3RZDI

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzdI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzdI02
4A3EI 1X3ZA 4Y52I 4A3MI 4A3CI 4NB8A 1X3WA 3GTMS 3GTKI 4A3GI 4A3KI 5FLMI 4BBSI 2P3YA 4A3JI 3RZOI 4A93I 3S16I 2BJOA 1I50I 3EERA 3GTOI 1WW9A 1LQLA 2E2HI 3PO3S 3HOVI 3U50C 4BXXI 2JS4A 1SFOI 4NBGA 4BBRI 4X6AI 1TWHI 2JNYA 2F4OA 1YUAA 1NUIA 4MH4A 3GKQA 4NBFA 4NBDA 2R7ZI 2NVXI 2JA5I 1USPA 4QTTA 2DE5A 1ZB8A 5C4XI 3K7AI 4NBCA 1I3QI 3D6WA 3GCFA 1I6HI 1Y1WI 2JA7I 3S14I 2NVYI 4NBEA 5IP9I 2YU9I 1RO4A 5IP7I 3ESWA 3GTLI 1TWFI 3GTMI 3M4OI 1TFIA 2KPIA 4A3FI 3S2HI 4NBAA 3GTGI 4NBHA 3GTJI 3HOWI 5C44I 2R92I 2JA8I 1Y1VS 3Q87A 4Y7NI 3VMGA 2F4MA 2R93I 4A3BI 2JR6A 5CM2M 3RZDI 3GTQI 3VMHA 4BY1I 1VLAA 2E2JI 3HOUI 2B63I 4XX2A 3PO3I 3S2DI 4QTUA 1TWAI 1DL6A 3PO2I 1ML8A 1K83I 3I4MI 2K5RA 1Y1VI 1TWCI 4NOZA 3HOXI 3S1RI 2RBLA 3S1NI 2AKLA 1WCMI 3HOYI 1USPB 3S1MI 3I07A 5C4JI 1TWGI 4BY7I 3FKII 4A3LI 3LUSA 4A3DI 3S15I 3VB9A 3H0GI 3I4NI 2DE7A 4NBBA 2VUMI 3VMIA 1QYPA 2E2II 2NVQI 3HOZI 3H3VJ 1N2FA 2DE6A 1RLYA 1R9TI 3S17I 5C3EI 4A3II 3GTPI 2JA6I 3M3YI 2HF1A 2PK7A 2NVTI 3S1QI 2J6AA 3CQZI 1ZB9A 1PFTA 1L1OC 4NB9A
chains in the Genus database with same CATH superfamily
1YIJZ 4MRIA 1K731 4NB8A 4A3GI 3BG0B 3GTKI 1S721 5D1OB 1QVFZ 4MD7A 1VQ61 4RVGA 3T4NB 2OOYB 3NDJA 1Z01A 2BJOA 3EERA 3CCEZ 1LQLA 2QR1B 2RPRA 1KC82 2W03A 4NBGA 2HU9A 1TWHI 2PM9A 1QVGY 2WB1A 1KC81 4MH4A 3IR7A 4NBFA 3CC71 2NVXI 4MONA 2JA5I 1Z02A 5T67A 1ZB8A 5C4XI 1I6HI 1VQ7Z 1K9M2 1VQK1 2YU9I 4E33A 3GTLI 1TWFI 2VPWA 2K3RA 3EEDA 4MD8A 2I3CA 1YJW1 3HOWI 1NJI2 2R92I 2JIRA 4Y7NI 3VMGA 3CCM1 2V45A 2VUGA 1NJI1 4BY1I 1VLAA 4NH1C 3CC21 1KRLA 3IF8A 1WIIA 1WZNA 2M48A 3IX0A 1Y1VI 3FQMA 1QVFY 1X0TA 4NOZA 3S1RI 2WAQA 2JIQA 3CCQZ 3I55Z 1WCMI 3CCE1 3I07A 2H85A 4E2WA 4A3DI 3D9XA 2LFUA 3IFUA 3I56Z 3I4NI 1QYPA 3HOZI 3OW2Z 4HGZA 3KIHA 4DQYB 1R9TI 1QF8A 5C3EI 1VQ71 3G711 3CMEZ 2PMZA 3J81f 2O4HA 2GTIA 3QWUA 3MZKB 1Q862 1L1OC 4NB9A 4A3EI 2IZ3A 3J81b 1NP6A 4A3MI 4A3CI 1P9NA 1VQP1 1FDOA 1Q861 4DK1A 1RNIA 3RZOI 5LL6f 3NH5A 1JJ2Z 2E2HI 1N8R2 4TNUA 4MD9A 3CD6Z 4BBRI 1W2BZ 4X6AI 2Q4ZA 1N8R1 1ZH1A 2VPXA 2VPZA 3CCQ1 2RIQA 3CCVZ 2LIYA 1VQ41 3CMAZ 2DE5A 2QLVB 2OTJ1 4NBCA 3GCFA 2JA7I 4E2ZA 2NVYI 3CCS1 3NH8A 2QA4Z 5IP7I 3J80f 4A3FI 3S2HI 3J80b 3D2LA 3GTGI 4NBHA 3G4S1 1SIWA 3CME1 3OW2Y 1VQ8Z 2JR6A 3RZDI 3PO3I 2B63I 3CC4Z 2JIMA 3CPWZ 2VF1A 2QREB 3PO2I 3CCU1 5D1OA 1TWCI 3CCJZ 5T6BA 3HOXI 3MZLB 1AA6A 1YJ91 3S1NI 3S1MI 1USPB 2JIPA 2OTL1 4E2YA 3CCR1 5C4JI 2QEXZ 3LUSA 3CD61 1JJ2Y 2V8JA 3F3PC 4NBBA 1YIJ1 3VMIA 2LEXA 2NVQI 1W2BY 1N2FA 1RLYA 2ZAEB 3S17I 2EGTA 2G2KA 1Q822 1YI2Z 4E30A 2JA6I 1S7MA 2QA41 2V3VA 1KQSZ 4RVHA 3CQZI 1Q821 2Y0SA 1VQLZ 2KI7B 2Q51A 1X3ZA 4Y52I 1M902 1X3WA 1Z03A 1YITZ 4A3KI 1M901 1VQ81 1YJNZ 4A93I 3JAMf 3S16I 3GTOI 3J7A4 1WW9A 4AYBA 2JUBA 3PO3S 3HOVI 4EWCA 1VQOZ 4E31A 3U50C 4BXXI 2W04A 1KD12 1SFOI 3CCJ1 1Q7Y2 3CPWY 2JNYA 1WJ2A 1YUAA 2F4OA 1KD11 1QXFA 1Q7Y1 2OZKA 4CL1A 2AYDA 3HKZA 3D6WA 4NBEA 1RO4A 3ESWA 3GTMI 5FLXf 1TFIA 2KPIA 4NBAA 1VQNZ 3GTJI 3CC7Z 3KIFA 2JA8I 1Y1VS 1VQ9Z 3I551 3BG1B 1K8A2 5CM2M 2JMOA 4MXUA 1VQKZ 1VQL1 3S2DI 2E2JI 3HOUI 1KQSY 3G6EZ 1K8A1 4E2XA 1DL6A 2K5RA 3I561 2IZ4A 1YJWZ 2QRCB 2P28A 5AN9F 3CCMZ 4S1TA 4RVFA 1JWHC 3TE5B 1VQO1 3CC2Z 1VQ5Z 1TWGI 4BY7I 3FKII 4A3LI 3VB9A 3CXCZ 2DE7A 5IT9f 2DE6A 1RQFA 5IT9b 2E7ZA 3P5JB 2V8IA 2M6NA 2IV2X 1ZB9A 1PFTA 4RV9A 2GTHA 2YADA 5T64A 1VQN1 2RHBA 3GTMS 1YHQZ 5FLMI 4BBSI 4NFRA 1VQMZ 1FDIA 3TDHB 2P3YA 1VQ91 3G71Z 2RT9A 4HH4A 4A3JI 3CCV1 3CMA1 1YUKA 1I50I 3G6E1 2QKDA 2NAPA 1K9M1 2JS4A 1VQPZ 3FQQA 1NUIA 3GKQA 4NBDA 2R7ZI 1VQ51 1USPA 4QTTA 3NDIA 3K7AI 4DGLA 1I3QI 4RS4A 3S14I 1Y1WI 3F3FC 5IP9I 1RO2A 3CC41 3M4OI 3CCLZ 3CXCY 3JAMb 4E32A 1S72Z 1VQ4Z 5A2Qf 5C44I 3Q87A 4RVDA 2OTJZ 2F4MA 2OOXB 2R93I 4A3BI 3NFZA 5A2Qb 1M1K2 3CCSZ 1VQ6Z 3GTQI 3VMHA 2E9HA 4XX2A 3VTNA 2QEX1 1M1K1 4QTUA 5D1PA 1TWAI 1YHQ1 3MONA 1ML8A 1K83I 1RO0A 1QVGZ 2GU2A 1VQM1 2JIOA 3I4MI 2QRDB 3G4SZ 2RBLA 1Q16A 2AKLA 3HOYI 5FLXb 1YI21 4HGYA 2R6MA 3S15I 3H0GI 3CCUZ 2VUMI 2E2II 2O53A 1Q812 1YIT1 3H3VJ 1YJ9Z 4A3II 2OTLZ 3CCRZ 1YJN1 3GTPI 3NH4A 1Q811 1Y8CA 3M3YI 2HF1A 2PK7A 2NVTI 1K732 2J6AA 2V8KA 2VPYA 3S1QI 3CCL1
chains in the Genus database with same CATH topology
1YIJZ 4MRIA 1K731 4NB8A 4A3GI 3BG0B 3GTKI 1S721 5D1OB 1QVFZ 4MD7A 1VQ61 4RVGA 3T4NB 2OOYB 3NDJA 1Z01A 2BJOA 3EERA 3CCEZ 1LQLA 2QR1B 2RPRA 1KC82 2W03A 4NBGA 2HU9A 1TWHI 2PM9A 1QVGY 2WB1A 1KC81 4MH4A 4NBFA 3CC71 2NVXI 4MONA 2JA5I 1Z02A 5T67A 1ZB8A 5C4XI 1I6HI 1VQ7Z 1K9M2 1VQK1 2YU9I 4E33A 3GTLI 1TWFI 2K3RA 3EEDA 4MD8A 2I3CA 1YJW1 3HOWI 1NJI2 2R92I 4Y7NI 3VMGA 3CCM1 2VUGA 1NJI1 4BY1I 1VLAA 4NH1C 3CC21 1KRLA 3IF8A 1WIIA 2M48A 3IX0A 1Y1VI 3FQMA 1QVFY 1X0TA 4NOZA 3S1RI 2WAQA 3CCQZ 3I55Z 1WCMI 3CCE1 3I07A 2H85A 4E2WA 4A3DI 3D9XA 2LFUA 3IFUA 3I56Z 3I4NI 1QYPA 3HOZI 3OW2Z 4HGZA 3KIHA 4DQYB 1R9TI 1QF8A 5C3EI 1VQ71 3G711 3CMEZ 2PMZA 3J81f 2O4HA 2GTIA 3QWUA 3MZKB 1Q862 1L1OC 4NB9A 4A3EI 2IZ3A 3J81b 1NP6A 4A3MI 4A3CI 1P9NA 1VQP1 1Q861 4DK1A 1RNIA 3RZOI 5LL6f 3NH5A 1JJ2Z 2E2HI 1N8R2 4TNUA 4MD9A 3CD6Z 4BBRI 1W2BZ 4X6AI 2Q4ZA 1N8R1 1ZH1A 3CCQ1 2RIQA 3CCVZ 2LIYA 1VQ41 3CMAZ 2DE5A 2QLVB 2OTJ1 4NBCA 3GCFA 2JA7I 4E2ZA 2NVYI 3CCS1 3NH8A 2QA4Z 5IP7I 3J80f 4A3FI 3S2HI 3J80b 3GTGI 4NBHA 3G4S1 3CME1 3OW2Y 1VQ8Z 2JR6A 3RZDI 3PO3I 2B63I 3CC4Z 3CPWZ 2VF1A 2QREB 3PO2I 3CCU1 5D1OA 1TWCI 3CCJZ 5T6BA 3HOXI 3MZLB 1YJ91 3S1NI 3S1MI 1USPB 2OTL1 4E2YA 3CCR1 5C4JI 2QEXZ 3LUSA 3CD61 1JJ2Y 2V8JA 3F3PC 4NBBA 1YIJ1 3VMIA 2NVQI 1W2BY 1N2FA 1RLYA 2ZAEB 3S17I 2EGTA 2G2KA 1Q822 1YI2Z 4E30A 2JA6I 1S7MA 2QA41 1KQSZ 4RVHA 3CQZI 1Q821 2Y0SA 1VQLZ 2KI7B 2Q51A 1X3ZA 4Y52I 1M902 1X3WA 1Z03A 1YITZ 4A3KI 1M901 1VQ81 1YJNZ 4A93I 3JAMf 3S16I 3GTOI 3J7A4 1WW9A 4AYBA 2JUBA 3PO3S 3HOVI 4EWCA 1VQOZ 4E31A 3U50C 4BXXI 2W04A 1KD12 1SFOI 3CCJ1 1Q7Y2 3CPWY 2JNYA 2F4OA 1YUAA 1KD11 1Q7Y1 2OZKA 4CL1A 3HKZA 3D6WA 4NBEA 1RO4A 3ESWA 3GTMI 5FLXf 1TFIA 2KPIA 4NBAA 1VQNZ 3GTJI 3CC7Z 3KIFA 2JA8I 1Y1VS 1VQ9Z 3I551 3BG1B 1K8A2 5CM2M 2JMOA 4MXUA 1VQKZ 1VQL1 3S2DI 2E2JI 3HOUI 1KQSY 3G6EZ 1K8A1 4E2XA 1DL6A 2K5RA 3I561 2IZ4A 1YJWZ 2QRCB 2P28A 5AN9F 3CCMZ 4S1TA 4RVFA 1JWHC 3TE5B 1VQO1 3CC2Z 1VQ5Z 1TWGI 4BY7I 3FKII 4A3LI 3VB9A 3CXCZ 2DE7A 5IT9f 2DE6A 1RQFA 5IT9b 3P5JB 2V8IA 2M6NA 1ZB9A 1PFTA 4RV9A 2GTHA 2YADA 5T64A 1VQN1 2RHBA 3GTMS 1YHQZ 5FLMI 4BBSI 4NFRA 1VQMZ 3TDHB 2P3YA 1VQ91 3G71Z 2RT9A 4HH4A 4A3JI 3CCV1 3CMA1 1YUKA 1I50I 3G6E1 2QKDA 1K9M1 2JS4A 1VQPZ 3FQQA 1NUIA 3GKQA 4NBDA 2R7ZI 1VQ51 1USPA 4QTTA 3NDIA 3K7AI 4DGLA 1I3QI 4RS4A 3S14I 1Y1WI 3F3FC 5IP9I 1RO2A 3CC41 3M4OI 3CCLZ 3CXCY 3JAMb 4E32A 1S72Z 1VQ4Z 5A2Qf 5C44I 3Q87A 4RVDA 2OTJZ 2F4MA 2OOXB 2R93I 4A3BI 3NFZA 5A2Qb 1M1K2 3CCSZ 1VQ6Z 3GTQI 3VMHA 2E9HA 4XX2A 3VTNA 2QEX1 1M1K1 4QTUA 5D1PA 1TWAI 1YHQ1 3MONA 1ML8A 1K83I 1RO0A 1QVGZ 2GU2A 1VQM1 3I4MI 2QRDB 3G4SZ 2RBLA 2AKLA 3HOYI 5FLXb 1YI21 4HGYA 2R6MA 3S15I 3H0GI 3CCUZ 2VUMI 2E2II 2O53A 1Q812 1YIT1 3H3VJ 1YJ9Z 4A3II 2OTLZ 3CCRZ 1YJN1 3GTPI 3NH4A 1Q811 3M3YI 2HF1A 2PK7A 2NVTI 1K732 2J6AA 2V8KA 3S1QI 3CCL1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E I;  1X3Z A;  4Y52 I;  4A3M I;  4A3C I;  4NB8 A;  1X3W A;  3GTM S;  3GTK I;  4A3G I;  4A3K I;  5FLM I;  4BBS I;  2P3Y A;  4A3J I;  3RZO I;  4A93 I;  3S16 I;  2BJO A;  1I50 I;  3EER A;  3GTO I;  1WW9 A;  1LQL A;  2E2H I;  3PO3 S;  3HOV I;  3U50 C;  4BXX I;  2JS4 A;  1SFO I;  4NBG A;  4BBR I;  4X6A I;  1TWH I;  2JNY A;  2F4O A;  1YUA A;  1NUI A;  4MH4 A;  3GKQ A;  4NBF A;  4NBD A;  2R7Z I;  2NVX I;  2JA5 I;  1USP A;  4QTT A;  2DE5 A;  1ZB8 A;  5C4X I;  3K7A I;  4NBC A;  1I3Q I;  3D6W A;  3GCF A;  1I6H I;  1Y1W I;  2JA7 I;  3S14 I;  2NVY I;  4NBE A;  5IP9 I;  2YU9 I;  1RO4 A;  5IP7 I;  3ESW A;  3GTL I;  1TWF I;  3GTM I;  3M4O I;  1TFI A;  2KPI A;  4A3F I;  3S2H I;  4NBA A;  3GTG I;  4NBH A;  3GTJ I;  3HOW I;  5C44 I;  2R92 I;  2JA8 I;  1Y1V S;  3Q87 A;  4Y7N I;  3VMG A;  2F4M A;  2R93 I;  4A3B I;  2JR6 A;  5CM2 M;  3RZD I;  3GTQ I;  3VMH A;  4BY1 I;  1VLA A;  2E2J I;  3HOU I;  2B63 I;  4XX2 A;  3PO3 I;  3S2D I;  4QTU A;  1TWA I;  1DL6 A;  3PO2 I;  1ML8 A;  1K83 I;  3I4M I;  2K5R A;  1Y1V I;  1TWC I;  4NOZ A;  3HOX I;  3S1R I;  2RBL A;  3S1N I;  2AKL A;  1WCM I;  3HOY I;  1USP B;  3S1M I;  3I07 A;  5C4J I;  1TWG I;  4BY7 I;  3FKI I;  4A3L I;  3LUS A;  4A3D I;  3S15 I;  3VB9 A;  3H0G I;  3I4N I;  2DE7 A;  4NBB A;  2VUM I;  3VMI A;  1QYP A;  2E2I I;  2NVQ I;  3HOZ I;  3H3V J;  1N2F A;  2DE6 A;  1RLY A;  1R9T I;  3S17 I;  5C3E I;  4A3I I;  3GTP I;  2JA6 I;  3M3Y I;  2HF1 A;  2PK7 A;  2NVT I;  3S1Q I;  2J6A A;  3CQZ I;  1ZB9 A;  1PFT A;  1L1O C;  4NB9 A; 
#chains in the Genus database with same CATH topology
 1YIJ Z;  4MRI A;  1K73 1;  4NB8 A;  4A3G I;  3BG0 B;  3GTK I;  1S72 1;  5D1O B;  1QVF Z;  4MD7 A;  1VQ6 1;  4RVG A;  3T4N B;  2OOY B;  3NDJ A;  1Z01 A;  2BJO A;  3EER A;  3CCE Z;  1LQL A;  2QR1 B;  2RPR A;  1KC8 2;  2W03 A;  4NBG A;  2HU9 A;  1TWH I;  2PM9 A;  1QVG Y;  2WB1 A;  1KC8 1;  4MH4 A;  3IR7 A;  4NBF A;  3CC7 1;  2NVX I;  4MON A;  2JA5 I;  1Z02 A;  5T67 A;  1ZB8 A;  5C4X I;  1I6H I;  1VQ7 Z;  1K9M 2;  1VQK 1;  2YU9 I;  4E33 A;  3GTL I;  1TWF I;  2VPW A;  2K3R A;  3EED A;  4MD8 A;  2I3C A;  1YJW 1;  3HOW I;  1NJI 2;  2R92 I;  2JIR A;  4Y7N I;  3VMG A;  3CCM 1;  2V45 A;  2VUG A;  1NJI 1;  4BY1 I;  1VLA A;  4NH1 C;  3CC2 1;  1KRL A;  3IF8 A;  1WII A;  1WZN A;  2M48 A;  3IX0 A;  1Y1V I;  3FQM A;  1QVF Y;  1X0T A;  4NOZ A;  3S1R I;  2WAQ A;  2JIQ A;  3CCQ Z;  3I55 Z;  1WCM I;  3CCE 1;  3I07 A;  2H85 A;  4E2W A;  4A3D I;  3D9X A;  2LFU A;  3IFU A;  3I56 Z;  3I4N I;  1QYP A;  3HOZ I;  3OW2 Z;  4HGZ A;  3KIH A;  4DQY B;  1R9T I;  1QF8 A;  5C3E I;  1VQ7 1;  3G71 1;  3CME Z;  2PMZ A;  3J81 f;  2O4H A;  2GTI A;  3QWU A;  3MZK B;  1Q86 2;  1L1O C;  4NB9 A;  4A3E I;  2IZ3 A;  3J81 b;  1NP6 A;  4A3M I;  4A3C I;  1P9N A;  1VQP 1;  1FDO A;  1Q86 1;  4DK1 A;  1RNI A;  3RZO I;  5LL6 f;  3NH5 A;  1JJ2 Z;  2E2H I;  1N8R 2;  4TNU A;  4MD9 A;  3CD6 Z;  4BBR I;  1W2B Z;  4X6A I;  2Q4Z A;  1N8R 1;  1ZH1 A;  2VPX A;  2VPZ A;  3CCQ 1;  2RIQ A;  3CCV Z;  2LIY A;  1VQ4 1;  3CMA Z;  2DE5 A;  2QLV B;  2OTJ 1;  4NBC A;  3GCF A;  2JA7 I;  4E2Z A;  2NVY I;  3CCS 1;  3NH8 A;  2QA4 Z;  5IP7 I;  3J80 f;  4A3F I;  3S2H I;  3J80 b;  3D2L A;  3GTG I;  4NBH A;  3G4S 1;  1SIW A;  3CME 1;  3OW2 Y;  1VQ8 Z;  2JR6 A;  3RZD I;  3PO3 I;  2B63 I;  3CC4 Z;  2JIM A;  3CPW Z;  2VF1 A;  2QRE B;  3PO2 I;  3CCU 1;  5D1O A;  1TWC I;  3CCJ Z;  5T6B A;  3HOX I;  3MZL B;  1AA6 A;  1YJ9 1;  3S1N I;  3S1M I;  1USP B;  2JIP A;  2OTL 1;  4E2Y A;  3CCR 1;  5C4J I;  2QEX Z;  3LUS A;  3CD6 1;  1JJ2 Y;  2V8J A;  3F3P C;  4NBB A;  1YIJ 1;  3VMI A;  2LEX A;  2NVQ I;  1W2B Y;  1N2F A;  1RLY A;  2ZAE B;  3S17 I;  2EGT A;  2G2K A;  1Q82 2;  1YI2 Z;  4E30 A;  2JA6 I;  1S7M A;  2QA4 1;  2V3V A;  1KQS Z;  4RVH A;  3CQZ I;  1Q82 1;  2Y0S A;  1VQL Z;  2KI7 B;  2Q51 A;  1X3Z A;  4Y52 I;  1M90 2;  1X3W A;  1Z03 A;  1YIT Z;  4A3K I;  1M90 1;  1VQ8 1;  1YJN Z;  4A93 I;  3JAM f;  3S16 I;  3GTO I;  3J7A 4;  1WW9 A;  4AYB A;  2JUB A;  3PO3 S;  3HOV I;  4EWC A;  1VQO Z;  4E31 A;  3U50 C;  4BXX I;  2W04 A;  1KD1 2;  1SFO I;  3CCJ 1;  1Q7Y 2;  3CPW Y;  2JNY A;  1WJ2 A;  1YUA A;  2F4O A;  1KD1 1;  1QXF A;  1Q7Y 1;  2OZK A;  4CL1 A;  2AYD A;  3HKZ A;  3D6W A;  4NBE A;  1RO4 A;  3ESW A;  3GTM I;  5FLX f;  1TFI A;  2KPI A;  4NBA A;  1VQN Z;  3GTJ I;  3CC7 Z;  3KIF A;  2JA8 I;  1Y1V S;  1VQ9 Z;  3I55 1;  3BG1 B;  1K8A 2;  5CM2 M;  2JMO A;  4MXU A;  1VQK Z;  1VQL 1;  3S2D I;  2E2J I;  3HOU I;  1KQS Y;  3G6E Z;  1K8A 1;  4E2X A;  1DL6 A;  2K5R A;  3I56 1;  2IZ4 A;  1YJW Z;  2QRC B;  2P28 A;  5AN9 F;  3CCM Z;  4S1T A;  4RVF A;  1JWH C;  3TE5 B;  1VQO 1;  3CC2 Z;  1VQ5 Z;  1TWG I;  4BY7 I;  3FKI I;  4A3L I;  3VB9 A;  3CXC Z;  2DE7 A;  5IT9 f;  2DE6 A;  1RQF A;  5IT9 b;  2E7Z A;  3P5J B;  2V8I A;  2M6N A;  2IV2 X;  1ZB9 A;  1PFT A;  4RV9 A;  2GTH A;  2YAD A;  5T64 A;  1VQN 1;  2RHB A;  3GTM S;  1YHQ Z;  5FLM I;  4BBS I;  4NFR A;  1VQM Z;  1FDI A;  3TDH B;  2P3Y A;  1VQ9 1;  3G71 Z;  2RT9 A;  4HH4 A;  4A3J I;  3CCV 1;  3CMA 1;  1YUK A;  1I50 I;  3G6E 1;  2QKD A;  2NAP A;  1K9M 1;  2JS4 A;  1VQP Z;  3FQQ A;  1NUI A;  3GKQ A;  4NBD A;  2R7Z I;  1VQ5 1;  1USP A;  4QTT A;  3NDI A;  3K7A I;  4DGL A;  1I3Q I;  4RS4 A;  3S14 I;  1Y1W I;  3F3F C;  5IP9 I;  1RO2 A;  3CC4 1;  3M4O I;  3CCL Z;  3CXC Y;  3JAM b;  4E32 A;  1S72 Z;  1VQ4 Z;  5A2Q f;  5C44 I;  3Q87 A;  4RVD A;  2OTJ Z;  2F4M A;  2OOX B;  2R93 I;  4A3B I;  3NFZ A;  5A2Q b;  1M1K 2;  3CCS Z;  1VQ6 Z;  3GTQ I;  3VMH A;  2E9H A;  4XX2 A;  3VTN A;  2QEX 1;  1M1K 1;  4QTU A;  5D1P A;  1TWA I;  1YHQ 1;  3MON A;  1ML8 A;  1K83 I;  1RO0 A;  1QVG Z;  2GU2 A;  1VQM 1;  2JIO A;  3I4M I;  2QRD B;  3G4S Z;  2RBL A;  1Q16 A;  2AKL A;  3HOY I;  5FLX b;  1YI2 1;  4HGY A;  2R6M A;  3S15 I;  3H0G I;  3CCU Z;  2VUM I;  2E2I I;  2O53 A;  1Q81 2;  1YIT 1;  3H3V J;  1YJ9 Z;  4A3I I;  2OTL Z;  3CCR Z;  1YJN 1;  3GTP I;  3NH4 A;  1Q81 1;  1Y8C A;  3M3Y I;  2HF1 A;  2PK7 A;  2NVT I;  1K73 2;  2J6A A;  2V8K A;  2VPY A;  3S1Q I;  3CCL 1; 
#chains in the Genus database with same CATH homology
 1YIJ Z;  4MRI A;  1K73 1;  4NB8 A;  4A3G I;  3BG0 B;  3GTK I;  1S72 1;  5D1O B;  1QVF Z;  4MD7 A;  1VQ6 1;  4RVG A;  3T4N B;  2OOY B;  3NDJ A;  1Z01 A;  2BJO A;  3EER A;  3CCE Z;  1LQL A;  2QR1 B;  2RPR A;  1KC8 2;  2W03 A;  4NBG A;  2HU9 A;  1TWH I;  2PM9 A;  1QVG Y;  2WB1 A;  1KC8 1;  4MH4 A;  4NBF A;  3CC7 1;  2NVX I;  4MON A;  2JA5 I;  1Z02 A;  5T67 A;  1ZB8 A;  5C4X I;  1I6H I;  1VQ7 Z;  1K9M 2;  1VQK 1;  2YU9 I;  4E33 A;  3GTL I;  1TWF I;  2K3R A;  3EED A;  4MD8 A;  2I3C A;  1YJW 1;  3HOW I;  1NJI 2;  2R92 I;  4Y7N I;  3VMG A;  3CCM 1;  2VUG A;  1NJI 1;  4BY1 I;  1VLA A;  4NH1 C;  3CC2 1;  1KRL A;  3IF8 A;  1WII A;  2M48 A;  3IX0 A;  1Y1V I;  3FQM A;  1QVF Y;  1X0T A;  4NOZ A;  3S1R I;  2WAQ A;  3CCQ Z;  3I55 Z;  1WCM I;  3CCE 1;  3I07 A;  2H85 A;  4E2W A;  4A3D I;  3D9X A;  2LFU A;  3IFU A;  3I56 Z;  3I4N I;  1QYP A;  3HOZ I;  3OW2 Z;  4HGZ A;  3KIH A;  4DQY B;  1R9T I;  1QF8 A;  5C3E I;  1VQ7 1;  3G71 1;  3CME Z;  2PMZ A;  3J81 f;  2O4H A;  2GTI A;  3QWU A;  3MZK B;  1Q86 2;  1L1O C;  4NB9 A;  4A3E I;  2IZ3 A;  3J81 b;  1NP6 A;  4A3M I;  4A3C I;  1P9N A;  1VQP 1;  1Q86 1;  4DK1 A;  1RNI A;  3RZO I;  5LL6 f;  3NH5 A;  1JJ2 Z;  2E2H I;  1N8R 2;  4TNU A;  4MD9 A;  3CD6 Z;  4BBR I;  1W2B Z;  4X6A I;  2Q4Z A;  1N8R 1;  1ZH1 A;  3CCQ 1;  2RIQ A;  3CCV Z;  2LIY A;  1VQ4 1;  3CMA Z;  2DE5 A;  2QLV B;  2OTJ 1;  4NBC A;  3GCF A;  2JA7 I;  4E2Z A;  2NVY I;  3CCS 1;  3NH8 A;  2QA4 Z;  5IP7 I;  3J80 f;  4A3F I;  3S2H I;  3J80 b;  3GTG I;  4NBH A;  3G4S 1;  3CME 1;  3OW2 Y;  1VQ8 Z;  2JR6 A;  3RZD I;  3PO3 I;  2B63 I;  3CC4 Z;  3CPW Z;  2VF1 A;  2QRE B;  3PO2 I;  3CCU 1;  5D1O A;  1TWC I;  3CCJ Z;  5T6B A;  3HOX I;  3MZL B;  1YJ9 1;  3S1N I;  3S1M I;  1USP B;  2OTL 1;  4E2Y A;  3CCR 1;  5C4J I;  2QEX Z;  3LUS A;  3CD6 1;  1JJ2 Y;  2V8J A;  3F3P C;  4NBB A;  1YIJ 1;  3VMI A;  2NVQ I;  1W2B Y;  1N2F A;  1RLY A;  2ZAE B;  3S17 I;  2EGT A;  2G2K A;  1Q82 2;  1YI2 Z;  4E30 A;  2JA6 I;  1S7M A;  2QA4 1;  1KQS Z;  4RVH A;  3CQZ I;  1Q82 1;  2Y0S A;  1VQL Z;  2KI7 B;  2Q51 A;  1X3Z A;  4Y52 I;  1M90 2;  1X3W A;  1Z03 A;  1YIT Z;  4A3K I;  1M90 1;  1VQ8 1;  1YJN Z;  4A93 I;  3JAM f;  3S16 I;  3GTO I;  3J7A 4;  1WW9 A;  4AYB A;  2JUB A;  3PO3 S;  3HOV I;  4EWC A;  1VQO Z;  4E31 A;  3U50 C;  4BXX I;  2W04 A;  1KD1 2;  1SFO I;  3CCJ 1;  1Q7Y 2;  3CPW Y;  2JNY A;  2F4O A;  1YUA A;  1KD1 1;  1Q7Y 1;  2OZK A;  4CL1 A;  3HKZ A;  3D6W A;  4NBE A;  1RO4 A;  3ESW A;  3GTM I;  5FLX f;  1TFI A;  2KPI A;  4NBA A;  1VQN Z;  3GTJ I;  3CC7 Z;  3KIF A;  2JA8 I;  1Y1V S;  1VQ9 Z;  3I55 1;  3BG1 B;  1K8A 2;  5CM2 M;  2JMO A;  4MXU A;  1VQK Z;  1VQL 1;  3S2D I;  2E2J I;  3HOU I;  1KQS Y;  3G6E Z;  1K8A 1;  4E2X A;  1DL6 A;  2K5R A;  3I56 1;  2IZ4 A;  1YJW Z;  2QRC B;  2P28 A;  5AN9 F;  3CCM Z;  4S1T A;  4RVF A;  1JWH C;  3TE5 B;  1VQO 1;  3CC2 Z;  1VQ5 Z;  1TWG I;  4BY7 I;  3FKI I;  4A3L I;  3VB9 A;  3CXC Z;  2DE7 A;  5IT9 f;  2DE6 A;  1RQF A;  5IT9 b;  3P5J B;  2V8I A;  2M6N A;  1ZB9 A;  1PFT A;  4RV9 A;  2GTH A;  2YAD A;  5T64 A;  1VQN 1;  2RHB A;  3GTM S;  1YHQ Z;  5FLM I;  4BBS I;  4NFR A;  1VQM Z;  3TDH B;  2P3Y A;  1VQ9 1;  3G71 Z;  2RT9 A;  4HH4 A;  4A3J I;  3CCV 1;  3CMA 1;  1YUK A;  1I50 I;  3G6E 1;  2QKD A;  1K9M 1;  2JS4 A;  1VQP Z;  3FQQ A;  1NUI A;  3GKQ A;  4NBD A;  2R7Z I;  1VQ5 1;  1USP A;  4QTT A;  3NDI A;  3K7A I;  4DGL A;  1I3Q I;  4RS4 A;  3S14 I;  1Y1W I;  3F3F C;  5IP9 I;  1RO2 A;  3CC4 1;  3M4O I;  3CCL Z;  3CXC Y;  3JAM b;  4E32 A;  1S72 Z;  1VQ4 Z;  5A2Q f;  5C44 I;  3Q87 A;  4RVD A;  2OTJ Z;  2F4M A;  2OOX B;  2R93 I;  4A3B I;  3NFZ A;  5A2Q b;  1M1K 2;  3CCS Z;  1VQ6 Z;  3GTQ I;  3VMH A;  2E9H A;  4XX2 A;  3VTN A;  2QEX 1;  1M1K 1;  4QTU A;  5D1P A;  1TWA I;  1YHQ 1;  3MON A;  1ML8 A;  1K83 I;  1RO0 A;  1QVG Z;  2GU2 A;  1VQM 1;  3I4M I;  2QRD B;  3G4S Z;  2RBL A;  2AKL A;  3HOY I;  5FLX b;  1YI2 1;  4HGY A;  2R6M A;  3S15 I;  3H0G I;  3CCU Z;  2VUM I;  2E2I I;  2O53 A;  1Q81 2;  1YIT 1;  3H3V J;  1YJ9 Z;  4A3I I;  2OTL Z;  3CCR Z;  1YJN 1;  3GTP I;  3NH4 A;  1Q81 1;  3M3Y I;  2HF1 A;  2PK7 A;  2NVT I;  1K73 2;  2J6A A;  2V8K A;  3S1Q I;  3CCL 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...