1KC82

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
b'TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8200
2QEX1 1VQ91 3CCRZ 3CC41 3CCEZ 3CXCZ 3CC7Z 3CCUZ 3CMA1 1YJ91 3CC2Z 1VQ51 1YIJ1 1VQNZ 1VQK1 3I561 2QEXZ 1W2BZ 1N8R1 1K8A1 1VQ61 1VQ41 1VQP1 3CPWY 3CC4Z 1M1K1 1VQO1 3OW2Z 1W2BY 1VQ71 1S721 3CCV1 1K9M1 3CMAZ 1VQM1 1VQ5Z 1JJ2Z 3CCS1 3I56Z 1Q7Y2 1VQ4Z 3CCQ1 3CXCY 1M901 2OTL1 1VQOZ 1YIT1 1QVFZ 1S72Z 3CCVZ 1KQSZ 1KC81 3CMEZ 1YHQ1 2OTJ1 1VQ9Z 1K732 1VQL1 1Q812 1Q822 1KD12 1NJI1 3CD61 3CCQZ 1YJ9Z 3OW2Y 2OTLZ 1YITZ 1Q862 3G4S1 3CCL1 1YIJZ 3G6E1 1VQKZ 1YHQZ 2OTJZ 3I551 1VQ6Z 1JJ2Y 1VQPZ 1VQLZ 2QA41 1VQ7Z 3CCU1 1QVGZ 3CCJ1 1VQMZ 1YJN1 1YJW1 1QVFY 3G4SZ 3CCLZ 1QVGY 1KQSY 1YI21 3G6EZ 1Q7Y1 1KC82 3CCSZ 3G711 3I55Z 1N8R2 1K8A2 1M1K2 2QA4Z 3CCM1 1VQ81 3CCJZ 1K9M2 1NJI2 1YJNZ 1YJWZ 3CCR1 1K731 3CPWZ 3CCE1 1YI2Z 1Q811 1Q821 3CC71 1KD11 3G71Z 3CD6Z 3CC21 1Q861 1M902 3CCMZ 1VQ8Z 1VQN1 3CME1
chains in the Genus database with same CATH superfamily
2JA5I 5IP9I 3CCEZ 4RV9A 2RBLA 3GKQA 2E9HA 1VQ51 2NAPA 2V8IA 4BBRI 4NBDA 1VQNZ 1TWFI 3I561 4EWCA 2QEXZ 4Y7NI 1VQP1 1VQ41 3CPWY 1M1K1 3MONA 1SIWA 1JWHC 1VQ71 3EERA 2YADA 3NH5A 1QYPA 3CCV1 1K9M1 1WCMI 1VQM1 3QWUA 2VF1A 2R7ZI 5T64A 2O4HA 3PO3S 2W03A 4E2WA 5C3EI 3P5JB 3CXCY 1YIT1 2WAQA 1ZB9A 5A2Qb 4A3GI 2RT9A 2RHBA 2OTJ1 2PM9A 5C44I 3TDHB 3EEDA 2DE7A 2I3CA 1KD12 3BG0B 5C4JI 1RNIA 3MZKB 1NJI1 4MONA 5FLXb 4NOZA 3KIFA 4BY1I 3K7AI 3CCL1 3JAMb 2LFUA 3HOYI 4NBGA 1RQFA 1YHQZ 3MZLB 3GTMS 1VQPZ 2OZKA 1VQLZ 2YU9I 4NH1C 3D2LA 1VQ7Z 1I50I 3CCU1 3M4OI 1QVGZ 1VQMZ 2JR6A 1R9TI 2R6MA 1X0TA 1QVGY 1KQSY 1Q7Y1 3IFUA 3S15I 1K8A2 2K3RA 1S7MA 3I07A 4HH4A 1NJI2 4NBFA 3NH4A 1YJWZ 3F3FC 4NB9A 3S1RI 1WZNA 3CCE1 2V3VA 2AKLA 1Q811 2QLVB 2IV2X 3J80f 3G71Z 3VB9A 3S1NI 3VMGA 2Y0SA 1Q861 3HOWI 1QXFA 4A3CI 3NFZA 3CME1 3ESWA 1VQN1 2QEX1 1YUKA 2B63I 2JA6I 4AYBA 3HOZI 1L1OC 2VPXA 3VMIA 3CCUZ 2LIYA 4NBBA 2GTIA 2NVTI 3D9XA 3CC2Z 2HF1A 2M48A 3I4NI 2VUGA 2QRCB 4DK1A 1Y1VI 1TWHI 4MD8A 3CC4Z 3OW2Z 3CMAZ 2NVQI 5FLMI 4NBEA 3BG1B 3RZOI 2VPYA 4E2ZA 3J7A4 3J81b 4E33A 4DQYB 3F3PC 1P9NA 2JNYA 1M901 4QTTA 1S72Z 2E2II 3T4NB 3CMEZ 1YHQ1 5A2Qf 3S2HI 1K732 1VQL1 1USPB 3CD61 3CCQZ 2JIMA 5D1PA 5FLXf 1AA6A 3GTKI 3HOVI 3JAMf 4BY7I 5IT9b 2BJOA 2DE6A 2VPWA 2R92I 4A3KI 4NBAA 1YJW1 3IF8A 2M6NA 3G4SZ 3NH8A 3G711 3S1QI 5LL6f 4DGLA 4XX2A 3I55Z 3M3YI 1WJ2A 1M1K2 4RVHA 2JA7I 1TWCI 2PK7A 2RPRA 2QKDA 2QA4Z 1USPA 3D6WA 2VUMI 1K9M2 2JA8I 2NVXI 2H85A 1YJNZ 4E2YA 4X6AI 1Q821 1YUAA 2PMZA 3FQMA 4NFRA 2V8KA 2LEXA 1Y1WI 3CD6Z 3CC21 3CCMZ 2E7ZA 2V8JA 2O53A 5C4XI 1Y8CA 3CCRZ 3CC41 2KI7B 4A3DI 3IR7A 3CC7Z 1RO4A 3CMA1 1Z02A 1YJ91 1LQLA 4A3FI 4NBHA 1YIJ1 2OOXB 2P3YA 1VQK1 1N8R1 5T6BA 1VQ61 1KRLA 3Q87A 5CM2M 1S721 2Q51A 1WW9A 1JJ2Z 1RLYA 1NP6A 4E32A 3CCS1 1Q7Y2 2NVYI 3CCQ1 1VQOZ 1QVFZ 2JIOA 3J81f 1NUIA 1KC81 3IX0A 1VLAA 1Y1VS 2JIPA 4NBCA 1TWAI 3GTLI 3GCFA 4MD7A 1Q812 2IZ4A 1I6HI 1N2FA 3I4MI 1YJ9Z 3HKZA 3OW2Y 2OTLZ 2Q4ZA 1Q862 3G4S1 4A3BI 1YIJZ 5D1OA 2R93I 5IP7I 1VQKZ 2QREB 1ML8A 1ZB8A 3I551 3CQZI 1VQ6Z 2DE5A 2G2KA 3GTOI 1X3ZA 2QA41 1Q16A 4A3JI 3NDIA 1YJN1 2E2HI 1SFOI 2V45A 4A3MI 2JS4A 3G6EZ 4MH4A 3CCSZ 1KC82 3PO2I 2GU2A 3S2DI 4A3EI 2QR1B 2GTHA 2KPIA 3CCM1 2IZ3A 2QRDB 3CCJZ 1PFTA 2W04A 1RO2A 3CCR1 4MRIA 3CPWZ 4A93I 1FDIA 1YI2Z 3CC71 1KD11 2JMOA 4CL1A 3HOUI 1QF8A 1M902 4TNUA 1VQ8Z 1Z01A 2F4OA 1X3WA 3H3VJ 1VQ91 4E2XA 3HOXI 1FDOA 3CXCZ 3PO3I 2AYDA 3S14I 3LUSA 2HU9A 4Y52I 4A3LI 4E31A 1W2BZ 1K8A1 3RZDI 4RVFA 4RVDA 2K5RA 1I3QI 4MD9A 2WB1A 1VQO1 2VPZA 1W2BY 4HGYA 1RO0A 2P28A 2ZAEB 3U50C 2J6AA 3GTQI 1VQ5Z 3NDJA 3I56Z 2JIRA 3GTPI 1VQ4Z 3GTMI 2OTL1 4RVGA 3CCVZ 1KQSZ 1K83I 4E30A 2E2JI 1VQ9Z 3TE5B 1Q822 5D1OB 1YITZ 4HGZA 2EGTA 3GTJI 3KIHA 3G6E1 2OOYB 2OTJZ 2JUBA 1JJ2Y 3VTNA 3CCJ1 4RS4A 1Z03A 1QVFY 1ZH1A 4S1TA 5T67A 4A3II 3CCLZ 1YI21 1TWGI 3H0GI 1DL6A 1N8R2 1TFIA 3GTGI 1VQ81 3S16I 3S17I 4BXXI 4QTUA 4NB8A 4MXUA 3VMHA 1K731 1WIIA 3J80b 3FKII 5IT9f 4BBSI 5AN9F 3S1MI 3FQQA 2F4MA 2RIQA 2JIQA
chains in the Genus database with same CATH topology
2JA5I 5IP9I 3CCEZ 4RV9A 2RBLA 3GKQA 2E9HA 1VQ51 2V8IA 4BBRI 4NBDA 1VQNZ 1TWFI 3I561 4EWCA 2QEXZ 4Y7NI 1VQP1 1VQ41 3CPWY 1M1K1 3MONA 1JWHC 1VQ71 3EERA 2YADA 3NH5A 1QYPA 3CCV1 1K9M1 1WCMI 1VQM1 3QWUA 2VF1A 2R7ZI 5T64A 2O4HA 3PO3S 2W03A 4E2WA 5C3EI 3P5JB 3CXCY 1YIT1 2WAQA 1ZB9A 5A2Qb 4A3GI 2RT9A 2RHBA 2OTJ1 2PM9A 5C44I 3TDHB 3EEDA 2DE7A 2I3CA 1KD12 3BG0B 5C4JI 1RNIA 3MZKB 1NJI1 4MONA 5FLXb 4NOZA 3KIFA 4BY1I 3K7AI 3CCL1 3JAMb 2LFUA 3HOYI 4NBGA 1RQFA 1YHQZ 3MZLB 3GTMS 1VQPZ 2OZKA 1VQLZ 2YU9I 4NH1C 1VQ7Z 1I50I 3CCU1 3M4OI 1QVGZ 1VQMZ 2JR6A 1R9TI 2R6MA 1X0TA 1QVGY 1KQSY 1Q7Y1 3IFUA 3S15I 1K8A2 2K3RA 1S7MA 3I07A 4HH4A 1NJI2 4NBFA 3NH4A 1YJWZ 3F3FC 4NB9A 3S1RI 3CCE1 2AKLA 1Q811 2QLVB 3J80f 3G71Z 3VB9A 3S1NI 3VMGA 2Y0SA 1Q861 3HOWI 4A3CI 3NFZA 3CME1 3ESWA 1VQN1 2QEX1 1YUKA 2B63I 2JA6I 4AYBA 3HOZI 1L1OC 3VMIA 3CCUZ 2LIYA 4NBBA 2GTIA 2NVTI 3D9XA 3CC2Z 2HF1A 2M48A 3I4NI 2VUGA 2QRCB 4DK1A 1Y1VI 1TWHI 4MD8A 3CC4Z 3OW2Z 3CMAZ 2NVQI 5FLMI 4NBEA 3BG1B 3RZOI 4E2ZA 3J7A4 3J81b 4E33A 4DQYB 3F3PC 1P9NA 2JNYA 1M901 4QTTA 1S72Z 2E2II 3T4NB 3CMEZ 1YHQ1 5A2Qf 3S2HI 1K732 1VQL1 1USPB 3CD61 3CCQZ 5D1PA 5FLXf 3GTKI 3HOVI 3JAMf 4BY7I 5IT9b 2BJOA 2DE6A 2R92I 4A3KI 4NBAA 1YJW1 3IF8A 2M6NA 3G4SZ 3NH8A 3G711 3S1QI 5LL6f 4DGLA 4XX2A 3I55Z 3M3YI 1M1K2 4RVHA 2JA7I 1TWCI 2PK7A 2RPRA 2QKDA 2QA4Z 1USPA 3D6WA 2VUMI 1K9M2 2JA8I 2NVXI 2H85A 1YJNZ 4E2YA 4X6AI 1Q821 1YUAA 2PMZA 3FQMA 4NFRA 2V8KA 1Y1WI 3CD6Z 3CC21 3CCMZ 2V8JA 2O53A 5C4XI 3CCRZ 3CC41 2KI7B 4A3DI 3CC7Z 1RO4A 3CMA1 1Z02A 1YJ91 1LQLA 4A3FI 4NBHA 1YIJ1 2OOXB 2P3YA 1VQK1 1N8R1 5T6BA 1VQ61 1KRLA 3Q87A 5CM2M 1S721 2Q51A 1WW9A 1JJ2Z 1RLYA 1NP6A 4E32A 3CCS1 1Q7Y2 2NVYI 3CCQ1 1VQOZ 1QVFZ 3J81f 1NUIA 1KC81 3IX0A 1VLAA 1Y1VS 4NBCA 1TWAI 3GTLI 3GCFA 4MD7A 1Q812 2IZ4A 1I6HI 1N2FA 3I4MI 1YJ9Z 3HKZA 3OW2Y 2OTLZ 2Q4ZA 1Q862 3G4S1 4A3BI 1YIJZ 5D1OA 2R93I 5IP7I 1VQKZ 2QREB 1ML8A 1ZB8A 3I551 3CQZI 1VQ6Z 2DE5A 2G2KA 3GTOI 1X3ZA 2QA41 4A3JI 3NDIA 1YJN1 2E2HI 1SFOI 4A3MI 2JS4A 3G6EZ 4MH4A 3CCSZ 1KC82 3PO2I 2GU2A 3S2DI 4A3EI 2QR1B 2GTHA 2KPIA 3CCM1 2IZ3A 2QRDB 3CCJZ 1PFTA 2W04A 1RO2A 3CCR1 4MRIA 3CPWZ 4A93I 1YI2Z 3CC71 1KD11 2JMOA 4CL1A 3HOUI 1QF8A 1M902 4TNUA 1VQ8Z 1Z01A 2F4OA 1X3WA 3H3VJ 1VQ91 4E2XA 3HOXI 3CXCZ 3PO3I 3S14I 3LUSA 2HU9A 4Y52I 4A3LI 4E31A 1W2BZ 1K8A1 3RZDI 4RVFA 4RVDA 2K5RA 1I3QI 4MD9A 2WB1A 1VQO1 1W2BY 4HGYA 1RO0A 2P28A 2ZAEB 3U50C 2J6AA 3GTQI 1VQ5Z 3NDJA 3I56Z 3GTPI 1VQ4Z 3GTMI 2OTL1 4RVGA 3CCVZ 1KQSZ 1K83I 4E30A 2E2JI 1VQ9Z 3TE5B 1Q822 5D1OB 1YITZ 4HGZA 2EGTA 3GTJI 3KIHA 3G6E1 2OOYB 2OTJZ 2JUBA 1JJ2Y 3VTNA 3CCJ1 4RS4A 1Z03A 1QVFY 1ZH1A 4S1TA 5T67A 4A3II 3CCLZ 1YI21 1TWGI 3H0GI 1DL6A 1N8R2 1TFIA 3GTGI 1VQ81 3S16I 3S17I 4BXXI 4QTUA 4NB8A 4MXUA 3VMHA 1K731 1WIIA 3J80b 3FKII 5IT9f 4BBSI 5AN9F 3S1MI 3FQQA 2F4MA 2RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX 1;  1VQ9 1;  3CCR Z;  3CC4 1;  3CCE Z;  3CXC Z;  3CC7 Z;  3CCU Z;  3CMA 1;  1YJ9 1;  3CC2 Z;  1VQ5 1;  1YIJ 1;  1VQN Z;  1VQK 1;  3I56 1;  2QEX Z;  1W2B Z;  1N8R 1;  1K8A 1;  1VQ6 1;  1VQ4 1;  1VQP 1;  3CPW Y;  3CC4 Z;  1M1K 1;  1VQO 1;  3OW2 Z;  1W2B Y;  1VQ7 1;  1S72 1;  3CCV 1;  1K9M 1;  3CMA Z;  1VQM 1;  1VQ5 Z;  1JJ2 Z;  3CCS 1;  3I56 Z;  1Q7Y 2;  1VQ4 Z;  3CCQ 1;  3CXC Y;  1M90 1;  2OTL 1;  1VQO Z;  1YIT 1;  1QVF Z;  1S72 Z;  3CCV Z;  1KQS Z;  1KC8 1;  3CME Z;  1YHQ 1;  2OTJ 1;  1VQ9 Z;  1K73 2;  1VQL 1;  1Q81 2;  1Q82 2;  1KD1 2;  1NJI 1;  3CD6 1;  3CCQ Z;  1YJ9 Z;  3OW2 Y;  2OTL Z;  1YIT Z;  1Q86 2;  3G4S 1;  3CCL 1;  1YIJ Z;  3G6E 1;  1VQK Z;  1YHQ Z;  2OTJ Z;  3I55 1;  1VQ6 Z;  1JJ2 Y;  1VQP Z;  1VQL Z;  2QA4 1;  1VQ7 Z;  3CCU 1;  1QVG Z;  3CCJ 1;  1VQM Z;  1YJN 1;  1YJW 1;  1QVF Y;  3G4S Z;  3CCL Z;  1QVG Y;  1KQS Y;  1YI2 1;  3G6E Z;  1Q7Y 1;  1KC8 2;  3CCS Z;  3G71 1;  3I55 Z;  1N8R 2;  1K8A 2;  1M1K 2;  2QA4 Z;  3CCM 1;  1VQ8 1;  3CCJ Z;  1K9M 2;  1NJI 2;  1YJN Z;  1YJW Z;  3CCR 1;  1K73 1;  3CPW Z;  3CCE 1;  1YI2 Z;  1Q81 1;  1Q82 1;  3CC7 1;  1KD1 1;  3G71 Z;  3CD6 Z;  3CC2 1;  1Q86 1;  1M90 2;  3CCM Z;  1VQ8 Z;  1VQN 1;  3CME 1; 
#chains in the Genus database with same CATH topology
 2JA5 I;  5IP9 I;  3CCE Z;  4RV9 A;  2RBL A;  3GKQ A;  2E9H A;  1VQ5 1;  2NAP A;  2V8I A;  4BBR I;  4NBD A;  1VQN Z;  1TWF I;  3I56 1;  4EWC A;  2QEX Z;  4Y7N I;  1VQP 1;  1VQ4 1;  3CPW Y;  1M1K 1;  3MON A;  1SIW A;  1JWH C;  1VQ7 1;  3EER A;  2YAD A;  3NH5 A;  1QYP A;  3CCV 1;  1K9M 1;  1WCM I;  1VQM 1;  3QWU A;  2VF1 A;  2R7Z I;  5T64 A;  2O4H A;  3PO3 S;  2W03 A;  4E2W A;  5C3E I;  3P5J B;  3CXC Y;  1YIT 1;  2WAQ A;  1ZB9 A;  5A2Q b;  4A3G I;  2RT9 A;  2RHB A;  2OTJ 1;  2PM9 A;  5C44 I;  3TDH B;  3EED A;  2DE7 A;  2I3C A;  1KD1 2;  3BG0 B;  5C4J I;  1RNI A;  3MZK B;  1NJI 1;  4MON A;  5FLX b;  4NOZ A;  3KIF A;  4BY1 I;  3K7A I;  3CCL 1;  3JAM b;  2LFU A;  3HOY I;  4NBG A;  1RQF A;  1YHQ Z;  3MZL B;  3GTM S;  1VQP Z;  2OZK A;  1VQL Z;  2YU9 I;  4NH1 C;  3D2L A;  1VQ7 Z;  1I50 I;  3CCU 1;  3M4O I;  1QVG Z;  1VQM Z;  2JR6 A;  1R9T I;  2R6M A;  1X0T A;  1QVG Y;  1KQS Y;  1Q7Y 1;  3IFU A;  3S15 I;  1K8A 2;  2K3R A;  1S7M A;  3I07 A;  4HH4 A;  1NJI 2;  4NBF A;  3NH4 A;  1YJW Z;  3F3F C;  4NB9 A;  3S1R I;  1WZN A;  3CCE 1;  2V3V A;  2AKL A;  1Q81 1;  2QLV B;  2IV2 X;  3J80 f;  3G71 Z;  3VB9 A;  3S1N I;  3VMG A;  2Y0S A;  1Q86 1;  3HOW I;  1QXF A;  4A3C I;  3NFZ A;  3CME 1;  3ESW A;  1VQN 1;  2QEX 1;  1YUK A;  2B63 I;  2JA6 I;  4AYB A;  3HOZ I;  1L1O C;  2VPX A;  3VMI A;  3CCU Z;  2LIY A;  4NBB A;  2GTI A;  2NVT I;  3D9X A;  3CC2 Z;  2HF1 A;  2M48 A;  3I4N I;  2VUG A;  2QRC B;  4DK1 A;  1Y1V I;  1TWH I;  4MD8 A;  3CC4 Z;  3OW2 Z;  3CMA Z;  2NVQ I;  5FLM I;  4NBE A;  3BG1 B;  3RZO I;  2VPY A;  4E2Z A;  3J7A 4;  3J81 b;  4E33 A;  4DQY B;  3F3P C;  1P9N A;  2JNY A;  1M90 1;  4QTT A;  1S72 Z;  2E2I I;  3T4N B;  3CME Z;  1YHQ 1;  5A2Q f;  3S2H I;  1K73 2;  1VQL 1;  1USP B;  3CD6 1;  3CCQ Z;  2JIM A;  5D1P A;  5FLX f;  1AA6 A;  3GTK I;  3HOV I;  3JAM f;  4BY7 I;  5IT9 b;  2BJO A;  2DE6 A;  2VPW A;  2R92 I;  4A3K I;  4NBA A;  1YJW 1;  3IF8 A;  2M6N A;  3G4S Z;  3NH8 A;  3G71 1;  3S1Q I;  5LL6 f;  4DGL A;  4XX2 A;  3I55 Z;  3M3Y I;  1WJ2 A;  1M1K 2;  4RVH A;  2JA7 I;  1TWC I;  2PK7 A;  2RPR A;  2QKD A;  2QA4 Z;  1USP A;  3D6W A;  2VUM I;  1K9M 2;  2JA8 I;  2NVX I;  2H85 A;  1YJN Z;  4E2Y A;  4X6A I;  1Q82 1;  1YUA A;  2PMZ A;  3FQM A;  4NFR A;  2V8K A;  2LEX A;  1Y1W I;  3CD6 Z;  3CC2 1;  3CCM Z;  2E7Z A;  2V8J A;  2O53 A;  5C4X I;  1Y8C A;  3CCR Z;  3CC4 1;  2KI7 B;  4A3D I;  3IR7 A;  3CC7 Z;  1RO4 A;  3CMA 1;  1Z02 A;  1YJ9 1;  1LQL A;  4A3F I;  4NBH A;  1YIJ 1;  2OOX B;  2P3Y A;  1VQK 1;  1N8R 1;  5T6B A;  1VQ6 1;  1KRL A;  3Q87 A;  5CM2 M;  1S72 1;  2Q51 A;  1WW9 A;  1JJ2 Z;  1RLY A;  1NP6 A;  4E32 A;  3CCS 1;  1Q7Y 2;  2NVY I;  3CCQ 1;  1VQO Z;  1QVF Z;  2JIO A;  3J81 f;  1NUI A;  1KC8 1;  3IX0 A;  1VLA A;  1Y1V S;  2JIP A;  4NBC A;  1TWA I;  3GTL I;  3GCF A;  4MD7 A;  1Q81 2;  2IZ4 A;  1I6H I;  1N2F A;  3I4M I;  1YJ9 Z;  3HKZ A;  3OW2 Y;  2OTL Z;  2Q4Z A;  1Q86 2;  3G4S 1;  4A3B I;  1YIJ Z;  5D1O A;  2R93 I;  5IP7 I;  1VQK Z;  2QRE B;  1ML8 A;  1ZB8 A;  3I55 1;  3CQZ I;  1VQ6 Z;  2DE5 A;  2G2K A;  3GTO I;  1X3Z A;  2QA4 1;  1Q16 A;  4A3J I;  3NDI A;  1YJN 1;  2E2H I;  1SFO I;  2V45 A;  4A3M I;  2JS4 A;  3G6E Z;  4MH4 A;  3CCS Z;  1KC8 2;  3PO2 I;  2GU2 A;  3S2D I;  4A3E I;  2QR1 B;  2GTH A;  2KPI A;  3CCM 1;  2IZ3 A;  2QRD B;  3CCJ Z;  1PFT A;  2W04 A;  1RO2 A;  3CCR 1;  4MRI A;  3CPW Z;  4A93 I;  1FDI A;  1YI2 Z;  3CC7 1;  1KD1 1;  2JMO A;  4CL1 A;  3HOU I;  1QF8 A;  1M90 2;  4TNU A;  1VQ8 Z;  1Z01 A;  2F4O A;  1X3W A;  3H3V J;  1VQ9 1;  4E2X A;  3HOX I;  1FDO A;  3CXC Z;  3PO3 I;  2AYD A;  3S14 I;  3LUS A;  2HU9 A;  4Y52 I;  4A3L I;  4E31 A;  1W2B Z;  1K8A 1;  3RZD I;  4RVF A;  4RVD A;  2K5R A;  1I3Q I;  4MD9 A;  2WB1 A;  1VQO 1;  2VPZ A;  1W2B Y;  4HGY A;  1RO0 A;  2P28 A;  2ZAE B;  3U50 C;  2J6A A;  3GTQ I;  1VQ5 Z;  3NDJ A;  3I56 Z;  2JIR A;  3GTP I;  1VQ4 Z;  3GTM I;  2OTL 1;  4RVG A;  3CCV Z;  1KQS Z;  1K83 I;  4E30 A;  2E2J I;  1VQ9 Z;  3TE5 B;  1Q82 2;  5D1O B;  1YIT Z;  4HGZ A;  2EGT A;  3GTJ I;  3KIH A;  3G6E 1;  2OOY B;  2OTJ Z;  2JUB A;  1JJ2 Y;  3VTN A;  3CCJ 1;  4RS4 A;  1Z03 A;  1QVF Y;  1ZH1 A;  4S1T A;  5T67 A;  4A3I I;  3CCL Z;  1YI2 1;  1TWG I;  3H0G I;  1DL6 A;  1N8R 2;  1TFI A;  3GTG I;  1VQ8 1;  3S16 I;  3S17 I;  4BXX I;  4QTU A;  4NB8 A;  4MXU A;  3VMH A;  1K73 1;  1WII A;  3J80 b;  3FKI I;  5IT9 f;  4BBS I;  5AN9 F;  3S1M I;  3FQQ A;  2F4M A;  2RIQ A;  2JIQ A; 
#chains in the Genus database with same CATH homology
 2JA5 I;  5IP9 I;  3CCE Z;  4RV9 A;  2RBL A;  3GKQ A;  2E9H A;  1VQ5 1;  2V8I A;  4BBR I;  4NBD A;  1VQN Z;  1TWF I;  3I56 1;  4EWC A;  2QEX Z;  4Y7N I;  1VQP 1;  1VQ4 1;  3CPW Y;  1M1K 1;  3MON A;  1JWH C;  1VQ7 1;  3EER A;  2YAD A;  3NH5 A;  1QYP A;  3CCV 1;  1K9M 1;  1WCM I;  1VQM 1;  3QWU A;  2VF1 A;  2R7Z I;  5T64 A;  2O4H A;  3PO3 S;  2W03 A;  4E2W A;  5C3E I;  3P5J B;  3CXC Y;  1YIT 1;  2WAQ A;  1ZB9 A;  5A2Q b;  4A3G I;  2RT9 A;  2RHB A;  2OTJ 1;  2PM9 A;  5C44 I;  3TDH B;  3EED A;  2DE7 A;  2I3C A;  1KD1 2;  3BG0 B;  5C4J I;  1RNI A;  3MZK B;  1NJI 1;  4MON A;  5FLX b;  4NOZ A;  3KIF A;  4BY1 I;  3K7A I;  3CCL 1;  3JAM b;  2LFU A;  3HOY I;  4NBG A;  1RQF A;  1YHQ Z;  3MZL B;  3GTM S;  1VQP Z;  2OZK A;  1VQL Z;  2YU9 I;  4NH1 C;  1VQ7 Z;  1I50 I;  3CCU 1;  3M4O I;  1QVG Z;  1VQM Z;  2JR6 A;  1R9T I;  2R6M A;  1X0T A;  1QVG Y;  1KQS Y;  1Q7Y 1;  3IFU A;  3S15 I;  1K8A 2;  2K3R A;  1S7M A;  3I07 A;  4HH4 A;  1NJI 2;  4NBF A;  3NH4 A;  1YJW Z;  3F3F C;  4NB9 A;  3S1R I;  3CCE 1;  2AKL A;  1Q81 1;  2QLV B;  3J80 f;  3G71 Z;  3VB9 A;  3S1N I;  3VMG A;  2Y0S A;  1Q86 1;  3HOW I;  4A3C I;  3NFZ A;  3CME 1;  3ESW A;  1VQN 1;  2QEX 1;  1YUK A;  2B63 I;  2JA6 I;  4AYB A;  3HOZ I;  1L1O C;  3VMI A;  3CCU Z;  2LIY A;  4NBB A;  2GTI A;  2NVT I;  3D9X A;  3CC2 Z;  2HF1 A;  2M48 A;  3I4N I;  2VUG A;  2QRC B;  4DK1 A;  1Y1V I;  1TWH I;  4MD8 A;  3CC4 Z;  3OW2 Z;  3CMA Z;  2NVQ I;  5FLM I;  4NBE A;  3BG1 B;  3RZO I;  4E2Z A;  3J7A 4;  3J81 b;  4E33 A;  4DQY B;  3F3P C;  1P9N A;  2JNY A;  1M90 1;  4QTT A;  1S72 Z;  2E2I I;  3T4N B;  3CME Z;  1YHQ 1;  5A2Q f;  3S2H I;  1K73 2;  1VQL 1;  1USP B;  3CD6 1;  3CCQ Z;  5D1P A;  5FLX f;  3GTK I;  3HOV I;  3JAM f;  4BY7 I;  5IT9 b;  2BJO A;  2DE6 A;  2R92 I;  4A3K I;  4NBA A;  1YJW 1;  3IF8 A;  2M6N A;  3G4S Z;  3NH8 A;  3G71 1;  3S1Q I;  5LL6 f;  4DGL A;  4XX2 A;  3I55 Z;  3M3Y I;  1M1K 2;  4RVH A;  2JA7 I;  1TWC I;  2PK7 A;  2RPR A;  2QKD A;  2QA4 Z;  1USP A;  3D6W A;  2VUM I;  1K9M 2;  2JA8 I;  2NVX I;  2H85 A;  1YJN Z;  4E2Y A;  4X6A I;  1Q82 1;  1YUA A;  2PMZ A;  3FQM A;  4NFR A;  2V8K A;  1Y1W I;  3CD6 Z;  3CC2 1;  3CCM Z;  2V8J A;  2O53 A;  5C4X I;  3CCR Z;  3CC4 1;  2KI7 B;  4A3D I;  3CC7 Z;  1RO4 A;  3CMA 1;  1Z02 A;  1YJ9 1;  1LQL A;  4A3F I;  4NBH A;  1YIJ 1;  2OOX B;  2P3Y A;  1VQK 1;  1N8R 1;  5T6B A;  1VQ6 1;  1KRL A;  3Q87 A;  5CM2 M;  1S72 1;  2Q51 A;  1WW9 A;  1JJ2 Z;  1RLY A;  1NP6 A;  4E32 A;  3CCS 1;  1Q7Y 2;  2NVY I;  3CCQ 1;  1VQO Z;  1QVF Z;  3J81 f;  1NUI A;  1KC8 1;  3IX0 A;  1VLA A;  1Y1V S;  4NBC A;  1TWA I;  3GTL I;  3GCF A;  4MD7 A;  1Q81 2;  2IZ4 A;  1I6H I;  1N2F A;  3I4M I;  1YJ9 Z;  3HKZ A;  3OW2 Y;  2OTL Z;  2Q4Z A;  1Q86 2;  3G4S 1;  4A3B I;  1YIJ Z;  5D1O A;  2R93 I;  5IP7 I;  1VQK Z;  2QRE B;  1ML8 A;  1ZB8 A;  3I55 1;  3CQZ I;  1VQ6 Z;  2DE5 A;  2G2K A;  3GTO I;  1X3Z A;  2QA4 1;  4A3J I;  3NDI A;  1YJN 1;  2E2H I;  1SFO I;  4A3M I;  2JS4 A;  3G6E Z;  4MH4 A;  3CCS Z;  1KC8 2;  3PO2 I;  2GU2 A;  3S2D I;  4A3E I;  2QR1 B;  2GTH A;  2KPI A;  3CCM 1;  2IZ3 A;  2QRD B;  3CCJ Z;  1PFT A;  2W04 A;  1RO2 A;  3CCR 1;  4MRI A;  3CPW Z;  4A93 I;  1YI2 Z;  3CC7 1;  1KD1 1;  2JMO A;  4CL1 A;  3HOU I;  1QF8 A;  1M90 2;  4TNU A;  1VQ8 Z;  1Z01 A;  2F4O A;  1X3W A;  3H3V J;  1VQ9 1;  4E2X A;  3HOX I;  3CXC Z;  3PO3 I;  3S14 I;  3LUS A;  2HU9 A;  4Y52 I;  4A3L I;  4E31 A;  1W2B Z;  1K8A 1;  3RZD I;  4RVF A;  4RVD A;  2K5R A;  1I3Q I;  4MD9 A;  2WB1 A;  1VQO 1;  1W2B Y;  4HGY A;  1RO0 A;  2P28 A;  2ZAE B;  3U50 C;  2J6A A;  3GTQ I;  1VQ5 Z;  3NDJ A;  3I56 Z;  3GTP I;  1VQ4 Z;  3GTM I;  2OTL 1;  4RVG A;  3CCV Z;  1KQS Z;  1K83 I;  4E30 A;  2E2J I;  1VQ9 Z;  3TE5 B;  1Q82 2;  5D1O B;  1YIT Z;  4HGZ A;  2EGT A;  3GTJ I;  3KIH A;  3G6E 1;  2OOY B;  2OTJ Z;  2JUB A;  1JJ2 Y;  3VTN A;  3CCJ 1;  4RS4 A;  1Z03 A;  1QVF Y;  1ZH1 A;  4S1T A;  5T67 A;  4A3I I;  3CCL Z;  1YI2 1;  1TWG I;  3H0G I;  1DL6 A;  1N8R 2;  1TFI A;  3GTG I;  1VQ8 1;  3S16 I;  3S17 I;  4BXX I;  4QTU A;  4NB8 A;  4MXU A;  3VMH A;  1K73 1;  1WII A;  3J80 b;  3FKI I;  5IT9 f;  4BBS I;  5AN9 F;  3S1M I;  3FQQ A;  2F4M A;  2RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...