1KC82

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8200
3I55Z 1K731 1VQ41 1YJNZ 3CCL1 1Q7Y1 1K9M2 3CCVZ 3CMAZ 1K8A2 3G4S1 3CC71 1VQ91 1Q812 3CCMZ 3CCSZ 1YI21 1Q821 3CMEZ 1VQM1 1YHQZ 2QA4Z 3CCRZ 1YJ9Z 1JJ2Y 1KD12 3CPWY 3CCQZ 1VQPZ 1VQ51 2OTLZ 3OW2Y 3CCE1 1VQKZ 3CCJZ 1Q861 1KC81 1W2BY 1VQ61 1VQN1 3G6EZ 1K8A1 1VQ4Z 3CC2Z 1YITZ 1VQ81 1VQ71 1KQSY 1M1K2 1JJ2Z 1N8R2 3I561 2OTJZ 3G4SZ 3CC41 3CPWZ 1YJWZ 3CCUZ 1VQ9Z 3CXCZ 1QVFY 1KD11 3OW2Z 3I551 1VQO1 2QEX1 1YI2Z 1YJN1 1M902 1VQMZ 3CCV1 1YIJZ 3CMA1 1K732 1VQLZ 1KQSZ 3G711 1K9M1 3CCEZ 3CCS1 1NJI2 3CME1 1YHQ1 2QA41 3CCR1 3CCLZ 1QVGY 3CD61 1N8R1 1QVFZ 1Q811 1VQ8Z 3CC7Z 2OTL1 3CCJ1 1S721 1M901 1W2BZ 1VQOZ 2QEXZ 3CC21 1YIT1 1KC82 1Q862 1QVGZ 1Q7Y2 1VQ5Z 2OTJ1 1YJW1 1NJI1 3CCM1 3CCU1 1M1K1 3G71Z 1VQ6Z 1VQNZ 1YJ91 3CD6Z 1VQ7Z 1Q822 1YIJ1 3CCQ1 1VQP1 1VQL1 1VQK1 3I56Z 3CC4Z 3CXCY 3G6E1 1S72Z
chains in the Genus database with same CATH superfamily
4A3KI 1YJNZ 1ZB8A 3H3VJ 3S15I 3VB9A 1ZB9A 1YUAA 3CC71 3BG0B 5C44I 1YI21 1Q821 4E2YA 4A3MI 1VQM1 2R6MA 3CCRZ 1YJ9Z 2DE6A 1JJ2Y 2ZAEB 1PFTA 3LUSA 2K5RA 1RO0A 1VQ51 4RVGA 1WZNA 2PM9A 1VQ61 3JAMf 3M4OI 2QRDB 2M6NA 1VQ71 3HOWI 3J80f 2E2HI 3M3YI 4RV9A 4NBCA 1RO4A 1KD11 5D1PA 2RIQA 2RPRA 2IV2X 1YI2Z 5C3EI 1VQMZ 2VPYA 3CCV1 2IZ3A 4E33A 4MRIA 2F4MA 2GTIA 4NBDA 2DE7A 4E31A 3CCS1 2JIPA 3I07A 1YHQ1 3CD61 3CCLZ 2YADA 1X0TA 2JIQA 3NH5A 1FDIA 1USPB 2VUMI 3Q87A 4NB8A 2QKDA 2V8KA 2DE5A 4NBBA 1RLYA 3MZKB 1YIT1 3S1RI 1TWGI 4X6AI 2PMZA 4A3II 3NDIA 1Q7Y2 2R7ZI 1VLAA 3NFZA 2VF1A 5T6BA 1R9TI 1M1K1 4NH1C 3CD6Z 1Z03A 4Y52I 1VQL1 4RVHA 3I56Z 1LQLA 1WCMI 2RT9A 4MD7A 3BG1B 1SFOI 4MD8A 2OOXB 2JA7I 3J80b 2V8JA 2YU9I 1K8A2 4CL1A 4DQYB 2E2II 4MH4A 3S2HI 1VQ91 3PO3I 2QLVB 3S1QI 2AKLA 2HU9A 3CMEZ 2QA4Z 1WIIA 2RHBA 4A3GI 2W04A 3FQMA 1USPA 3IF8A 3CPWY 3S1MI 3VMHA 2NVTI 4NB9A 4Y7NI 3OW2Y 3F3FC 1I50I 3CCJZ 2K3RA 2Q51A 1Q861 2NAPA 1NUIA 1VQN1 3GTOI 3KIHA 3D9XA 3CC2Z 3GTMI 1M1K2 1ZH1A 3U50C 3KIFA 1N8R2 1K83I 3CC41 1YJWZ 4E2XA 3NH4A 3CCUZ 2JUBA 1VQ9Z 4QTUA 1QVFY 3I551 1SIWA 1TFIA 3NDJA 1M902 3D2LA 3GTQI 3CMA1 4HGZA 2I3CA 3S16I 3S2DI 4MONA 1KQSZ 2JA8I 3RZDI 4A3LI 2PK7A 3G711 1K9M1 1TWAI 4EWCA 1NJI2 3J7A4 2R93I 1QVGY 4A3CI 3K7AI 1Q811 5C4JI 4E2ZA 4A3DI 1S7MA 3CC7Z 2OTL1 5C4XI 1S721 2OZKA 2E9HA 2F4OA 5D1OB 3GTGI 1Q862 4NOZA 2M48A 1VQ5Z 2JS4A 2OTJ1 3CCM1 2H85A 3G71Z 1VQ6Z 3FKII 3TE5B 1VQ7Z 2V3VA 1Q822 2VUGA 3CCQ1 1YIJ1 4NBAA 1VQK1 4A3FI 2JA6I 5CM2M 1S72Z 1K731 3S17I 4NBFA 1K9M2 3CCVZ 2VPZA 1Y1WI 3EERA 1TWHI 3F3PC 4DGLA 4A3JI 1Q812 3CCMZ 3CCSZ 1NP6A 5A2Qf 2O53A 1YHQZ 2E2JI 1L1OC 2Q4ZA 2LIYA 4A3BI 1KD12 5FLXb 1I6HI 4NBHA 3CCQZ 3IFUA 4BBRI 3GTMS 4A93I 3CCE1 1VQKZ 1KC81 4RS4A 5T64A 2VPWA 3HOZI 3MONA 5D1OA 4E30A 2LFUA 2J6AA 1QF8A 1YITZ 2NVYI 1VQ81 1RO2A 1JJ2Z 3GCFA 4NBEA 4BXXI 1TWFI 1QXFA 1VQO1 3I4NI 2QEX1 1YJN1 1Y1VI 1WJ2A 5LL6f 1K732 1VQLZ 4HGYA 2LEXA 3CCEZ 2R92I 2IZ4A 5T67A 3VMIA 3CCR1 4XX2A 3TDHB 3HOXI 1VQ8Z 1W2BZ 2P28A 1VQOZ 4RVDA 4NFRA 2QEXZ 3GTLI 1KC82 2QRCB 5A2Qb 4E32A 2JIOA 1N2FA 5FLXf 3VTNA 1VQNZ 2JIMA 5IT9f 2B63I 4MXUA 3H0GI 3FQQA 1VQP1 1RNIA 3J81f 4BY1I 3CC4Z 1KRLA 3S1NI 4MD9A 2GTHA 5FLMI 3G6E1 3GTJI 2GU2A 3I55Z 1VQ41 3CCL1 1Q7Y1 2P3YA 2WB1A 3NH8A 2O4HA 3CQZI 3GTPI 3CMAZ 4A3EI 3G4S1 1WW9A 4BY7I 2NVQI 2JIRA 2OOYB 1DL6A 3PO2I 1X3ZA 3S14I 2AYDA 1YUKA 3RZOI 5IP9I 5IP7I 4S1TA 1VQPZ 1Z01A 2OTLZ 1W2BY 3PO3S 2HF1A 3G6EZ 3HOVI 3D6WA 1K8A1 4DK1A 2NVXI 1VQ4Z 4QTTA 3MZLB 1KQSY 3T4NB 3EEDA 1Y1VS 1X3WA 4HH4A 2KI7B 4AYBA 3I561 2OTJZ 3G4SZ 3CPWZ 3P5JB 1FDOA 3CXCZ 2KPIA 3OW2Z 3HOUI 1JWHC 1P9NA 1YIJZ 1ML8A 5IT9b 3ESWA 4RVFA 2JMOA 3J81b 2WAQA 3CME1 2VPXA 2QA41 3GTKI 3IX0A 1RQFA 1N8R1 1Y8CA 1QVFZ 2QREB 2E7ZA 2EGTA 2JA5I 3JAMb 3CCJ1 1M901 3HKZA 2JR6A 3QWUA 1TWCI 2G2KA 2RBLA 3CC21 1QYPA 2BJOA 1QVGZ 1I3QI 4BBSI 5AN9F 1YJW1 1NJI1 3CCU1 3HOYI 2JNYA 2Y0SA 1YJ91 4TNUA 3I4MI 1Z02A 1Q16A 3IR7A 4E2WA 2W03A 3VMGA 1AA6A 2V8IA 3CXCY 2V45A 4NBGA 2QR1B 3GKQA
chains in the Genus database with same CATH topology
4A3KI 1YJNZ 1ZB8A 3H3VJ 3S15I 3VB9A 1ZB9A 1YUAA 3CC71 3BG0B 5C44I 1YI21 1Q821 4E2YA 4A3MI 1VQM1 2R6MA 3CCRZ 1YJ9Z 2DE6A 1JJ2Y 2ZAEB 1PFTA 3LUSA 2K5RA 1RO0A 1VQ51 4RVGA 2PM9A 1VQ61 3JAMf 3M4OI 2QRDB 2M6NA 1VQ71 3HOWI 3J80f 2E2HI 3M3YI 4RV9A 4NBCA 1RO4A 1KD11 5D1PA 2RIQA 2RPRA 1YI2Z 5C3EI 1VQMZ 3CCV1 2IZ3A 4E33A 4MRIA 2F4MA 2GTIA 4NBDA 2DE7A 4E31A 3CCS1 3I07A 1YHQ1 3CD61 3CCLZ 2YADA 1X0TA 3NH5A 1USPB 2VUMI 3Q87A 4NB8A 2QKDA 2V8KA 2DE5A 4NBBA 1RLYA 3MZKB 1YIT1 3S1RI 1TWGI 4X6AI 2PMZA 4A3II 3NDIA 1Q7Y2 2R7ZI 1VLAA 3NFZA 2VF1A 5T6BA 1R9TI 1M1K1 4NH1C 3CD6Z 1Z03A 4Y52I 1VQL1 4RVHA 3I56Z 1LQLA 1WCMI 2RT9A 4MD7A 3BG1B 1SFOI 4MD8A 2OOXB 2JA7I 3J80b 2V8JA 2YU9I 1K8A2 4CL1A 4DQYB 2E2II 4MH4A 3S2HI 1VQ91 3PO3I 2QLVB 3S1QI 2AKLA 2HU9A 3CMEZ 2QA4Z 1WIIA 2RHBA 4A3GI 2W04A 3FQMA 1USPA 3IF8A 3CPWY 3S1MI 3VMHA 2NVTI 4NB9A 4Y7NI 3OW2Y 3F3FC 1I50I 3CCJZ 2K3RA 2Q51A 1Q861 1NUIA 1VQN1 3GTOI 3KIHA 3D9XA 3CC2Z 3GTMI 1M1K2 1ZH1A 3U50C 3KIFA 1N8R2 1K83I 3CC41 1YJWZ 4E2XA 3NH4A 3CCUZ 2JUBA 1VQ9Z 4QTUA 1QVFY 3I551 1TFIA 3NDJA 1M902 3GTQI 3CMA1 4HGZA 2I3CA 3S16I 3S2DI 4MONA 1KQSZ 2JA8I 3RZDI 4A3LI 2PK7A 3G711 1K9M1 1TWAI 4EWCA 1NJI2 3J7A4 2R93I 1QVGY 4A3CI 3K7AI 1Q811 5C4JI 4E2ZA 4A3DI 1S7MA 3CC7Z 2OTL1 5C4XI 1S721 2OZKA 2E9HA 2F4OA 5D1OB 3GTGI 1Q862 4NOZA 2M48A 1VQ5Z 2JS4A 2OTJ1 3CCM1 2H85A 3G71Z 1VQ6Z 3FKII 3TE5B 1VQ7Z 1Q822 2VUGA 3CCQ1 1YIJ1 4NBAA 1VQK1 4A3FI 2JA6I 5CM2M 1S72Z 1K731 3S17I 4NBFA 1K9M2 3CCVZ 1Y1WI 3EERA 1TWHI 3F3PC 4DGLA 4A3JI 1Q812 3CCMZ 3CCSZ 1NP6A 5A2Qf 2O53A 1YHQZ 2E2JI 1L1OC 2Q4ZA 2LIYA 4A3BI 1KD12 5FLXb 1I6HI 4NBHA 3CCQZ 3IFUA 4BBRI 3GTMS 4A93I 3CCE1 1VQKZ 1KC81 4RS4A 5T64A 3HOZI 3MONA 5D1OA 4E30A 2LFUA 2J6AA 1QF8A 1YITZ 2NVYI 1VQ81 1RO2A 1JJ2Z 3GCFA 4NBEA 4BXXI 1TWFI 1VQO1 3I4NI 2QEX1 1YJN1 1Y1VI 5LL6f 1K732 1VQLZ 4HGYA 3CCEZ 2R92I 2IZ4A 5T67A 3VMIA 3CCR1 4XX2A 3TDHB 3HOXI 1VQ8Z 1W2BZ 2P28A 1VQOZ 4RVDA 4NFRA 2QEXZ 3GTLI 1KC82 2QRCB 5A2Qb 4E32A 1N2FA 5FLXf 3VTNA 1VQNZ 5IT9f 2B63I 4MXUA 3H0GI 3FQQA 1VQP1 1RNIA 3J81f 4BY1I 3CC4Z 1KRLA 3S1NI 4MD9A 2GTHA 5FLMI 3G6E1 3GTJI 2GU2A 3I55Z 1VQ41 3CCL1 1Q7Y1 2P3YA 2WB1A 3NH8A 2O4HA 3CQZI 3GTPI 3CMAZ 4A3EI 3G4S1 1WW9A 4BY7I 2NVQI 2OOYB 1DL6A 3PO2I 1X3ZA 3S14I 1YUKA 3RZOI 5IP9I 5IP7I 4S1TA 1VQPZ 1Z01A 2OTLZ 1W2BY 3PO3S 2HF1A 3G6EZ 3HOVI 3D6WA 1K8A1 4DK1A 2NVXI 1VQ4Z 4QTTA 3MZLB 1KQSY 3T4NB 3EEDA 1Y1VS 1X3WA 4HH4A 2KI7B 4AYBA 3I561 2OTJZ 3G4SZ 3CPWZ 3P5JB 3CXCZ 2KPIA 3OW2Z 3HOUI 1JWHC 1P9NA 1YIJZ 1ML8A 5IT9b 3ESWA 4RVFA 2JMOA 3J81b 2WAQA 3CME1 2QA41 3GTKI 3IX0A 1RQFA 1N8R1 1QVFZ 2QREB 2EGTA 2JA5I 3JAMb 3CCJ1 1M901 3HKZA 2JR6A 3QWUA 1TWCI 2G2KA 2RBLA 3CC21 1QYPA 2BJOA 1QVGZ 1I3QI 4BBSI 5AN9F 1YJW1 1NJI1 3CCU1 3HOYI 2JNYA 2Y0SA 1YJ91 4TNUA 3I4MI 1Z02A 4E2WA 2W03A 3VMGA 2V8IA 3CXCY 4NBGA 2QR1B 3GKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Z;  1K73 1;  1VQ4 1;  1YJN Z;  3CCL 1;  1Q7Y 1;  1K9M 2;  3CCV Z;  3CMA Z;  1K8A 2;  3G4S 1;  3CC7 1;  1VQ9 1;  1Q81 2;  3CCM Z;  3CCS Z;  1YI2 1;  1Q82 1;  3CME Z;  1VQM 1;  1YHQ Z;  2QA4 Z;  3CCR Z;  1YJ9 Z;  1JJ2 Y;  1KD1 2;  3CPW Y;  3CCQ Z;  1VQP Z;  1VQ5 1;  2OTL Z;  3OW2 Y;  3CCE 1;  1VQK Z;  3CCJ Z;  1Q86 1;  1KC8 1;  1W2B Y;  1VQ6 1;  1VQN 1;  3G6E Z;  1K8A 1;  1VQ4 Z;  3CC2 Z;  1YIT Z;  1VQ8 1;  1VQ7 1;  1KQS Y;  1M1K 2;  1JJ2 Z;  1N8R 2;  3I56 1;  2OTJ Z;  3G4S Z;  3CC4 1;  3CPW Z;  1YJW Z;  3CCU Z;  1VQ9 Z;  3CXC Z;  1QVF Y;  1KD1 1;  3OW2 Z;  3I55 1;  1VQO 1;  2QEX 1;  1YI2 Z;  1YJN 1;  1M90 2;  1VQM Z;  3CCV 1;  1YIJ Z;  3CMA 1;  1K73 2;  1VQL Z;  1KQS Z;  3G71 1;  1K9M 1;  3CCE Z;  3CCS 1;  1NJI 2;  3CME 1;  1YHQ 1;  2QA4 1;  3CCR 1;  3CCL Z;  1QVG Y;  3CD6 1;  1N8R 1;  1QVF Z;  1Q81 1;  1VQ8 Z;  3CC7 Z;  2OTL 1;  3CCJ 1;  1S72 1;  1M90 1;  1W2B Z;  1VQO Z;  2QEX Z;  3CC2 1;  1YIT 1;  1KC8 2;  1Q86 2;  1QVG Z;  1Q7Y 2;  1VQ5 Z;  2OTJ 1;  1YJW 1;  1NJI 1;  3CCM 1;  3CCU 1;  1M1K 1;  3G71 Z;  1VQ6 Z;  1VQN Z;  1YJ9 1;  3CD6 Z;  1VQ7 Z;  1Q82 2;  1YIJ 1;  3CCQ 1;  1VQP 1;  1VQL 1;  1VQK 1;  3I56 Z;  3CC4 Z;  3CXC Y;  3G6E 1;  1S72 Z; 
#chains in the Genus database with same CATH topology
 4A3K I;  1YJN Z;  1ZB8 A;  3H3V J;  3S15 I;  3VB9 A;  1ZB9 A;  1YUA A;  3CC7 1;  3BG0 B;  5C44 I;  1YI2 1;  1Q82 1;  4E2Y A;  4A3M I;  1VQM 1;  2R6M A;  3CCR Z;  1YJ9 Z;  2DE6 A;  1JJ2 Y;  2ZAE B;  1PFT A;  3LUS A;  2K5R A;  1RO0 A;  1VQ5 1;  4RVG A;  1WZN A;  2PM9 A;  1VQ6 1;  3JAM f;  3M4O I;  2QRD B;  2M6N A;  1VQ7 1;  3HOW I;  3J80 f;  2E2H I;  3M3Y I;  4RV9 A;  4NBC A;  1RO4 A;  1KD1 1;  5D1P A;  2RIQ A;  2RPR A;  2IV2 X;  1YI2 Z;  5C3E I;  1VQM Z;  2VPY A;  3CCV 1;  2IZ3 A;  4E33 A;  4MRI A;  2F4M A;  2GTI A;  4NBD A;  2DE7 A;  4E31 A;  3CCS 1;  2JIP A;  3I07 A;  1YHQ 1;  3CD6 1;  3CCL Z;  2YAD A;  1X0T A;  2JIQ A;  3NH5 A;  1FDI A;  1USP B;  2VUM I;  3Q87 A;  4NB8 A;  2QKD A;  2V8K A;  2DE5 A;  4NBB A;  1RLY A;  3MZK B;  1YIT 1;  3S1R I;  1TWG I;  4X6A I;  2PMZ A;  4A3I I;  3NDI A;  1Q7Y 2;  2R7Z I;  1VLA A;  3NFZ A;  2VF1 A;  5T6B A;  1R9T I;  1M1K 1;  4NH1 C;  3CD6 Z;  1Z03 A;  4Y52 I;  1VQL 1;  4RVH A;  3I56 Z;  1LQL A;  1WCM I;  2RT9 A;  4MD7 A;  3BG1 B;  1SFO I;  4MD8 A;  2OOX B;  2JA7 I;  3J80 b;  2V8J A;  2YU9 I;  1K8A 2;  4CL1 A;  4DQY B;  2E2I I;  4MH4 A;  3S2H I;  1VQ9 1;  3PO3 I;  2QLV B;  3S1Q I;  2AKL A;  2HU9 A;  3CME Z;  2QA4 Z;  1WII A;  2RHB A;  4A3G I;  2W04 A;  3FQM A;  1USP A;  3IF8 A;  3CPW Y;  3S1M I;  3VMH A;  2NVT I;  4NB9 A;  4Y7N I;  3OW2 Y;  3F3F C;  1I50 I;  3CCJ Z;  2K3R A;  2Q51 A;  1Q86 1;  2NAP A;  1NUI A;  1VQN 1;  3GTO I;  3KIH A;  3D9X A;  3CC2 Z;  3GTM I;  1M1K 2;  1ZH1 A;  3U50 C;  3KIF A;  1N8R 2;  1K83 I;  3CC4 1;  1YJW Z;  4E2X A;  3NH4 A;  3CCU Z;  2JUB A;  1VQ9 Z;  4QTU A;  1QVF Y;  3I55 1;  1SIW A;  1TFI A;  3NDJ A;  1M90 2;  3D2L A;  3GTQ I;  3CMA 1;  4HGZ A;  2I3C A;  3S16 I;  3S2D I;  4MON A;  1KQS Z;  2JA8 I;  3RZD I;  4A3L I;  2PK7 A;  3G71 1;  1K9M 1;  1TWA I;  4EWC A;  1NJI 2;  3J7A 4;  2R93 I;  1QVG Y;  4A3C I;  3K7A I;  1Q81 1;  5C4J I;  4E2Z A;  4A3D I;  1S7M A;  3CC7 Z;  2OTL 1;  5C4X I;  1S72 1;  2OZK A;  2E9H A;  2F4O A;  5D1O B;  3GTG I;  1Q86 2;  4NOZ A;  2M48 A;  1VQ5 Z;  2JS4 A;  2OTJ 1;  3CCM 1;  2H85 A;  3G71 Z;  1VQ6 Z;  3FKI I;  3TE5 B;  1VQ7 Z;  2V3V A;  1Q82 2;  2VUG A;  3CCQ 1;  1YIJ 1;  4NBA A;  1VQK 1;  4A3F I;  2JA6 I;  5CM2 M;  1S72 Z;  1K73 1;  3S17 I;  4NBF A;  1K9M 2;  3CCV Z;  2VPZ A;  1Y1W I;  3EER A;  1TWH I;  3F3P C;  4DGL A;  4A3J I;  1Q81 2;  3CCM Z;  3CCS Z;  1NP6 A;  5A2Q f;  2O53 A;  1YHQ Z;  2E2J I;  1L1O C;  2Q4Z A;  2LIY A;  4A3B I;  1KD1 2;  5FLX b;  1I6H I;  4NBH A;  3CCQ Z;  3IFU A;  4BBR I;  3GTM S;  4A93 I;  3CCE 1;  1VQK Z;  1KC8 1;  4RS4 A;  5T64 A;  2VPW A;  3HOZ I;  3MON A;  5D1O A;  4E30 A;  2LFU A;  2J6A A;  1QF8 A;  1YIT Z;  2NVY I;  1VQ8 1;  1RO2 A;  1JJ2 Z;  3GCF A;  4NBE A;  4BXX I;  1TWF I;  1QXF A;  1VQO 1;  3I4N I;  2QEX 1;  1YJN 1;  1Y1V I;  1WJ2 A;  5LL6 f;  1K73 2;  1VQL Z;  4HGY A;  2LEX A;  3CCE Z;  2R92 I;  2IZ4 A;  5T67 A;  3VMI A;  3CCR 1;  4XX2 A;  3TDH B;  3HOX I;  1VQ8 Z;  1W2B Z;  2P28 A;  1VQO Z;  4RVD A;  4NFR A;  2QEX Z;  3GTL I;  1KC8 2;  2QRC B;  5A2Q b;  4E32 A;  2JIO A;  1N2F A;  5FLX f;  3VTN A;  1VQN Z;  2JIM A;  5IT9 f;  2B63 I;  4MXU A;  3H0G I;  3FQQ A;  1VQP 1;  1RNI A;  3J81 f;  4BY1 I;  3CC4 Z;  1KRL A;  3S1N I;  4MD9 A;  2GTH A;  5FLM I;  3G6E 1;  3GTJ I;  2GU2 A;  3I55 Z;  1VQ4 1;  3CCL 1;  1Q7Y 1;  2P3Y A;  2WB1 A;  3NH8 A;  2O4H A;  3CQZ I;  3GTP I;  3CMA Z;  4A3E I;  3G4S 1;  1WW9 A;  4BY7 I;  2NVQ I;  2JIR A;  2OOY B;  1DL6 A;  3PO2 I;  1X3Z A;  3S14 I;  2AYD A;  1YUK A;  3RZO I;  5IP9 I;  5IP7 I;  4S1T A;  1VQP Z;  1Z01 A;  2OTL Z;  1W2B Y;  3PO3 S;  2HF1 A;  3G6E Z;  3HOV I;  3D6W A;  1K8A 1;  4DK1 A;  2NVX I;  1VQ4 Z;  4QTT A;  3MZL B;  1KQS Y;  3T4N B;  3EED A;  1Y1V S;  1X3W A;  4HH4 A;  2KI7 B;  4AYB A;  3I56 1;  2OTJ Z;  3G4S Z;  3CPW Z;  3P5J B;  1FDO A;  3CXC Z;  2KPI A;  3OW2 Z;  3HOU I;  1JWH C;  1P9N A;  1YIJ Z;  1ML8 A;  5IT9 b;  3ESW A;  4RVF A;  2JMO A;  3J81 b;  2WAQ A;  3CME 1;  2VPX A;  2QA4 1;  3GTK I;  3IX0 A;  1RQF A;  1N8R 1;  1Y8C A;  1QVF Z;  2QRE B;  2E7Z A;  2EGT A;  2JA5 I;  3JAM b;  3CCJ 1;  1M90 1;  3HKZ A;  2JR6 A;  3QWU A;  1TWC I;  2G2K A;  2RBL A;  3CC2 1;  1QYP A;  2BJO A;  1QVG Z;  1I3Q I;  4BBS I;  5AN9 F;  1YJW 1;  1NJI 1;  3CCU 1;  3HOY I;  2JNY A;  2Y0S A;  1YJ9 1;  4TNU A;  3I4M I;  1Z02 A;  1Q16 A;  3IR7 A;  4E2W A;  2W03 A;  3VMG A;  1AA6 A;  2V8I A;  3CXC Y;  2V45 A;  4NBG A;  2QR1 B;  3GKQ A; 
#chains in the Genus database with same CATH homology
 4A3K I;  1YJN Z;  1ZB8 A;  3H3V J;  3S15 I;  3VB9 A;  1ZB9 A;  1YUA A;  3CC7 1;  3BG0 B;  5C44 I;  1YI2 1;  1Q82 1;  4E2Y A;  4A3M I;  1VQM 1;  2R6M A;  3CCR Z;  1YJ9 Z;  2DE6 A;  1JJ2 Y;  2ZAE B;  1PFT A;  3LUS A;  2K5R A;  1RO0 A;  1VQ5 1;  4RVG A;  2PM9 A;  1VQ6 1;  3JAM f;  3M4O I;  2QRD B;  2M6N A;  1VQ7 1;  3HOW I;  3J80 f;  2E2H I;  3M3Y I;  4RV9 A;  4NBC A;  1RO4 A;  1KD1 1;  5D1P A;  2RIQ A;  2RPR A;  1YI2 Z;  5C3E I;  1VQM Z;  3CCV 1;  2IZ3 A;  4E33 A;  4MRI A;  2F4M A;  2GTI A;  4NBD A;  2DE7 A;  4E31 A;  3CCS 1;  3I07 A;  1YHQ 1;  3CD6 1;  3CCL Z;  2YAD A;  1X0T A;  3NH5 A;  1USP B;  2VUM I;  3Q87 A;  4NB8 A;  2QKD A;  2V8K A;  2DE5 A;  4NBB A;  1RLY A;  3MZK B;  1YIT 1;  3S1R I;  1TWG I;  4X6A I;  2PMZ A;  4A3I I;  3NDI A;  1Q7Y 2;  2R7Z I;  1VLA A;  3NFZ A;  2VF1 A;  5T6B A;  1R9T I;  1M1K 1;  4NH1 C;  3CD6 Z;  1Z03 A;  4Y52 I;  1VQL 1;  4RVH A;  3I56 Z;  1LQL A;  1WCM I;  2RT9 A;  4MD7 A;  3BG1 B;  1SFO I;  4MD8 A;  2OOX B;  2JA7 I;  3J80 b;  2V8J A;  2YU9 I;  1K8A 2;  4CL1 A;  4DQY B;  2E2I I;  4MH4 A;  3S2H I;  1VQ9 1;  3PO3 I;  2QLV B;  3S1Q I;  2AKL A;  2HU9 A;  3CME Z;  2QA4 Z;  1WII A;  2RHB A;  4A3G I;  2W04 A;  3FQM A;  1USP A;  3IF8 A;  3CPW Y;  3S1M I;  3VMH A;  2NVT I;  4NB9 A;  4Y7N I;  3OW2 Y;  3F3F C;  1I50 I;  3CCJ Z;  2K3R A;  2Q51 A;  1Q86 1;  1NUI A;  1VQN 1;  3GTO I;  3KIH A;  3D9X A;  3CC2 Z;  3GTM I;  1M1K 2;  1ZH1 A;  3U50 C;  3KIF A;  1N8R 2;  1K83 I;  3CC4 1;  1YJW Z;  4E2X A;  3NH4 A;  3CCU Z;  2JUB A;  1VQ9 Z;  4QTU A;  1QVF Y;  3I55 1;  1TFI A;  3NDJ A;  1M90 2;  3GTQ I;  3CMA 1;  4HGZ A;  2I3C A;  3S16 I;  3S2D I;  4MON A;  1KQS Z;  2JA8 I;  3RZD I;  4A3L I;  2PK7 A;  3G71 1;  1K9M 1;  1TWA I;  4EWC A;  1NJI 2;  3J7A 4;  2R93 I;  1QVG Y;  4A3C I;  3K7A I;  1Q81 1;  5C4J I;  4E2Z A;  4A3D I;  1S7M A;  3CC7 Z;  2OTL 1;  5C4X I;  1S72 1;  2OZK A;  2E9H A;  2F4O A;  5D1O B;  3GTG I;  1Q86 2;  4NOZ A;  2M48 A;  1VQ5 Z;  2JS4 A;  2OTJ 1;  3CCM 1;  2H85 A;  3G71 Z;  1VQ6 Z;  3FKI I;  3TE5 B;  1VQ7 Z;  1Q82 2;  2VUG A;  3CCQ 1;  1YIJ 1;  4NBA A;  1VQK 1;  4A3F I;  2JA6 I;  5CM2 M;  1S72 Z;  1K73 1;  3S17 I;  4NBF A;  1K9M 2;  3CCV Z;  1Y1W I;  3EER A;  1TWH I;  3F3P C;  4DGL A;  4A3J I;  1Q81 2;  3CCM Z;  3CCS Z;  1NP6 A;  5A2Q f;  2O53 A;  1YHQ Z;  2E2J I;  1L1O C;  2Q4Z A;  2LIY A;  4A3B I;  1KD1 2;  5FLX b;  1I6H I;  4NBH A;  3CCQ Z;  3IFU A;  4BBR I;  3GTM S;  4A93 I;  3CCE 1;  1VQK Z;  1KC8 1;  4RS4 A;  5T64 A;  3HOZ I;  3MON A;  5D1O A;  4E30 A;  2LFU A;  2J6A A;  1QF8 A;  1YIT Z;  2NVY I;  1VQ8 1;  1RO2 A;  1JJ2 Z;  3GCF A;  4NBE A;  4BXX I;  1TWF I;  1VQO 1;  3I4N I;  2QEX 1;  1YJN 1;  1Y1V I;  5LL6 f;  1K73 2;  1VQL Z;  4HGY A;  3CCE Z;  2R92 I;  2IZ4 A;  5T67 A;  3VMI A;  3CCR 1;  4XX2 A;  3TDH B;  3HOX I;  1VQ8 Z;  1W2B Z;  2P28 A;  1VQO Z;  4RVD A;  4NFR A;  2QEX Z;  3GTL I;  1KC8 2;  2QRC B;  5A2Q b;  4E32 A;  1N2F A;  5FLX f;  3VTN A;  1VQN Z;  5IT9 f;  2B63 I;  4MXU A;  3H0G I;  3FQQ A;  1VQP 1;  1RNI A;  3J81 f;  4BY1 I;  3CC4 Z;  1KRL A;  3S1N I;  4MD9 A;  2GTH A;  5FLM I;  3G6E 1;  3GTJ I;  2GU2 A;  3I55 Z;  1VQ4 1;  3CCL 1;  1Q7Y 1;  2P3Y A;  2WB1 A;  3NH8 A;  2O4H A;  3CQZ I;  3GTP I;  3CMA Z;  4A3E I;  3G4S 1;  1WW9 A;  4BY7 I;  2NVQ I;  2OOY B;  1DL6 A;  3PO2 I;  1X3Z A;  3S14 I;  1YUK A;  3RZO I;  5IP9 I;  5IP7 I;  4S1T A;  1VQP Z;  1Z01 A;  2OTL Z;  1W2B Y;  3PO3 S;  2HF1 A;  3G6E Z;  3HOV I;  3D6W A;  1K8A 1;  4DK1 A;  2NVX I;  1VQ4 Z;  4QTT A;  3MZL B;  1KQS Y;  3T4N B;  3EED A;  1Y1V S;  1X3W A;  4HH4 A;  2KI7 B;  4AYB A;  3I56 1;  2OTJ Z;  3G4S Z;  3CPW Z;  3P5J B;  3CXC Z;  2KPI A;  3OW2 Z;  3HOU I;  1JWH C;  1P9N A;  1YIJ Z;  1ML8 A;  5IT9 b;  3ESW A;  4RVF A;  2JMO A;  3J81 b;  2WAQ A;  3CME 1;  2QA4 1;  3GTK I;  3IX0 A;  1RQF A;  1N8R 1;  1QVF Z;  2QRE B;  2EGT A;  2JA5 I;  3JAM b;  3CCJ 1;  1M90 1;  3HKZ A;  2JR6 A;  3QWU A;  1TWC I;  2G2K A;  2RBL A;  3CC2 1;  1QYP A;  2BJO A;  1QVG Z;  1I3Q I;  4BBS I;  5AN9 F;  1YJW 1;  1NJI 1;  3CCU 1;  3HOY I;  2JNY A;  2Y0S A;  1YJ9 1;  4TNU A;  3I4M I;  1Z02 A;  4E2W A;  2W03 A;  3VMG A;  2V8I A;  3CXC Y;  4NBG A;  2QR1 B;  3GKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...