JA5 I;  3D9X A;  3GTL I;  1RO0 A;  5IT9 f;  3OW2 Z;  2QA4 1;  3S2H I;  2OOX B;  1TFI A;  4MH4 A;  1I3Q I;  1QVF Y;  3JAM f;  3MZL B;  4MD7 A;  3HOZ I;  4A93 I;  1R9T I;  4TNU A;  3I07 A;  2JMO A;  1VQK 1;  4DK1 A;  4NBC A;  1X3Z A;  2QRD B;  1YIJ Z;  2M48 A;  5T67 A;  2R7Z I;  1K8A 1;  2JA6 I;  1RO4 A;  1VQN Z;  5FLX f;  3NH8 A;  3I4M I;  1Q81 1;  3CCM 1;  1YJW Z;  3CCU Z;  5A2Q b;  3GTM S;  4HH4 A;  1VQL Z;  2R6M A;  3NH4 A;  5LL6 f;  3CCR Z;  4X6A I;  3PO3 I;  2PM9 A;  1VQ9 Z;  4MRI A;  2R93 I;  3LUS A;  2OOY B;  4NOZ A;  3NDI A;  1YHQ Z;  1ZB8 A;  3IFU A;  4NBB A;  1VQN 1;  3CC2 Z;  1DL6 A;  4AYB A;  1RNI A;  3CCS Z;  4Y7N I;  1VQP Z;  3GTP I;  3G71 1;  4CL1 A;  1I6H I;  1S7M A;  3J80 f;  3OW2 Y;  2RT9 A;  1L1O C;  2R92 I;  3QWU A;  2GTH A;  3G6E Z;  1VQ4 1;  4A3F I;  2AKL A;  1QVF Z;  3CCR 1;  4A3D I;  4A3K I;  2QLV B;  4E32 A;  3S1N I;  3IX0 A;  2HF1 A;  2Q4Z A;  4NBD A;  3GTK I;  1N8R 2;  3HOX I;  3S1R I;  1ML8 A;  3TE5 B;  5AN9 F;  1LQL A;  4MXU A;  3CCS 1;  3KIH A;  1NP6 A;  4E2Y A;  3CCE Z;  3J7A 4;  2JUB A;  2WAQ A;  3MON A;  3EED A;  3G6E 1;  1VQ4 Z;  3CQZ I;  4MD8 A;  3VTN A;  3CD6 Z;  2H85 A;  2YU9 I;  3CC2 1;  1W2B Y;  1VQO Z;  3F3F C;  3CME Z;  1Q82 1;  4A3E I;  3CPW Z;  3GTM I;  2OZK A;  4NBE A;  3H3V J;  4RVD A;  3RZD I;  3K7A I;  2ZAE B;  2QKD A;  1M90 2;  3HKZ A;  2OTL 1;  1NJI 2;  2M6N A;  4QTT A;  3KIF A;  1YJ9 Z;  1QVG Y;  2E2J I;  2NVQ I;  3U50 C;  3JAM b;  2P28 A;  1S72 1;  3VB9 A;  5D1P A;  2JA8 I;  1N2F A;  1QF8 A;  4MD9 A;  5C4X I;  5FLM I;  1NUI A;  4E33 A;  1VLA A;  1RLY A;  3I4N I;  4Y52 I;  3J80 b;  1NJI 1;  5D1O A;  2G2K A;  3BG0 B;  5T64 A;  3NH5 A;  1JJ2 Y;  3GTQ I;  3CC4 1;  1Q7Y 1;  1TWA I;  3J81 f;  1JJ2 Z;  3CCM Z;  1YJW 1;  5T6B A;  3I55 Z;  1YUA A;  3CCQ Z;  3D6W A;  1VQK Z;  3NFZ A;  3EER A;  4A3G I;  1VQ8 1;  2QR1 B;  3TDH B;  2RHB A;  5IP7 I;  1VQM Z;  2LIY A;  2IZ4 A;  1YUK A;  2P3Y A;  4HGZ A;  1W2B Z;  3NDJ A;  2OTL Z;  1S72 Z;  1TWF I;  1YI2 1;  3CPW Y;  1TWG I;  3GTG I;  2KI7 B;  1PFT A;  1WCM I;  4DGL A;  2V8J A;  1YHQ 1;  4BY1 I;  2GU2 A;  4NBA A;  4BXX I;  3S1Q I;  2V8I A;  2GTI A;  1QVG Z;  2Q51 A;  1RO2 A;  2VUG A;  3FQM A;  3GTO I;  1K83 I;  4NH1 C;  3RZO I;  3G71 Z;  2E9H A;  3PO2 I;  3I55 1;  3CCQ 1;  4NB9 A;  3G4S 1;  3CCL Z;  3VMI A;  3HOW I;  4RVF A;  1M1K 2;  5CM2 M;  3Q87 A;  4A3M I;  3S14 I;  2K5R A;  3GKQ A;  2QEX Z;  3GCF A;  3H0G I;  3S2D I;  1Y1V S;  2WB1 A;  1JWH C;  3J81 b;  2RPR A;  3FQQ A;  3F3P C;  5FLX b;  3HOU I;  3I56 Z;  3VMG A;  4E2X A;  2NVX I;  5C44 I;  2RBL A;  4RVH A;  3S1M I;  1Q82 2;  1WII A;  4HGY A;  4NBG A;  1Q81 2;  1K9M 2;  3CCV Z;  1VQ6 1;  3CMA Z;  4A3B I;  1VQ7 1;  2OTJ 1;  2VUM I;  1KRL A;  4BBR I;  2O53 A;  1YJN Z;  2QA4 Z;  2Y0S A;  3FKI I;  1X3W A;  3VMH A;  3P5J B;  2YAD A;  1X0T A;  2PK7 A;  2E2H I;  3CCE 1;  1P9N A;  3T4N B;  3PO3 S;  1ZB9 A;  1Y1V I;  3GTJ I;  1N8R 1;  1Z03 A;  1K9M 1;  1TWH I;  4A3I I;  4NBH A;  1KQS Y;  2DE5 A;  2QEX 1;  3CMA 1;  1K73 2;  4RVG A;  1VQO 1;  4BBS I;  4NB8 A;  2OTJ Z;  1KQS Z;  4RS4 A;  3CCU 1;  4E2Z A;  1TWC I;  1USP A;  5A2Q f;  3I56 1;  4A3C I;  4E2W A;  4RV9 A;  4A3L I;  1VQL 1;  2I3C A;  3CC7 1;  3HOV I;  1VQ9 1;  3HOY I;  2HU9 A;  3IF8 A;  2J6A A;  3CCV 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...