1KC82

Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
56
structure length
56
Chain Sequence
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
pubmed doi rcsb
total genus 9
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01907 Ribosomal_L37e Ribosomal protein L37e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1kc8200
1NJI1 1VQ7Z 2QEX1 1Q7Y1 3CCRZ 1K9M1 1YHQZ 2OTJ1 1M902 3CC7Z 1M901 1VQ81 1KQSZ 3I551 3CCVZ 3CME1 1YIT1 1QVGZ 1QVGY 3G4S1 1KC82 1VQ8Z 3CCQ1 1VQN1 1KC81 3CMEZ 3CC4Z 1YITZ 3G6E1 3G4SZ 1VQNZ 3CCUZ 1YJN1 3G6EZ 2QEXZ 1YIJ1 1W2BZ 2OTJZ 1W2BY 1S721 2OTL1 1Q822 1Q812 1YJNZ 2QA41 1YIJZ 3I561 1VQ91 1Q821 1Q862 1Q811 1VQ61 3I55Z 3CPWY 1QVFZ 1K8A2 1Q861 1S72Z 2OTLZ 1YJW1 1QVFY 2QA4Z 1K8A1 3I56Z 1VQ9Z 1KD12 1N8R2 3CCQZ 3CD61 1VQ6Z 1KD11 1N8R1 3CCE1 1JJ2Z 1YJWZ 1YI21 1VQM1 1JJ2Y 3CMA1 1M1K2 1K732 3CD6Z 3CCJ1 3CXCY 1K731 3CCM1 1YI2Z 3CC21 1VQMZ 3CMAZ 1VQP1 3CCS1 1YJ91 3OW2Y 1K9M2 3CPWZ 3CCJZ 3CCMZ 1VQ41 3CC2Z 1VQO1 3CCV1 1VQPZ 3CCSZ 1YJ9Z 3CCL1 1VQK1 3G711 1VQ4Z 1VQL1 1VQOZ 1KQSY 3CC41 1VQ51 1VQ71 3CCLZ 3CXCZ 3CCR1 1M1K1 1VQKZ 1YHQ1 3CCEZ 3G71Z 1NJI2 3CC71 1VQLZ 3OW2Z 1Q7Y2 1VQ5Z 3CCU1
chains in the Genus database with same CATH superfamily
2Y0SA 1VQ7Z 3EERA 5FLMI 1YUKA 5D1PA 2F4MA 3CCVZ 4BY7I 3MZLB 2R92I 1YIT1 1QVGZ 2NVQI 5IP9I 3TDHB 1QVGY 3M4OI 2OOXB 1KC81 2NVYI 2VUMI 2JIOA 3NDIA 2IZ3A 1VQNZ 2KPIA 2QRDB 2QREB 4MD7A 1YIJ1 1X0TA 5AN9F 4E2ZA 1WCMI 1YJNZ 1QF8A 1VQ91 5IT9f 5FLXb 1VQ61 5IT9b 3CPWY 1Q861 1X3WA 2PMZA 4NBEA 3GCFA 3I56Z 2YADA 3D2LA 3CD61 4A3II 2R6MA 4A3EI 3I4NI 2JS4A 2E9HA 5C44I 4Y52I 3KIFA 1WJ2A 1K732 1Z01A 4HGYA 4HGZA 3HOUI 3MZKB 2M48A 1I50I 2JIRA 3CMAZ 3CCS1 2P3YA 5CM2M 4A3FI 3NH5A 3NH4A 2JA8I 1USPB 4AYBA 3HOXI 3CCMZ 3CC2Z 1VQO1 1VLAA 3JAMb 4A3BI 2Q4ZA 4E2XA 2E2HI 4BXXI 3VMIA 1VQK1 4NB9A 3LUSA 4E32A 1VQL1 3D6WA 1KQSY 4QTUA 3CC41 4QTTA 1KRLA 2JR6A 2W03A 3RZOI 4MONA 4NOZA 2DE6A 1YHQ1 4RS4A 3G71Z 3NH8A 2V45A 3D9XA 1NJI1 1Z02A 4A3CI 3HOZI 1Q7Y1 1TWHI 3CCRZ 2OTJ1 2PM9A 5C4JI 2JIQA 4A3DI 2B63I 1M901 2R7ZI 2IV2X 1VQ81 4HH4A 1RQFA 5T64A 1RO2A 3GTMS 3I4MI 2K3RA 1NUIA 1KC82 3GTKI 3CCQ1 1Z03A 3VTNA 2VPXA 1YITZ 3S15I 3FQMA 2PK7A 3GTMI 1K83I 3S1NI 1Y1VS 2QEXZ 1Y1WI 2JA6I 4RVDA 4E33A 4X6AI 1W2BZ 1TFIA 1W2BY 2Q51A 2OTL1 2QLVB 2VPWA 1YIJZ 1Q821 2E2II 1Q862 3MONA 3J7A4 3IX0A 1Y1VI 3I55Z 3H3VJ 1K8A1 1VQ9Z 2E7ZA 1VQ6Z 1KD11 1N8R1 1YI21 1VQM1 1M1K2 4NH1C 3CD6Z 3CCJ1 2AYDA 2WB1A 4MRIA 5FLXf 1S7MA 1VQP1 3EEDA 3OW2Y 3GTPI 1K9M2 3GTOI 3CPWZ 1Q16A 3S17I 3Q87A 3GTQI 3BG0B 1QXFA 3CCV1 4NBBA 2J6AA 3CCSZ 4S1TA 1N2FA 2GTIA 1VQOZ 4NBAA 1AA6A 2OOYB 3J80b 1M1K1 1VQKZ 2V3VA 5IP7I 2KI7B 3CCEZ 1NJI2 1RO4A 3CC71 1VQLZ 1Q7Y2 1RLYA 1DL6A 1X3ZA 4NBDA 3JAMf 1K9M1 1YHQZ 2JNYA 3S2HI 4E2WA 1M902 2W04A 3NDJA 2V8IA 2JUBA 2VUGA 1PFTA 2VF1A 3S16I 1KQSZ 1SIWA 3GTLI 3S1MI 3CME1 2QR1B 2HF1A 3G4S1 4BBSI 4DK1A 2JMOA 1VQ8Z 4A3LI 3GTGI 3P5JB 2NVTI 2RPRA 3G6E1 3J81b 5A2Qb 3IF8A 2NAPA 4BBRI 3VB9A 1ZB9A 3NFZA 4NBCA 3CCUZ 3GKQA 5T67A 4NB8A 2BJOA 3FQQA 1QYPA 4A93I 1S721 1Q822 2QA41 3PO2I 2DE5A 4NBFA 1Q811 3BG1B 1QVFZ 1K8A2 2OTLZ 1YJW1 1QVFY 3HOYI 1KD12 1N8R2 2RHBA 4DGLA 3TE5B 1JJ2Z 5D1OA 1JJ2Y 4A3GI 2HU9A 3I07A 3CXCY 3CQZI 2DE7A 2OZKA 1YI2Z 1VQMZ 1RO0A 2NVXI 3ESWA 1YJ91 2RT9A 3KIHA 3F3PC 3CCJZ 2ZAEB 4RVGA 4E2YA 3IR7A 3T4NB 4EWCA 1VQ41 2H85A 1ZB8A 3GTJI 2WAQA 1VQPZ 4E31A 4DQYB 3CCL1 5LL6f 2IZ4A 4MH4A 1RNIA 1TWGI 1VQ51 1ZH1A 1VQ71 3S14I 3S1QI 3HKZA 1JWHC 4BY1I 2P28A 3OW2Z 4RV9A 1ML8A 2JIPA 4XX2A 2LIYA 2QEX1 2YU9I 1R9TI 1NP6A 2O4HA 4RVHA 4A3MI 3CC7Z 5C3EI 1WIIA 2RBLA 1WZNA 2GTHA 2VPZA 3I551 1FDIA 2GU2A 2V8KA 3K7AI 2QRCB 3J80f 2I3CA 2O53A 3HOVI 4MD9A 1VQN1 4NBHA 3CMEZ 3CC4Z 4MD8A 3M3YI 1I3QI 3G4SZ 1LQLA 2QKDA 4Y7NI 4A3JI 2M6NA 4MXUA 1YJN1 3G6EZ 4E30A 3S1RI 2OTJZ 2AKLA 1FDOA 3IFUA 3VMHA 5D1OB 1Q812 3VMGA 3I561 1TWFI 3U50C 2K5RA 3PO3S 3RZDI 3J81f 5A2Qf 2LFUA 1S72Z 2QA4Z 2JIMA 4CL1A 2EGTA 1P9NA 3CCQZ 3H0GI 2VPYA 1TWCI 4TNUA 3CCE1 2RIQA 1TWAI 1YJWZ 1WW9A 3CMA1 4NBGA 3PO3I 2G2KA 1K731 3CCM1 4A3KI 1I6HI 3CC21 5C4XI 4RVFA 1L1OC 2V8JA 3HOWI 3FKII 2LEXA 3F3FC 2JA5I 1YJ9Z 3G711 1VQ4Z 3S2DI 4NFRA 1YUAA 1SFOI 3CCLZ 3CXCZ 2F4OA 3CCR1 2JA7I 1USPA 1Y8CA 5T6BA 2R93I 2E2JI 3QWUA 1VQ5Z 3CCU1
chains in the Genus database with same CATH topology
2Y0SA 1VQ7Z 3EERA 5FLMI 1YUKA 5D1PA 2F4MA 3CCVZ 4BY7I 3MZLB 2R92I 1YIT1 1QVGZ 2NVQI 5IP9I 3TDHB 1QVGY 3M4OI 2OOXB 1KC81 2NVYI 2VUMI 3NDIA 2IZ3A 1VQNZ 2KPIA 2QRDB 2QREB 4MD7A 1YIJ1 1X0TA 5AN9F 4E2ZA 1WCMI 1YJNZ 1QF8A 1VQ91 5IT9f 5FLXb 1VQ61 5IT9b 3CPWY 1Q861 1X3WA 2PMZA 4NBEA 3GCFA 3I56Z 2YADA 3CD61 4A3II 2R6MA 4A3EI 3I4NI 2JS4A 2E9HA 5C44I 4Y52I 3KIFA 1K732 3HOUI 1Z01A 4HGYA 4HGZA 3MZKB 2M48A 1I50I 3CMAZ 3CCS1 4A3FI 2P3YA 5CM2M 3NH5A 3NH4A 2JA8I 1USPB 4AYBA 3HOXI 3CCMZ 3CC2Z 1VQO1 1VLAA 3JAMb 4A3BI 2Q4ZA 4E2XA 2E2HI 4BXXI 3VMIA 1VQK1 4NB9A 3LUSA 4E32A 1VQL1 3D6WA 1KQSY 4QTUA 3CC41 4QTTA 1KRLA 2JR6A 2W03A 3RZOI 4MONA 4NOZA 2DE6A 1YHQ1 4RS4A 3G71Z 3NH8A 3D9XA 1NJI1 1Z02A 4A3CI 3HOZI 1Q7Y1 1TWHI 3CCRZ 2OTJ1 2PM9A 5C4JI 4A3DI 2B63I 1M901 2R7ZI 1VQ81 4HH4A 1RQFA 5T64A 1RO2A 3GTMS 3I4MI 2K3RA 1NUIA 1KC82 3GTKI 3CCQ1 1Z03A 3VTNA 1YITZ 3S15I 3FQMA 2PK7A 3GTMI 1K83I 3S1NI 1Y1VS 2QEXZ 1Y1WI 2JA6I 4RVDA 4E33A 4X6AI 1W2BZ 1TFIA 1W2BY 2Q51A 2OTL1 2QLVB 1YIJZ 1Q821 2E2II 1Q862 3MONA 3J7A4 3IX0A 1Y1VI 3I55Z 3H3VJ 1K8A1 1VQ9Z 1VQ6Z 1KD11 1N8R1 1YI21 1VQM1 1M1K2 4NH1C 3CD6Z 3CCJ1 2WB1A 4MRIA 5FLXf 1S7MA 1VQP1 3EEDA 3OW2Y 3GTPI 1K9M2 3GTOI 3CPWZ 3S17I 3Q87A 3GTQI 3BG0B 3CCV1 4NBBA 2J6AA 3CCSZ 4S1TA 1N2FA 2GTIA 1VQOZ 4NBAA 2OOYB 3J80b 1M1K1 1VQKZ 5IP7I 2KI7B 3CCEZ 1NJI2 1RO4A 3CC71 1VQLZ 1Q7Y2 1RLYA 1DL6A 1X3ZA 4NBDA 3JAMf 1K9M1 1YHQZ 2JNYA 3S2HI 4E2WA 1M902 2W04A 3NDJA 2V8IA 2JUBA 2VUGA 1PFTA 2VF1A 3S16I 1KQSZ 3GTLI 3S1MI 3CME1 2QR1B 2HF1A 3G4S1 4BBSI 4DK1A 2JMOA 1VQ8Z 4A3LI 3GTGI 3P5JB 2NVTI 2RPRA 3G6E1 3J81b 5A2Qb 3IF8A 4BBRI 3VB9A 1ZB9A 3NFZA 4NBCA 3CCUZ 3GKQA 5T67A 4NB8A 2BJOA 3FQQA 1QYPA 4A93I 1S721 1Q822 2QA41 3PO2I 2DE5A 4NBFA 1Q811 3BG1B 1QVFZ 1K8A2 2OTLZ 1YJW1 1QVFY 3HOYI 1KD12 1N8R2 2RHBA 4DGLA 3TE5B 1JJ2Z 5D1OA 1JJ2Y 4A3GI 2HU9A 3I07A 3CXCY 3CQZI 2DE7A 2OZKA 1YI2Z 1VQMZ 1RO0A 2NVXI 3ESWA 1YJ91 2RT9A 3KIHA 3F3PC 3CCJZ 2ZAEB 4RVGA 4E2YA 4EWCA 3T4NB 1VQ41 2H85A 1ZB8A 3GTJI 2WAQA 1VQPZ 4E31A 4DQYB 3CCL1 5LL6f 2IZ4A 4MH4A 1RNIA 1TWGI 1VQ51 1ZH1A 1VQ71 3S14I 3S1QI 3HKZA 1JWHC 4BY1I 2P28A 3OW2Z 4RV9A 1ML8A 4XX2A 2LIYA 2QEX1 2YU9I 1R9TI 1NP6A 2O4HA 4RVHA 4A3MI 3CC7Z 5C3EI 1WIIA 2RBLA 2GTHA 3I551 2GU2A 2V8KA 3K7AI 2QRCB 3J80f 2I3CA 2O53A 3HOVI 4MD9A 1VQN1 4NBHA 3CMEZ 3CC4Z 4MD8A 3M3YI 1I3QI 3G4SZ 1LQLA 2QKDA 4Y7NI 4A3JI 2M6NA 4MXUA 1YJN1 3G6EZ 4E30A 3S1RI 2OTJZ 2AKLA 3IFUA 3VMHA 5D1OB 1Q812 3VMGA 3I561 1TWFI 3U50C 2K5RA 3PO3S 3RZDI 3J81f 5A2Qf 2LFUA 1S72Z 2QA4Z 4CL1A 2EGTA 1P9NA 3CCQZ 3H0GI 1TWCI 4TNUA 3CCE1 2RIQA 1TWAI 1YJWZ 1WW9A 3CMA1 4NBGA 3PO3I 2G2KA 1K731 3CCM1 4A3KI 1I6HI 3CC21 5C4XI 4RVFA 1L1OC 2V8JA 3HOWI 3FKII 3F3FC 2JA5I 1YJ9Z 3G711 1VQ4Z 3S2DI 4NFRA 1YUAA 1SFOI 3CCLZ 3CXCZ 2F4OA 3CCR1 2JA7I 1USPA 5T6BA 2R93I 2E2JI 3QWUA 1VQ5Z 3CCU1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI 1;  1VQ7 Z;  2QEX 1;  1Q7Y 1;  3CCR Z;  1K9M 1;  1YHQ Z;  2OTJ 1;  1M90 2;  3CC7 Z;  1M90 1;  1VQ8 1;  1KQS Z;  3I55 1;  3CCV Z;  3CME 1;  1YIT 1;  1QVG Z;  1QVG Y;  3G4S 1;  1KC8 2;  1VQ8 Z;  3CCQ 1;  1VQN 1;  1KC8 1;  3CME Z;  3CC4 Z;  1YIT Z;  3G6E 1;  3G4S Z;  1VQN Z;  3CCU Z;  1YJN 1;  3G6E Z;  2QEX Z;  1YIJ 1;  1W2B Z;  2OTJ Z;  1W2B Y;  1S72 1;  2OTL 1;  1Q82 2;  1Q81 2;  1YJN Z;  2QA4 1;  1YIJ Z;  3I56 1;  1VQ9 1;  1Q82 1;  1Q86 2;  1Q81 1;  1VQ6 1;  3I55 Z;  3CPW Y;  1QVF Z;  1K8A 2;  1Q86 1;  1S72 Z;  2OTL Z;  1YJW 1;  1QVF Y;  2QA4 Z;  1K8A 1;  3I56 Z;  1VQ9 Z;  1KD1 2;  1N8R 2;  3CCQ Z;  3CD6 1;  1VQ6 Z;  1KD1 1;  1N8R 1;  3CCE 1;  1JJ2 Z;  1YJW Z;  1YI2 1;  1VQM 1;  1JJ2 Y;  3CMA 1;  1M1K 2;  1K73 2;  3CD6 Z;  3CCJ 1;  3CXC Y;  1K73 1;  3CCM 1;  1YI2 Z;  3CC2 1;  1VQM Z;  3CMA Z;  1VQP 1;  3CCS 1;  1YJ9 1;  3OW2 Y;  1K9M 2;  3CPW Z;  3CCJ Z;  3CCM Z;  1VQ4 1;  3CC2 Z;  1VQO 1;  3CCV 1;  1VQP Z;  3CCS Z;  1YJ9 Z;  3CCL 1;  1VQK 1;  3G71 1;  1VQ4 Z;  1VQL 1;  1VQO Z;  1KQS Y;  3CC4 1;  1VQ5 1;  1VQ7 1;  3CCL Z;  3CXC Z;  3CCR 1;  1M1K 1;  1VQK Z;  1YHQ 1;  3CCE Z;  3G71 Z;  1NJI 2;  3CC7 1;  1VQL Z;  3OW2 Z;  1Q7Y 2;  1VQ5 Z;  3CCU 1; 
#chains in the Genus database with same CATH topology
 2Y0S A;  1VQ7 Z;  3EER A;  5FLM I;  1YUK A;  5D1P A;  2F4M A;  3CCV Z;  4BY7 I;  3MZL B;  2R92 I;  1YIT 1;  1QVG Z;  2NVQ I;  5IP9 I;  3TDH B;  1QVG Y;  3M4O I;  2OOX B;  1KC8 1;  2NVY I;  2VUM I;  2JIO A;  3NDI A;  2IZ3 A;  1VQN Z;  2KPI A;  2QRD B;  2QRE B;  4MD7 A;  1YIJ 1;  1X0T A;  5AN9 F;  4E2Z A;  1WCM I;  1YJN Z;  1QF8 A;  1VQ9 1;  5IT9 f;  5FLX b;  1VQ6 1;  5IT9 b;  3CPW Y;  1Q86 1;  1X3W A;  2PMZ A;  4NBE A;  3GCF A;  3I56 Z;  2YAD A;  3D2L A;  3CD6 1;  4A3I I;  2R6M A;  4A3E I;  3I4N I;  2JS4 A;  2E9H A;  5C44 I;  4Y52 I;  3KIF A;  1WJ2 A;  1K73 2;  1Z01 A;  4HGY A;  4HGZ A;  3HOU I;  3MZK B;  2M48 A;  1I50 I;  2JIR A;  3CMA Z;  3CCS 1;  2P3Y A;  5CM2 M;  4A3F I;  3NH5 A;  3NH4 A;  2JA8 I;  1USP B;  4AYB A;  3HOX I;  3CCM Z;  3CC2 Z;  1VQO 1;  1VLA A;  3JAM b;  4A3B I;  2Q4Z A;  4E2X A;  2E2H I;  4BXX I;  3VMI A;  1VQK 1;  4NB9 A;  3LUS A;  4E32 A;  1VQL 1;  3D6W A;  1KQS Y;  4QTU A;  3CC4 1;  4QTT A;  1KRL A;  2JR6 A;  2W03 A;  3RZO I;  4MON A;  4NOZ A;  2DE6 A;  1YHQ 1;  4RS4 A;  3G71 Z;  3NH8 A;  2V45 A;  3D9X A;  1NJI 1;  1Z02 A;  4A3C I;  3HOZ I;  1Q7Y 1;  1TWH I;  3CCR Z;  2OTJ 1;  2PM9 A;  5C4J I;  2JIQ A;  4A3D I;  2B63 I;  1M90 1;  2R7Z I;  2IV2 X;  1VQ8 1;  4HH4 A;  1RQF A;  5T64 A;  1RO2 A;  3GTM S;  3I4M I;  2K3R A;  1NUI A;  1KC8 2;  3GTK I;  3CCQ 1;  1Z03 A;  3VTN A;  2VPX A;  1YIT Z;  3S15 I;  3FQM A;  2PK7 A;  3GTM I;  1K83 I;  3S1N I;  1Y1V S;  2QEX Z;  1Y1W I;  2JA6 I;  4RVD A;  4E33 A;  4X6A I;  1W2B Z;  1TFI A;  1W2B Y;  2Q51 A;  2OTL 1;  2QLV B;  2VPW A;  1YIJ Z;  1Q82 1;  2E2I I;  1Q86 2;  3MON A;  3J7A 4;  3IX0 A;  1Y1V I;  3I55 Z;  3H3V J;  1K8A 1;  1VQ9 Z;  2E7Z A;  1VQ6 Z;  1KD1 1;  1N8R 1;  1YI2 1;  1VQM 1;  1M1K 2;  4NH1 C;  3CD6 Z;  3CCJ 1;  2AYD A;  2WB1 A;  4MRI A;  5FLX f;  1S7M A;  1VQP 1;  3EED A;  3OW2 Y;  3GTP I;  1K9M 2;  3GTO I;  3CPW Z;  1Q16 A;  3S17 I;  3Q87 A;  3GTQ I;  3BG0 B;  1QXF A;  3CCV 1;  4NBB A;  2J6A A;  3CCS Z;  4S1T A;  1N2F A;  2GTI A;  1VQO Z;  4NBA A;  1AA6 A;  2OOY B;  3J80 b;  1M1K 1;  1VQK Z;  2V3V A;  5IP7 I;  2KI7 B;  3CCE Z;  1NJI 2;  1RO4 A;  3CC7 1;  1VQL Z;  1Q7Y 2;  1RLY A;  1DL6 A;  1X3Z A;  4NBD A;  3JAM f;  1K9M 1;  1YHQ Z;  2JNY A;  3S2H I;  4E2W A;  1M90 2;  2W04 A;  3NDJ A;  2V8I A;  2JUB A;  2VUG A;  1PFT A;  2VF1 A;  3S16 I;  1KQS Z;  1SIW A;  3GTL I;  3S1M I;  3CME 1;  2QR1 B;  2HF1 A;  3G4S 1;  4BBS I;  4DK1 A;  2JMO A;  1VQ8 Z;  4A3L I;  3GTG I;  3P5J B;  2NVT I;  2RPR A;  3G6E 1;  3J81 b;  5A2Q b;  3IF8 A;  2NAP A;  4BBR I;  3VB9 A;  1ZB9 A;  3NFZ A;  4NBC A;  3CCU Z;  3GKQ A;  5T67 A;  4NB8 A;  2BJO A;  3FQQ A;  1QYP A;  4A93 I;  1S72 1;  1Q82 2;  2QA4 1;  3PO2 I;  2DE5 A;  4NBF A;  1Q81 1;  3BG1 B;  1QVF Z;  1K8A 2;  2OTL Z;  1YJW 1;  1QVF Y;  3HOY I;  1KD1 2;  1N8R 2;  2RHB A;  4DGL A;  3TE5 B;  1JJ2 Z;  5D1O A;  1JJ2 Y;  4A3G I;  2HU9 A;  3I07 A;  3CXC Y;  3CQZ I;  2DE7 A;  2OZK A;  1YI2 Z;  1VQM Z;  1RO0 A;  2NVX I;  3ESW A;  1YJ9 1;  2RT9 A;  3KIH A;  3F3P C;  3CCJ Z;  2ZAE B;  4RVG A;  4E2Y A;  3IR7 A;  3T4N B;  4EWC A;  1VQ4 1;  2H85 A;  1ZB8 A;  3GTJ I;  2WAQ A;  1VQP Z;  4E31 A;  4DQY B;  3CCL 1;  5LL6 f;  2IZ4 A;  4MH4 A;  1RNI A;  1TWG I;  1VQ5 1;  1ZH1 A;  1VQ7 1;  3S14 I;  3S1Q I;  3HKZ A;  1JWH C;  4BY1 I;  2P28 A;  3OW2 Z;  4RV9 A;  1ML8 A;  2JIP A;  4XX2 A;  2LIY A;  2QEX 1;  2YU9 I;  1R9T I;  1NP6 A;  2O4H A;  4RVH A;  4A3M I;  3CC7 Z;  5C3E I;  1WII A;  2RBL A;  1WZN A;  2GTH A;  2VPZ A;  3I55 1;  1FDI A;  2GU2 A;  2V8K A;  3K7A I;  2QRC B;  3J80 f;  2I3C A;  2O53 A;  3HOV I;  4MD9 A;  1VQN 1;  4NBH A;  3CME Z;  3CC4 Z;  4MD8 A;  3M3Y I;  1I3Q I;  3G4S Z;  1LQL A;  2QKD A;  4Y7N I;  4A3J I;  2M6N A;  4MXU A;  1YJN 1;  3G6E Z;  4E30 A;  3S1R I;  2OTJ Z;  2AKL A;  1FDO A;  3IFU A;  3VMH A;  5D1O B;  1Q81 2;  3VMG A;  3I56 1;  1TWF I;  3U50 C;  2K5R A;  3PO3 S;  3RZD I;  3J81 f;  5A2Q f;  2LFU A;  1S72 Z;  2QA4 Z;  2JIM A;  4CL1 A;  2EGT A;  1P9N A;  3CCQ Z;  3H0G I;  2VPY A;  1TWC I;  4TNU A;  3CCE 1;  2RIQ A;  1TWA I;  1YJW Z;  1WW9 A;  3CMA 1;  4NBG A;  3PO3 I;  2G2K A;  1K73 1;  3CCM 1;  4A3K I;  1I6H I;  3CC2 1;  5C4X I;  4RVF A;  1L1O C;  2V8J A;  3HOW I;  3FKI I;  2LEX A;  3F3F C;  2JA5 I;  1YJ9 Z;  3G71 1;  1VQ4 Z;  3S2D I;  4NFR A;  1YUA A;  1SFO I;  3CCL Z;  3CXC Z;  2F4O A;  3CCR 1;  2JA7 I;  1USP A;  1Y8C A;  5T6B A;  2R93 I;  2E2J I;  3QWU A;  1VQ5 Z;  3CCU 1; 
#chains in the Genus database with same CATH homology
 2Y0S A;  1VQ7 Z;  3EER A;  5FLM I;  1YUK A;  5D1P A;  2F4M A;  3CCV Z;  4BY7 I;  3MZL B;  2R92 I;  1YIT 1;  1QVG Z;  2NVQ I;  5IP9 I;  3TDH B;  1QVG Y;  3M4O I;  2OOX B;  1KC8 1;  2NVY I;  2VUM I;  3NDI A;  2IZ3 A;  1VQN Z;  2KPI A;  2QRD B;  2QRE B;  4MD7 A;  1YIJ 1;  1X0T A;  5AN9 F;  4E2Z A;  1WCM I;  1YJN Z;  1QF8 A;  1VQ9 1;  5IT9 f;  5FLX b;  1VQ6 1;  5IT9 b;  3CPW Y;  1Q86 1;  1X3W A;  2PMZ A;  4NBE A;  3GCF A;  3I56 Z;  2YAD A;  3CD6 1;  4A3I I;  2R6M A;  4A3E I;  3I4N I;  2JS4 A;  2E9H A;  5C44 I;  4Y52 I;  3KIF A;  1K73 2;  3HOU I;  1Z01 A;  4HGY A;  4HGZ A;  3MZK B;  2M48 A;  1I50 I;  3CMA Z;  3CCS 1;  4A3F I;  2P3Y A;  5CM2 M;  3NH5 A;  3NH4 A;  2JA8 I;  1USP B;  4AYB A;  3HOX I;  3CCM Z;  3CC2 Z;  1VQO 1;  1VLA A;  3JAM b;  4A3B I;  2Q4Z A;  4E2X A;  2E2H I;  4BXX I;  3VMI A;  1VQK 1;  4NB9 A;  3LUS A;  4E32 A;  1VQL 1;  3D6W A;  1KQS Y;  4QTU A;  3CC4 1;  4QTT A;  1KRL A;  2JR6 A;  2W03 A;  3RZO I;  4MON A;  4NOZ A;  2DE6 A;  1YHQ 1;  4RS4 A;  3G71 Z;  3NH8 A;  3D9X A;  1NJI 1;  1Z02 A;  4A3C I;  3HOZ I;  1Q7Y 1;  1TWH I;  3CCR Z;  2OTJ 1;  2PM9 A;  5C4J I;  4A3D I;  2B63 I;  1M90 1;  2R7Z I;  1VQ8 1;  4HH4 A;  1RQF A;  5T64 A;  1RO2 A;  3GTM S;  3I4M I;  2K3R A;  1NUI A;  1KC8 2;  3GTK I;  3CCQ 1;  1Z03 A;  3VTN A;  1YIT Z;  3S15 I;  3FQM A;  2PK7 A;  3GTM I;  1K83 I;  3S1N I;  1Y1V S;  2QEX Z;  1Y1W I;  2JA6 I;  4RVD A;  4E33 A;  4X6A I;  1W2B Z;  1TFI A;  1W2B Y;  2Q51 A;  2OTL 1;  2QLV B;  1YIJ Z;  1Q82 1;  2E2I I;  1Q86 2;  3MON A;  3J7A 4;  3IX0 A;  1Y1V I;  3I55 Z;  3H3V J;  1K8A 1;  1VQ9 Z;  1VQ6 Z;  1KD1 1;  1N8R 1;  1YI2 1;  1VQM 1;  1M1K 2;  4NH1 C;  3CD6 Z;  3CCJ 1;  2WB1 A;  4MRI A;  5FLX f;  1S7M A;  1VQP 1;  3EED A;  3OW2 Y;  3GTP I;  1K9M 2;  3GTO I;  3CPW Z;  3S17 I;  3Q87 A;  3GTQ I;  3BG0 B;  3CCV 1;  4NBB A;  2J6A A;  3CCS Z;  4S1T A;  1N2F A;  2GTI A;  1VQO Z;  4NBA A;  2OOY B;  3J80 b;  1M1K 1;  1VQK Z;  5IP7 I;  2KI7 B;  3CCE Z;  1NJI 2;  1RO4 A;  3CC7 1;  1VQL Z;  1Q7Y 2;  1RLY A;  1DL6 A;  1X3Z A;  4NBD A;  3JAM f;  1K9M 1;  1YHQ Z;  2JNY A;  3S2H I;  4E2W A;  1M90 2;  2W04 A;  3NDJ A;  2V8I A;  2JUB A;  2VUG A;  1PFT A;  2VF1 A;  3S16 I;  1KQS Z;  3GTL I;  3S1M I;  3CME 1;  2QR1 B;  2HF1 A;  3G4S 1;  4BBS I;  4DK1 A;  2JMO A;  1VQ8 Z;  4A3L I;  3GTG I;  3P5J B;  2NVT I;  2RPR A;  3G6E 1;  3J81 b;  5A2Q b;  3IF8 A;  4BBR I;  3VB9 A;  1ZB9 A;  3NFZ A;  4NBC A;  3CCU Z;  3GKQ A;  5T67 A;  4NB8 A;  2BJO A;  3FQQ A;  1QYP A;  4A93 I;  1S72 1;  1Q82 2;  2QA4 1;  3PO2 I;  2DE5 A;  4NBF A;  1Q81 1;  3BG1 B;  1QVF Z;  1K8A 2;  2OTL Z;  1YJW 1;  1QVF Y;  3HOY I;  1KD1 2;  1N8R 2;  2RHB A;  4DGL A;  3TE5 B;  1JJ2 Z;  5D1O A;  1JJ2 Y;  4A3G I;  2HU9 A;  3I07 A;  3CXC Y;  3CQZ I;  2DE7 A;  2OZK A;  1YI2 Z;  1VQM Z;  1RO0 A;  2NVX I;  3ESW A;  1YJ9 1;  2RT9 A;  3KIH A;  3F3P C;  3CCJ Z;  2ZAE B;  4RVG A;  4E2Y A;  4EWC A;  3T4N B;  1VQ4 1;  2H85 A;  1ZB8 A;  3GTJ I;  2WAQ A;  1VQP Z;  4E31 A;  4DQY B;  3CCL 1;  5LL6 f;  2IZ4 A;  4MH4 A;  1RNI A;  1TWG I;  1VQ5 1;  1ZH1 A;  1VQ7 1;  3S14 I;  3S1Q I;  3HKZ A;  1JWH C;  4BY1 I;  2P28 A;  3OW2 Z;  4RV9 A;  1ML8 A;  4XX2 A;  2LIY A;  2QEX 1;  2YU9 I;  1R9T I;  1NP6 A;  2O4H A;  4RVH A;  4A3M I;  3CC7 Z;  5C3E I;  1WII A;  2RBL A;  2GTH A;  3I55 1;  2GU2 A;  2V8K A;  3K7A I;  2QRC B;  3J80 f;  2I3C A;  2O53 A;  3HOV I;  4MD9 A;  1VQN 1;  4NBH A;  3CME Z;  3CC4 Z;  4MD8 A;  3M3Y I;  1I3Q I;  3G4S Z;  1LQL A;  2QKD A;  4Y7N I;  4A3J I;  2M6N A;  4MXU A;  1YJN 1;  3G6E Z;  4E30 A;  3S1R I;  2OTJ Z;  2AKL A;  3IFU A;  3VMH A;  5D1O B;  1Q81 2;  3VMG A;  3I56 1;  1TWF I;  3U50 C;  2K5R A;  3PO3 S;  3RZD I;  3J81 f;  5A2Q f;  2LFU A;  1S72 Z;  2QA4 Z;  4CL1 A;  2EGT A;  1P9N A;  3CCQ Z;  3H0G I;  1TWC I;  4TNU A;  3CCE 1;  2RIQ A;  1TWA I;  1YJW Z;  1WW9 A;  3CMA 1;  4NBG A;  3PO3 I;  2G2K A;  1K73 1;  3CCM 1;  4A3K I;  1I6H I;  3CC2 1;  5C4X I;  4RVF A;  1L1O C;  2V8J A;  3HOW I;  3FKI I;  3F3F C;  2JA5 I;  1YJ9 Z;  3G71 1;  1VQ4 Z;  3S2D I;  4NFR A;  1YUA A;  1SFO I;  3CCL Z;  3CXC Z;  2F4O A;  3CCR 1;  2JA7 I;  1USP A;  5T6B A;  2R93 I;  2E2J I;  3QWU A;  1VQ5 Z;  3CCU 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...