1KC82

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8200
1KQSZ 2QEX1 1VQ7Z 3G711 1YJ91 1YJWZ 2OTL1 1NJI2 3CC4Z 3CMEZ 1VQNZ 1M901 1VQ51 1VQ71 1KD11 1M1K1 3CPWY 3CPWZ 1VQ6Z 1VQ81 1Q7Y2 3CC41 3CME1 1YJNZ 1VQP1 1JJ2Y 1VQN1 1Q812 3G6EZ 1VQMZ 1QVFY 1QVFZ 3I55Z 1VQOZ 1KQSY 2OTJZ 1W2BY 1W2BZ 1Q862 3G6E1 1YIJZ 3CC2Z 3I561 1NJI1 3CC71 3CCUZ 1VQ4Z 3I551 1K9M2 1VQO1 2OTJ1 3CD6Z 1YIJ1 1YJW1 3OW2Z 1Q7Y1 1Q811 1KC82 3CCVZ 3CD61 1QVGZ 3CCQZ 3CXCZ 1VQ61 1YI2Z 1YJN1 1S72Z 1YHQZ 3CMAZ 1Q861 1VQKZ 1K732 3CCRZ 1Q822 1VQM1 3CCEZ 3CCSZ 1N8R1 1K9M1 1YI21 1N8R2 1YHQ1 3CCLZ 1YITZ 3CMA1 1VQK1 3CCR1 3CC21 2QEXZ 3OW2Y 3CCE1 3CCS1 3CCU1 1VQLZ 1VQ41 1KC81 3CCJZ 2OTLZ 3CCL1 1YIT1 1QVGY 3CCMZ 3CXCY 1VQ5Z 1VQL1 3CCJ1 1VQ9Z 1K731 3CCV1 1VQ8Z 1K8A1 1VQPZ 3CCQ1 2QA4Z 1Q821 1K8A2 3CCM1 1M902 1KD12 1S721 1VQ91 1M1K2 3G4SZ 2QA41 1JJ2Z 3G71Z 1YJ9Z 3I56Z 3CC7Z 3G4S1
chains in the Genus database with same CATH superfamily
1X0TA 1KQSZ 5FLXf 4Y52I 1ZB9A 2LFUA 2R6MA 3I07A 3VMHA 4MH4A 3G711 4MD9A 2GTIA 2LEXA 1QXFA 2GU2A 1I6HI 3J7A4 1RNIA 5D1PA 4AYBA 1ZB8A 1YJNZ 1JJ2Y 1ZH1A 2V45A 4MXUA 3G6EZ 1VQMZ 5D1OB 1Z03A 1KQSY 2E2HI 5LL6f 3G6E1 1YIJZ 3RZOI 3CC71 2BJOA 3CCUZ 1VQ4Z 2B63I 2VPXA 3CD6Z 2PMZA 4RVFA 2R93I 4BY7I 4RVHA 2IZ3A 2VUMI 1YIJ1 4NBFA 2VPZA 2F4MA 2JS4A 3CD61 2KPIA 4XX2A 3CCQZ 1X3WA 1P9NA 4A3FI 1SFOI 3TDHB 2RBLA 1K732 3CCRZ 1JWHC 3S1RI 2NVYI 3VMIA 5IT9b 3CCEZ 2NVXI 1Y1VS 5AN9F 1X3ZA 4BBRI 1Y8CA 4E2YA 1TWAI 3CCR1 2NAPA 4BY1I 2QEXZ 3NDJA 3HKZA 3CCE1 2JA5I 4A3BI 2M48A 1WJ2A 4A3CI 4RV9A 5A2Qb 3GTQI 3CCMZ 2QRDB 3GTJI 1VQ9Z 1K731 3GTMI 2IZ4A 5C4XI 1VQ8Z 1WIIA 2QA4Z 3GTMS 4CL1A 3D9XA 2W03A 3CCM1 1M902 1TFIA 4DGLA 1S721 1VQ91 5D1OA 3GTPI 4X6AI 2QA41 3EERA 2JA6I 3HOYI 4NOZA 3U50C 3KIFA 2VF1A 1YJWZ 2JIMA 3HOWI 2QREB 2QLVB 2DE7A 1M901 4NFRA 4A3DI 2PK7A 2PM9A 3FKII 1VQ6Z 5IP9I 3J80b 2JA8I 1Q812 1QVFY 1FDIA 1NP6A 1TWHI 1USPB 1TWFI 4NBAA 5IP7I 3I561 2JIQA 4A3JI 2ZAEB 4HGZA 2NVTI 3S14I 2WAQA 2YU9I 2JUBA 3FQMA 3IF8A 2RIQA 3GKQA 1Q811 3HOZI 2HU9A 3CXCZ 4MRIA 2LIYA 1YJN1 3D6WA 3P5JB 2JMOA 1Q822 1VQM1 1N8R1 3S2HI 1Y1WI 3F3PC 4E2WA 3CCLZ 2YADA 1Z02A 3JAMb 4A3II 4E32A 1ML8A 4A3LI 2OZKA 3CCU1 1VQLZ 4BXXI 2R92I 1VQ41 3GTLI 3CCJZ 2OTLZ 2VUGA 3CCL1 3GTGI 4NBDA 3CXCY 1TWGI 2V8IA 1QF8A 1VQ5Z 3H3VJ 4E2XA 1VQL1 4NB9A 3CCJ1 1FDOA 1VQPZ 3CCQ1 2OOXB 2RHBA 1Q821 2JIOA 1DL6A 5T67A 3S1QI 2Q4ZA 3HOXI 2P3YA 3D2LA 2H85A 3M3YI 2AYDA 1Q16A 1QYPA 2W04A 2VPYA 3VMGA 2JNYA 3IR7A 1L1OC 3ESWA 3BG0B 1RQFA 3VB9A 5FLXb 2QEX1 1VQ7Z 3NH5A 2DE5A 1TWCI 3CMEZ 3S15I 1VQNZ 1VQ71 3NDIA 3CPWY 2O4HA 2P28A 1WW9A 4A3MI 3FQQA 1VQ81 3K7AI 1Q7Y2 3CME1 1VQN1 4MD8A 1Z01A 3GTKI 1QVFZ 3J81b 3I55Z 1YUKA 3KIHA 3M4OI 3IX0A 1W2BY 1Q862 2E2JI 2Q51A 3CC2Z 3TE5B 3I551 4NB8A 1K9M2 1I3QI 2IV2X 2QRCB 1YJW1 1Q7Y1 2G2KA 4EWCA 3CCVZ 3MZLB 2E7ZA 1YUAA 1VQ61 1YI2Z 2K3RA 2VPWA 1Q861 2NVQI 5IT9f 2V3VA 4NBEA 1K9M1 3CCSZ 2JIRA 3NH4A 3EEDA 1YI21 1N8R2 4S1TA 4Y7NI 4HGYA 3PO3I 2JR6A 3CCS1 5A2Qf 4BBSI 3BG1B 1K83I 4NBGA 2JIPA 3H0GI 2Y0SA 3S16I 4A3KI 1K8A1 4E33A 4E31A 3S2DI 2DE6A 4TNUA 4RS4A 1KD12 4RVDA 1M1K2 2F4OA 3G4SZ 2WB1A 2V8KA 5C4JI 1LQLA 3J81f 1RLYA 2GTHA 2RT9A 1YJ9Z 3CC7Z 2QR1B 3G4S1 2I3CA 5C3EI 2KI7B 4MONA 2K5RA 1NUIA 4QTTA 3HOUI 1WZNA 1YJ91 2OTL1 4A3GI 3NH8A 1WCMI 4NH1C 1NJI2 3CC4Z 4A93I 1S7MA 5T64A 1VQ51 1KD11 1M1K1 3MONA 3CQZI 3CPWZ 3T4NB 3J80f 3CC41 1USPA 4MD7A 1VQP1 1RO2A 4DQYB 2M6NA 3GCFA 4DK1A 4NBBA 1VQOZ 2HF1A 2OTJZ 1W2BZ 2V8JA 1Y1VI 2O53A 4A3EI 1NJI1 1I50I 2QKDA 1VQO1 3S17I 2OTJ1 3MZKB 5CM2M 1RO4A 3VTNA 3OW2Z 1SIWA 3NFZA 2R7ZI 1KC82 3I4MI 3HOVI 1QVGZ 2E2II 4E2ZA 2E9HA 2OOYB 4NBCA 3IFUA 1KRLA 1S72Z 3LUSA 4E30A 3CMAZ 1YHQZ 1VQKZ 4RVGA 3PO2I 3Q87A 1YHQ1 3JAMf 1YITZ 3CMA1 1VQK1 3F3FC 2JA7I 2J6AA 3GTOI 5C44I 3CC21 3OW2Y 1VLAA 1KC81 5FLMI 1N2FA 1YIT1 1QVGY 2EGTA 2AKLA 1AA6A 1R9TI 5T6BA 1PFTA 3S1NI 3CCV1 1RO0A 1K8A2 2RPRA 4QTUA 3QWUA 4HH4A 1JJ2Z 4NBHA 3S1MI 3I4NI 3G71Z 3RZDI 3I56Z 3PO3S
chains in the Genus database with same CATH topology
1X0TA 1KQSZ 5FLXf 4Y52I 1ZB9A 2LFUA 2R6MA 3I07A 3VMHA 4MH4A 3G711 4MD9A 2GTIA 2GU2A 1I6HI 3J7A4 1RNIA 5D1PA 4AYBA 1ZB8A 1YJNZ 1JJ2Y 1ZH1A 4MXUA 3G6EZ 1VQMZ 5D1OB 1Z03A 1KQSY 2E2HI 5LL6f 3G6E1 1YIJZ 3RZOI 3CC71 2BJOA 3CCUZ 1VQ4Z 2B63I 3CD6Z 2PMZA 4RVFA 2R93I 4BY7I 4RVHA 2IZ3A 2VUMI 1YIJ1 4NBFA 2F4MA 2JS4A 3CD61 2KPIA 4XX2A 3CCQZ 1X3WA 1P9NA 4A3FI 1SFOI 3TDHB 2RBLA 1K732 3CCRZ 1JWHC 3S1RI 2NVYI 3VMIA 5IT9b 3CCEZ 2NVXI 1Y1VS 5AN9F 1X3ZA 4BBRI 4E2YA 1TWAI 3CCR1 4BY1I 2QEXZ 3NDJA 3HKZA 3CCE1 2JA5I 4A3BI 2M48A 4A3CI 4RV9A 5A2Qb 3GTQI 3CCMZ 2QRDB 3GTJI 1VQ9Z 1K731 3GTMI 2IZ4A 5C4XI 1VQ8Z 1WIIA 2QA4Z 3GTMS 4CL1A 3D9XA 2W03A 3CCM1 1M902 1TFIA 4DGLA 1S721 1VQ91 5D1OA 3GTPI 4X6AI 2QA41 3EERA 2JA6I 3HOYI 4NOZA 3U50C 3KIFA 2VF1A 1YJWZ 3HOWI 2QREB 2QLVB 2DE7A 1M901 4NFRA 4A3DI 2PK7A 2PM9A 3FKII 1VQ6Z 5IP9I 3J80b 2JA8I 1Q812 1QVFY 1NP6A 1TWHI 1USPB 1TWFI 4NBAA 5IP7I 3I561 4A3JI 2ZAEB 4HGZA 2NVTI 3S14I 2WAQA 2YU9I 2JUBA 3FQMA 3IF8A 2RIQA 3GKQA 1Q811 3HOZI 2HU9A 3CXCZ 4MRIA 2LIYA 1YJN1 3D6WA 3P5JB 2JMOA 1Q822 1VQM1 1N8R1 3S2HI 1Y1WI 3F3PC 4E2WA 3CCLZ 2YADA 1Z02A 3JAMb 4A3II 4E32A 1ML8A 4A3LI 2OZKA 3CCU1 1VQLZ 4BXXI 2R92I 1VQ41 3GTLI 3CCJZ 2OTLZ 2VUGA 3CCL1 3GTGI 4NBDA 3CXCY 1TWGI 2V8IA 1QF8A 1VQ5Z 3H3VJ 4E2XA 1VQL1 4NB9A 3CCJ1 1VQPZ 3CCQ1 2OOXB 2RHBA 1Q821 1DL6A 5T67A 3S1QI 2Q4ZA 3HOXI 2P3YA 2H85A 3M3YI 1QYPA 2W04A 3VMGA 2JNYA 1L1OC 3ESWA 3BG0B 1RQFA 3VB9A 5FLXb 2QEX1 1VQ7Z 3NH5A 2DE5A 1TWCI 3CMEZ 3S15I 1VQNZ 1VQ71 3NDIA 3CPWY 2O4HA 2P28A 1WW9A 4A3MI 3FQQA 1VQ81 3K7AI 1Q7Y2 3CME1 1VQN1 4MD8A 1Z01A 3GTKI 1QVFZ 3J81b 3I55Z 1YUKA 3KIHA 3M4OI 3IX0A 1W2BY 1Q862 2E2JI 2Q51A 3CC2Z 3TE5B 3I551 4NB8A 1K9M2 1I3QI 2QRCB 1YJW1 1Q7Y1 2G2KA 4EWCA 3CCVZ 3MZLB 1YUAA 1VQ61 1YI2Z 2K3RA 1Q861 2NVQI 5IT9f 4NBEA 1K9M1 3CCSZ 3NH4A 3EEDA 1YI21 1N8R2 4S1TA 4Y7NI 4HGYA 3PO3I 2JR6A 3CCS1 5A2Qf 4BBSI 3BG1B 1K83I 4NBGA 3H0GI 2Y0SA 3S16I 4A3KI 1K8A1 4E33A 4E31A 3S2DI 2DE6A 4TNUA 4RS4A 1KD12 4RVDA 1M1K2 2F4OA 3G4SZ 2WB1A 2V8KA 5C4JI 1LQLA 3J81f 1RLYA 2GTHA 2RT9A 1YJ9Z 3CC7Z 2QR1B 3G4S1 2I3CA 5C3EI 2KI7B 4MONA 2K5RA 1NUIA 4QTTA 3HOUI 1YJ91 2OTL1 4A3GI 3NH8A 1WCMI 4NH1C 1NJI2 3CC4Z 4A93I 1S7MA 5T64A 1VQ51 1KD11 1M1K1 3MONA 3CQZI 3CPWZ 3T4NB 3J80f 3CC41 1USPA 4MD7A 1VQP1 1RO2A 4DQYB 2M6NA 3GCFA 4DK1A 4NBBA 1VQOZ 2HF1A 2OTJZ 1W2BZ 2V8JA 1Y1VI 2O53A 4A3EI 1NJI1 1I50I 2QKDA 1VQO1 3S17I 2OTJ1 3MZKB 5CM2M 1RO4A 3VTNA 3OW2Z 3NFZA 2R7ZI 1KC82 3I4MI 3HOVI 1QVGZ 2E2II 4E2ZA 2E9HA 2OOYB 4NBCA 3IFUA 1KRLA 1S72Z 3LUSA 4E30A 3CMAZ 1YHQZ 1VQKZ 4RVGA 3PO2I 3Q87A 1YHQ1 3JAMf 1YITZ 3CMA1 1VQK1 3F3FC 2JA7I 2J6AA 3GTOI 5C44I 3CC21 3OW2Y 1VLAA 1KC81 5FLMI 1N2FA 1YIT1 1QVGY 2EGTA 2AKLA 1R9TI 5T6BA 1PFTA 3S1NI 3CCV1 1RO0A 1K8A2 2RPRA 4QTUA 3QWUA 4HH4A 1JJ2Z 4NBHA 3S1MI 3I4NI 3G71Z 3RZDI 3I56Z 3PO3S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS Z;  2QEX 1;  1VQ7 Z;  3G71 1;  1YJ9 1;  1YJW Z;  2OTL 1;  1NJI 2;  3CC4 Z;  3CME Z;  1VQN Z;  1M90 1;  1VQ5 1;  1VQ7 1;  1KD1 1;  1M1K 1;  3CPW Y;  3CPW Z;  1VQ6 Z;  1VQ8 1;  1Q7Y 2;  3CC4 1;  3CME 1;  1YJN Z;  1VQP 1;  1JJ2 Y;  1VQN 1;  1Q81 2;  3G6E Z;  1VQM Z;  1QVF Y;  1QVF Z;  3I55 Z;  1VQO Z;  1KQS Y;  2OTJ Z;  1W2B Y;  1W2B Z;  1Q86 2;  3G6E 1;  1YIJ Z;  3CC2 Z;  3I56 1;  1NJI 1;  3CC7 1;  3CCU Z;  1VQ4 Z;  3I55 1;  1K9M 2;  1VQO 1;  2OTJ 1;  3CD6 Z;  1YIJ 1;  1YJW 1;  3OW2 Z;  1Q7Y 1;  1Q81 1;  1KC8 2;  3CCV Z;  3CD6 1;  1QVG Z;  3CCQ Z;  3CXC Z;  1VQ6 1;  1YI2 Z;  1YJN 1;  1S72 Z;  1YHQ Z;  3CMA Z;  1Q86 1;  1VQK Z;  1K73 2;  3CCR Z;  1Q82 2;  1VQM 1;  3CCE Z;  3CCS Z;  1N8R 1;  1K9M 1;  1YI2 1;  1N8R 2;  1YHQ 1;  3CCL Z;  1YIT Z;  3CMA 1;  1VQK 1;  3CCR 1;  3CC2 1;  2QEX Z;  3OW2 Y;  3CCE 1;  3CCS 1;  3CCU 1;  1VQL Z;  1VQ4 1;  1KC8 1;  3CCJ Z;  2OTL Z;  3CCL 1;  1YIT 1;  1QVG Y;  3CCM Z;  3CXC Y;  1VQ5 Z;  1VQL 1;  3CCJ 1;  1VQ9 Z;  1K73 1;  3CCV 1;  1VQ8 Z;  1K8A 1;  1VQP Z;  3CCQ 1;  2QA4 Z;  1Q82 1;  1K8A 2;  3CCM 1;  1M90 2;  1KD1 2;  1S72 1;  1VQ9 1;  1M1K 2;  3G4S Z;  2QA4 1;  1JJ2 Z;  3G71 Z;  1YJ9 Z;  3I56 Z;  3CC7 Z;  3G4S 1; 
#chains in the Genus database with same CATH topology
 1X0T A;  1KQS Z;  5FLX f;  4Y52 I;  1ZB9 A;  2LFU A;  2R6M A;  3I07 A;  3VMH A;  4MH4 A;  3G71 1;  4MD9 A;  2GTI A;  2LEX A;  1QXF A;  2GU2 A;  1I6H I;  3J7A 4;  1RNI A;  5D1P A;  4AYB A;  1ZB8 A;  1YJN Z;  1JJ2 Y;  1ZH1 A;  2V45 A;  4MXU A;  3G6E Z;  1VQM Z;  5D1O B;  1Z03 A;  1KQS Y;  2E2H I;  5LL6 f;  3G6E 1;  1YIJ Z;  3RZO I;  3CC7 1;  2BJO A;  3CCU Z;  1VQ4 Z;  2B63 I;  2VPX A;  3CD6 Z;  2PMZ A;  4RVF A;  2R93 I;  4BY7 I;  4RVH A;  2IZ3 A;  2VUM I;  1YIJ 1;  4NBF A;  2VPZ A;  2F4M A;  2JS4 A;  3CD6 1;  2KPI A;  4XX2 A;  3CCQ Z;  1X3W A;  1P9N A;  4A3F I;  1SFO I;  3TDH B;  2RBL A;  1K73 2;  3CCR Z;  1JWH C;  3S1R I;  2NVY I;  3VMI A;  5IT9 b;  3CCE Z;  2NVX I;  1Y1V S;  5AN9 F;  1X3Z A;  4BBR I;  1Y8C A;  4E2Y A;  1TWA I;  3CCR 1;  2NAP A;  4BY1 I;  2QEX Z;  3NDJ A;  3HKZ A;  3CCE 1;  2JA5 I;  4A3B I;  2M48 A;  1WJ2 A;  4A3C I;  4RV9 A;  5A2Q b;  3GTQ I;  3CCM Z;  2QRD B;  3GTJ I;  1VQ9 Z;  1K73 1;  3GTM I;  2IZ4 A;  5C4X I;  1VQ8 Z;  1WII A;  2QA4 Z;  3GTM S;  4CL1 A;  3D9X A;  2W03 A;  3CCM 1;  1M90 2;  1TFI A;  4DGL A;  1S72 1;  1VQ9 1;  5D1O A;  3GTP I;  4X6A I;  2QA4 1;  3EER A;  2JA6 I;  3HOY I;  4NOZ A;  3U50 C;  3KIF A;  2VF1 A;  1YJW Z;  2JIM A;  3HOW I;  2QRE B;  2QLV B;  2DE7 A;  1M90 1;  4NFR A;  4A3D I;  2PK7 A;  2PM9 A;  3FKI I;  1VQ6 Z;  5IP9 I;  3J80 b;  2JA8 I;  1Q81 2;  1QVF Y;  1FDI A;  1NP6 A;  1TWH I;  1USP B;  1TWF I;  4NBA A;  5IP7 I;  3I56 1;  2JIQ A;  4A3J I;  2ZAE B;  4HGZ A;  2NVT I;  3S14 I;  2WAQ A;  2YU9 I;  2JUB A;  3FQM A;  3IF8 A;  2RIQ A;  3GKQ A;  1Q81 1;  3HOZ I;  2HU9 A;  3CXC Z;  4MRI A;  2LIY A;  1YJN 1;  3D6W A;  3P5J B;  2JMO A;  1Q82 2;  1VQM 1;  1N8R 1;  3S2H I;  1Y1W I;  3F3P C;  4E2W A;  3CCL Z;  2YAD A;  1Z02 A;  3JAM b;  4A3I I;  4E32 A;  1ML8 A;  4A3L I;  2OZK A;  3CCU 1;  1VQL Z;  4BXX I;  2R92 I;  1VQ4 1;  3GTL I;  3CCJ Z;  2OTL Z;  2VUG A;  3CCL 1;  3GTG I;  4NBD A;  3CXC Y;  1TWG I;  2V8I A;  1QF8 A;  1VQ5 Z;  3H3V J;  4E2X A;  1VQL 1;  4NB9 A;  3CCJ 1;  1FDO A;  1VQP Z;  3CCQ 1;  2OOX B;  2RHB A;  1Q82 1;  2JIO A;  1DL6 A;  5T67 A;  3S1Q I;  2Q4Z A;  3HOX I;  2P3Y A;  3D2L A;  2H85 A;  3M3Y I;  2AYD A;  1Q16 A;  1QYP A;  2W04 A;  2VPY A;  3VMG A;  2JNY A;  3IR7 A;  1L1O C;  3ESW A;  3BG0 B;  1RQF A;  3VB9 A;  5FLX b;  2QEX 1;  1VQ7 Z;  3NH5 A;  2DE5 A;  1TWC I;  3CME Z;  3S15 I;  1VQN Z;  1VQ7 1;  3NDI A;  3CPW Y;  2O4H A;  2P28 A;  1WW9 A;  4A3M I;  3FQQ A;  1VQ8 1;  3K7A I;  1Q7Y 2;  3CME 1;  1VQN 1;  4MD8 A;  1Z01 A;  3GTK I;  1QVF Z;  3J81 b;  3I55 Z;  1YUK A;  3KIH A;  3M4O I;  3IX0 A;  1W2B Y;  1Q86 2;  2E2J I;  2Q51 A;  3CC2 Z;  3TE5 B;  3I55 1;  4NB8 A;  1K9M 2;  1I3Q I;  2IV2 X;  2QRC B;  1YJW 1;  1Q7Y 1;  2G2K A;  4EWC A;  3CCV Z;  3MZL B;  2E7Z A;  1YUA A;  1VQ6 1;  1YI2 Z;  2K3R A;  2VPW A;  1Q86 1;  2NVQ I;  5IT9 f;  2V3V A;  4NBE A;  1K9M 1;  3CCS Z;  2JIR A;  3NH4 A;  3EED A;  1YI2 1;  1N8R 2;  4S1T A;  4Y7N I;  4HGY A;  3PO3 I;  2JR6 A;  3CCS 1;  5A2Q f;  4BBS I;  3BG1 B;  1K83 I;  4NBG A;  2JIP A;  3H0G I;  2Y0S A;  3S16 I;  4A3K I;  1K8A 1;  4E33 A;  4E31 A;  3S2D I;  2DE6 A;  4TNU A;  4RS4 A;  1KD1 2;  4RVD A;  1M1K 2;  2F4O A;  3G4S Z;  2WB1 A;  2V8K A;  5C4J I;  1LQL A;  3J81 f;  1RLY A;  2GTH A;  2RT9 A;  1YJ9 Z;  3CC7 Z;  2QR1 B;  3G4S 1;  2I3C A;  5C3E I;  2KI7 B;  4MON A;  2K5R A;  1NUI A;  4QTT A;  3HOU I;  1WZN A;  1YJ9 1;  2OTL 1;  4A3G I;  3NH8 A;  1WCM I;  4NH1 C;  1NJI 2;  3CC4 Z;  4A93 I;  1S7M A;  5T64 A;  1VQ5 1;  1KD1 1;  1M1K 1;  3MON A;  3CQZ I;  3CPW Z;  3T4N B;  3J80 f;  3CC4 1;  1USP A;  4MD7 A;  1VQP 1;  1RO2 A;  4DQY B;  2M6N A;  3GCF A;  4DK1 A;  4NBB A;  1VQO Z;  2HF1 A;  2OTJ Z;  1W2B Z;  2V8J A;  1Y1V I;  2O53 A;  4A3E I;  1NJI 1;  1I50 I;  2QKD A;  1VQO 1;  3S17 I;  2OTJ 1;  3MZK B;  5CM2 M;  1RO4 A;  3VTN A;  3OW2 Z;  1SIW A;  3NFZ A;  2R7Z I;  1KC8 2;  3I4M I;  3HOV I;  1QVG Z;  2E2I I;  4E2Z A;  2E9H A;  2OOY B;  4NBC A;  3IFU A;  1KRL A;  1S72 Z;  3LUS A;  4E30 A;  3CMA Z;  1YHQ Z;  1VQK Z;  4RVG A;  3PO2 I;  3Q87 A;  1YHQ 1;  3JAM f;  1YIT Z;  3CMA 1;  1VQK 1;  3F3F C;  2JA7 I;  2J6A A;  3GTO I;  5C44 I;  3CC2 1;  3OW2 Y;  1VLA A;  1KC8 1;  5FLM I;  1N2F A;  1YIT 1;  1QVG Y;  2EGT A;  2AKL A;  1AA6 A;  1R9T I;  5T6B A;  1PFT A;  3S1N I;  3CCV 1;  1RO0 A;  1K8A 2;  2RPR A;  4QTU A;  3QWU A;  4HH4 A;  1JJ2 Z;  4NBH A;  3S1M I;  3I4N I;  3G71 Z;  3RZD I;  3I56 Z;  3PO3 S; 
#chains in the Genus database with same CATH homology
 1X0T A;  1KQS Z;  5FLX f;  4Y52 I;  1ZB9 A;  2LFU A;  2R6M A;  3I07 A;  3VMH A;  4MH4 A;  3G71 1;  4MD9 A;  2GTI A;  2GU2 A;  1I6H I;  3J7A 4;  1RNI A;  5D1P A;  4AYB A;  1ZB8 A;  1YJN Z;  1JJ2 Y;  1ZH1 A;  4MXU A;  3G6E Z;  1VQM Z;  5D1O B;  1Z03 A;  1KQS Y;  2E2H I;  5LL6 f;  3G6E 1;  1YIJ Z;  3RZO I;  3CC7 1;  2BJO A;  3CCU Z;  1VQ4 Z;  2B63 I;  3CD6 Z;  2PMZ A;  4RVF A;  2R93 I;  4BY7 I;  4RVH A;  2IZ3 A;  2VUM I;  1YIJ 1;  4NBF A;  2F4M A;  2JS4 A;  3CD6 1;  2KPI A;  4XX2 A;  3CCQ Z;  1X3W A;  1P9N A;  4A3F I;  1SFO I;  3TDH B;  2RBL A;  1K73 2;  3CCR Z;  1JWH C;  3S1R I;  2NVY I;  3VMI A;  5IT9 b;  3CCE Z;  2NVX I;  1Y1V S;  5AN9 F;  1X3Z A;  4BBR I;  4E2Y A;  1TWA I;  3CCR 1;  4BY1 I;  2QEX Z;  3NDJ A;  3HKZ A;  3CCE 1;  2JA5 I;  4A3B I;  2M48 A;  4A3C I;  4RV9 A;  5A2Q b;  3GTQ I;  3CCM Z;  2QRD B;  3GTJ I;  1VQ9 Z;  1K73 1;  3GTM I;  2IZ4 A;  5C4X I;  1VQ8 Z;  1WII A;  2QA4 Z;  3GTM S;  4CL1 A;  3D9X A;  2W03 A;  3CCM 1;  1M90 2;  1TFI A;  4DGL A;  1S72 1;  1VQ9 1;  5D1O A;  3GTP I;  4X6A I;  2QA4 1;  3EER A;  2JA6 I;  3HOY I;  4NOZ A;  3U50 C;  3KIF A;  2VF1 A;  1YJW Z;  3HOW I;  2QRE B;  2QLV B;  2DE7 A;  1M90 1;  4NFR A;  4A3D I;  2PK7 A;  2PM9 A;  3FKI I;  1VQ6 Z;  5IP9 I;  3J80 b;  2JA8 I;  1Q81 2;  1QVF Y;  1NP6 A;  1TWH I;  1USP B;  1TWF I;  4NBA A;  5IP7 I;  3I56 1;  4A3J I;  2ZAE B;  4HGZ A;  2NVT I;  3S14 I;  2WAQ A;  2YU9 I;  2JUB A;  3FQM A;  3IF8 A;  2RIQ A;  3GKQ A;  1Q81 1;  3HOZ I;  2HU9 A;  3CXC Z;  4MRI A;  2LIY A;  1YJN 1;  3D6W A;  3P5J B;  2JMO A;  1Q82 2;  1VQM 1;  1N8R 1;  3S2H I;  1Y1W I;  3F3P C;  4E2W A;  3CCL Z;  2YAD A;  1Z02 A;  3JAM b;  4A3I I;  4E32 A;  1ML8 A;  4A3L I;  2OZK A;  3CCU 1;  1VQL Z;  4BXX I;  2R92 I;  1VQ4 1;  3GTL I;  3CCJ Z;  2OTL Z;  2VUG A;  3CCL 1;  3GTG I;  4NBD A;  3CXC Y;  1TWG I;  2V8I A;  1QF8 A;  1VQ5 Z;  3H3V J;  4E2X A;  1VQL 1;  4NB9 A;  3CCJ 1;  1VQP Z;  3CCQ 1;  2OOX B;  2RHB A;  1Q82 1;  1DL6 A;  5T67 A;  3S1Q I;  2Q4Z A;  3HOX I;  2P3Y A;  2H85 A;  3M3Y I;  1QYP A;  2W04 A;  3VMG A;  2JNY A;  1L1O C;  3ESW A;  3BG0 B;  1RQF A;  3VB9 A;  5FLX b;  2QEX 1;  1VQ7 Z;  3NH5 A;  2DE5 A;  1TWC I;  3CME Z;  3S15 I;  1VQN Z;  1VQ7 1;  3NDI A;  3CPW Y;  2O4H A;  2P28 A;  1WW9 A;  4A3M I;  3FQQ A;  1VQ8 1;  3K7A I;  1Q7Y 2;  3CME 1;  1VQN 1;  4MD8 A;  1Z01 A;  3GTK I;  1QVF Z;  3J81 b;  3I55 Z;  1YUK A;  3KIH A;  3M4O I;  3IX0 A;  1W2B Y;  1Q86 2;  2E2J I;  2Q51 A;  3CC2 Z;  3TE5 B;  3I55 1;  4NB8 A;  1K9M 2;  1I3Q I;  2QRC B;  1YJW 1;  1Q7Y 1;  2G2K A;  4EWC A;  3CCV Z;  3MZL B;  1YUA A;  1VQ6 1;  1YI2 Z;  2K3R A;  1Q86 1;  2NVQ I;  5IT9 f;  4NBE A;  1K9M 1;  3CCS Z;  3NH4 A;  3EED A;  1YI2 1;  1N8R 2;  4S1T A;  4Y7N I;  4HGY A;  3PO3 I;  2JR6 A;  3CCS 1;  5A2Q f;  4BBS I;  3BG1 B;  1K83 I;  4NBG A;  3H0G I;  2Y0S A;  3S16 I;  4A3K I;  1K8A 1;  4E33 A;  4E31 A;  3S2D I;  2DE6 A;  4TNU A;  4RS4 A;  1KD1 2;  4RVD A;  1M1K 2;  2F4O A;  3G4S Z;  2WB1 A;  2V8K A;  5C4J I;  1LQL A;  3J81 f;  1RLY A;  2GTH A;  2RT9 A;  1YJ9 Z;  3CC7 Z;  2QR1 B;  3G4S 1;  2I3C A;  5C3E I;  2KI7 B;  4MON A;  2K5R A;  1NUI A;  4QTT A;  3HOU I;  1YJ9 1;  2OTL 1;  4A3G I;  3NH8 A;  1WCM I;  4NH1 C;  1NJI 2;  3CC4 Z;  4A93 I;  1S7M A;  5T64 A;  1VQ5 1;  1KD1 1;  1M1K 1;  3MON A;  3CQZ I;  3CPW Z;  3T4N B;  3J80 f;  3CC4 1;  1USP A;  4MD7 A;  1VQP 1;  1RO2 A;  4DQY B;  2M6N A;  3GCF A;  4DK1 A;  4NBB A;  1VQO Z;  2HF1 A;  2OTJ Z;  1W2B Z;  2V8J A;  1Y1V I;  2O53 A;  4A3E I;  1NJI 1;  1I50 I;  2QKD A;  1VQO 1;  3S17 I;  2OTJ 1;  3MZK B;  5CM2 M;  1RO4 A;  3VTN A;  3OW2 Z;  3NFZ A;  2R7Z I;  1KC8 2;  3I4M I;  3HOV I;  1QVG Z;  2E2I I;  4E2Z A;  2E9H A;  2OOY B;  4NBC A;  3IFU A;  1KRL A;  1S72 Z;  3LUS A;  4E30 A;  3CMA Z;  1YHQ Z;  1VQK Z;  4RVG A;  3PO2 I;  3Q87 A;  1YHQ 1;  3JAM f;  1YIT Z;  3CMA 1;  1VQK 1;  3F3F C;  2JA7 I;  2J6A A;  3GTO I;  5C44 I;  3CC2 1;  3OW2 Y;  1VLA A;  1KC8 1;  5FLM I;  1N2F A;  1YIT 1;  1QVG Y;  2EGT A;  2AKL A;  1R9T I;  5T6B A;  1PFT A;  3S1N I;  3CCV 1;  1RO0 A;  1K8A 2;  2RPR A;  4QTU A;  3QWU A;  4HH4 A;  1JJ2 Z;  4NBH A;  3S1M I;  3I4N I;  3G71 Z;  3RZD I;  3I56 Z;  3PO3 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...