3RZDI

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzdI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzdI02
2E2HI 5C4JI 2DE7A 2NVXI 3I4NI 3S2HI 2P3YA 1TWAI 4NBEA 5C3EI 2KPIA 4A3EI 2K5RA 2JA7I 3HOWI 2YU9I 5IP9I 3HOYI 3FKII 3GTKI 1USPB 3S1QI 1N2FA 1Y1WI 2E2JI 4A3CI 3EERA 1SFOI 1I6HI 3M4OI 2R93I 3VMHA 1RO4A 3I4MI 3PO3I 4NBAA 2R7ZI 1ML8A 1TWGI 1YUAA 3H0GI 3S1MI 2E2II 4BY7I 1Y1VI 4NBGA 2JA5I 2AKLA 3K7AI 3S17I 3GTMI 2NVYI 1R9TI 4NBDA 4A3JI 3GTGI 3I07A 4X6AI 4NBFA 4NBHA 3D6WA 3U50C 3RZDI 4NB8A 3VB9A 4QTTA 1X3ZA 2BJOA 3PO2I 4MH4A 3Q87A 3VMIA 2JA8I 3HOZI 2PK7A 1RLYA 5FLMI 5C4XI 3HOVI 3CQZI 4A3II 4A3DI 2NVQI 1TWFI 5CM2M 3HOXI 2HF1A 5IP7I 4XX2A 3S1RI 3S14I 1USPA 2R92I 2F4OA 4A3LI 3S16I 1X3WA 3S15I 3GTLI 4BBSI 3GKQA 2JNYA 4A3KI 2DE6A 2JR6A 2JS4A 2B63I 3GTQI 1L1OC 3RZOI 3PO3S 4BXXI 1DL6A 4A3BI 2RBLA 3LUSA 4BBRI 1Y1VS 4NBBA 1WCMI 4Y7NI 4QTUA 3GTMS 3GCFA 1ZB8A 4A93I 1I3QI 5C44I 1WW9A 2VUMI 3S2DI 1PFTA 3H3VJ 1ZB9A 1NUIA 3ESWA 2NVTI 1TFIA 1TWHI 4NOZA 1K83I 1VLAA 1I50I 3GTJI 4BY1I 1LQLA 4NBCA 1TWCI 3GTOI 4Y52I 2DE5A 4A3FI 3GTPI 2J6AA 2JA6I 3HOUI 4A3MI 4NB9A 1QYPA 3VMGA 2F4MA 4A3GI 3S1NI 3M3YI
chains in the Genus database with same CATH superfamily
3CXCY 2RHBA 2QRDB 3S2HI 2P3YA 5C3EI 3CC71 2KPIA 1Q16A 2YU9I 2IZ4A 3GTKI 1USPB 1N2FA 1Y1WI 2E2JI 2VPXA 2RT9A 3M4OI 3VMHA 2OTJ1 4NBAA 1QVGZ 3S1MI 1KD12 1QXFA 1VQK1 3IF8A 3K7AI 3S17I 3IFUA 1YJW1 1R9TI 4MD7A 4A3JI 1YJ91 4NFRA 4X6AI 2RIQA 3RZDI 3JAMf 4NB8A 2Y0SA 3CMEZ 3PO2I 1Q861 2JA8I 1RLYA 3CCSZ 3MZLB 4E33A 3J80f 1ZH1A 1TWFI 3I56Z 2PMZA 2VF1A 2RPRA 3CCQZ 1VQ8Z 4HH4A 2HF1A 5IP7I 4XX2A 3S1RI 2QLVB 2QRCB 1USPA 5T64A 2R92I 5LL6f 4A3LI 3S16I 2EGTA 3S15I 2JUBA 4BBSI 3GKQA 2QA4Z 2O4HA 3CCJZ 1L1OC 1DL6A 3CCMZ 4Y7NI 2JIOA 3OW2Z 3NDJA 1Q862 3GCFA 2JIMA 1JJ2Z 1I3QI 5C44I 1VQOZ 2VUMI 1WZNA 1PFTA 3H3VJ 1Q812 1NUIA 3CCL1 2YADA 1K83I 4NBCA 1YITZ 5A2Qb 2VPWA 2E7ZA 5T6BA 3GTPI 2J6AA 2JA6I 3CCV1 3CCS1 1YHQZ 4NH1C 1FDIA 3I561 3VMGA 3BG0B 5AN9F 2GTIA 1Q7Y1 2ZAEB 5C4JI 2NVXI 3I4NI 3NDIA 1QF8A 1TWAI 3G4SZ 3P5JB 2LIYA 2R6MA 3CPWZ 2OTLZ 2K5RA 1QVFZ 1M1K1 3HOYI 3CCJ1 3FKII 3CCM1 1SFOI 1N8R1 1JJ2Y 1VQ71 1RNIA 1VQO1 1TWGI 1YUAA 3CCUZ 3H0GI 2E2II 3BG1B 4BY7I 1Z03A 4MONA 1KRLA 1Q7Y2 4NBDA 4HGYA 3FQQA 1YIT1 3NH5A 3G71Z 3GTGI 2OOXB 3U50C 2IV2X 1X3ZA 4TNUA 2P28A 1VQ41 3CMA1 1M1K2 3HOZI 2PK7A 1YHQ1 3NH8A 3CQZI 3D9XA 2NVQI 1YUKA 1N8R2 3S14I 3CPWY 1VQMZ 2OTL1 2WAQA 2F4OA 1VQ61 4RV9A 2JR6A 2B63I 3RZOI 3TE5B 4BBRI 4NBBA 1WCMI 1K731 2H85A 3CCU1 4A93I 1AA6A 1P9NA 3S2DI 2QREB 5T67A 1VQPZ 2NVTI 1TFIA 4AYBA 3GTJI 3CC2Z 2G2KA 4Y52I 2JIRA 1RO0A 4A3MI 1QVGY 2IZ3A 4RS4A 2GTHA 2W04A 2JIPA 5IT9f 2JIQA 1K8A1 3M3YI 3J81f 2K3RA 2W03A 4E2YA 1NP6A 3QWUA 1KQSZ 1YJNZ 3S1QI 3CME1 4E32A 2VPZA 3JAMb 2QEXZ 2V8IA 2GU2A 4E2WA 5FLXf 5D1OB 1VQNZ 2R7ZI 3CCQ1 2LEXA 4RVGA 1VQ81 3EEDA 3J80b 1VQP1 4RVHA 4NBGA 4MD9A 2I3CA 4E2ZA 3CXCZ 3GTMI 1JWHC 1K8A2 2NVYI 3CC7Z 2OZKA 4MXUA 2NAPA 3CC4Z 4MD8A 1NJI1 3I07A 4NBFA 2QA41 3G6EZ 3D6WA 1YI2Z 3VB9A 3I55Z 4RVFA 2M48A 4RVDA 3VMIA 3OW2Y 1Q821 3IX0A 3D2LA 1WJ2A 1VQLZ 3HOVI 2OOYB 2PM9A 5CM2M 1KC81 3KIHA 3HOXI 2OTJZ 3MZKB 3NH4A 2E9HA 1VQKZ 3CCEZ 1YJWZ 1X0TA 1KQSY 1X3WA 1RQFA 2DE6A 2JS4A 4E2XA 1YJN1 1VQ5Z 4BXXI 1NJI2 4MRIA 2QEX1 4A3BI 1YIJZ 1Q822 1VQN1 3GTMS 1SIWA 5D1PA 1KC82 2LFUA 3G4S1 2QKDA 1QVFY 1I50I 4BY1I 1Z02A 3CC41 3G6E1 1YI21 2DE5A 1W2BZ 4A3FI 3I551 1S72Z 4NB9A 4E30A 1VQL1 2V45A 2VUGA 1QYPA 3CCRZ 1M901 1WIIA 2E2HI 3VTNA 3CCE1 2O53A 2V8KA 2V3VA 2DE7A 3IR7A 3HKZA 3CCLZ 4NBEA 1Y8CA 5A2Qf 4A3EI 2JA7I 3G711 3FQMA 3HOWI 5IP9I 1VQ51 4S1TA 4A3CI 3CCVZ 3EERA 1YIJ1 1I6HI 3F3FC 2R93I 2HU9A 1RO4A 1Q811 3I4MI 2QR1B 3PO3I 1VQ9Z 1ML8A 3F3PC 4CL1A 1M902 1K732 1Y1VI 2JA5I 1VQM1 2AKLA 2VPYA 1W2BY 3J7A4 4NBHA 2Q51A 1S721 4QTTA 2BJOA 4DQYB 4MH4A 3Q87A 1VQ7Z 5FLMI 4EWCA 5C4XI 3CCR1 4A3II 4A3DI 3CD6Z 4DGLA 1Z01A 3CC21 3GTLI 2JNYA 4A3KI 3GTQI 4DK1A 3PO3S 3TDHB 3CMAZ 1VQ4Z 2RBLA 3LUSA 2JMOA 1Y1VS 3T4NB 1K9M1 4QTUA 1VQ91 2KI7B 1ZB8A 2Q4ZA 1WW9A 5IT9b 1ZB9A 1RO2A 2V8JA 3ESWA 1TWHI 4NOZA 1FDOA 1VLAA 2WB1A 4HGZA 3J81b 1VQ6Z 1LQLA 3NFZA 1YJ9Z 1TWCI 3GTOI 5D1OA 3KIFA 3HOUI 4E31A 2AYDA 2F4MA 1KD11 4A3GI 2M6NA 3S1NI 3CD61 1S7MA 3MONA 1K9M2 5FLXb
chains in the Genus database with same CATH topology
3CXCY 2RHBA 2QRDB 3S2HI 2P3YA 5C3EI 3CC71 2KPIA 2YU9I 2IZ4A 3GTKI 1USPB 1N2FA 1Y1WI 2E2JI 2RT9A 3M4OI 3VMHA 2OTJ1 4NBAA 1QVGZ 3S1MI 1KD12 1VQK1 3IF8A 3K7AI 3S17I 3IFUA 1YJW1 1R9TI 4MD7A 4A3JI 1YJ91 4NFRA 4X6AI 2RIQA 3RZDI 3JAMf 4NB8A 2Y0SA 3CMEZ 3PO2I 1Q861 2JA8I 1RLYA 3CCSZ 3MZLB 4E33A 3J80f 1ZH1A 1TWFI 3I56Z 2PMZA 2VF1A 2RPRA 3CCQZ 1VQ8Z 4HH4A 2HF1A 5IP7I 4XX2A 3S1RI 2QLVB 2QRCB 1USPA 5T64A 2R92I 5LL6f 4A3LI 3S16I 2EGTA 3S15I 2JUBA 4BBSI 3GKQA 2QA4Z 2O4HA 3CCJZ 1L1OC 1DL6A 3CCMZ 4Y7NI 3OW2Z 3NDJA 1Q862 3GCFA 1JJ2Z 1I3QI 5C44I 1VQOZ 2VUMI 1PFTA 3H3VJ 1Q812 1NUIA 3CCL1 2YADA 1K83I 4NBCA 1YITZ 5A2Qb 5T6BA 3GTPI 2J6AA 2JA6I 3CCV1 3CCS1 1YHQZ 4NH1C 3I561 3VMGA 3BG0B 5AN9F 2GTIA 1Q7Y1 2ZAEB 5C4JI 2NVXI 3I4NI 3NDIA 1QF8A 1TWAI 3G4SZ 3P5JB 2LIYA 2R6MA 3CPWZ 2OTLZ 2K5RA 1QVFZ 1M1K1 3HOYI 3CCJ1 3FKII 3CCM1 1SFOI 1N8R1 1JJ2Y 1VQ71 1RNIA 1VQO1 1TWGI 1YUAA 3CCUZ 3H0GI 2E2II 3BG1B 4BY7I 1Z03A 4MONA 1KRLA 1Q7Y2 4NBDA 4HGYA 3FQQA 1YIT1 3NH5A 3G71Z 3GTGI 2OOXB 3U50C 1X3ZA 4TNUA 2P28A 1VQ41 3CMA1 1M1K2 3HOZI 2PK7A 1YHQ1 3NH8A 3CQZI 3D9XA 2NVQI 1YUKA 1N8R2 3S14I 3CPWY 1VQMZ 2OTL1 2WAQA 2F4OA 1VQ61 4RV9A 2JR6A 2B63I 3RZOI 3TE5B 4BBRI 4NBBA 1WCMI 1K731 2H85A 3CCU1 4A93I 1P9NA 3S2DI 2QREB 5T67A 1VQPZ 2NVTI 1TFIA 4AYBA 3GTJI 3CC2Z 2G2KA 4Y52I 1RO0A 4A3MI 1QVGY 2IZ3A 4RS4A 2GTHA 2W04A 5IT9f 1K8A1 3M3YI 3J81f 2K3RA 2W03A 4E2YA 1NP6A 3QWUA 1KQSZ 1YJNZ 3S1QI 3CME1 4E32A 3JAMb 2QEXZ 2V8IA 2GU2A 4E2WA 5FLXf 5D1OB 1VQNZ 2R7ZI 3CCQ1 1VQ81 4RVGA 3EEDA 3J80b 1VQP1 4RVHA 4NBGA 4MD9A 2I3CA 4E2ZA 3CXCZ 3GTMI 1JWHC 1K8A2 2NVYI 3CC7Z 2OZKA 4MXUA 3CC4Z 4MD8A 1NJI1 3I07A 4NBFA 2QA41 3G6EZ 3D6WA 1YI2Z 3VB9A 3I55Z 4RVFA 2M48A 4RVDA 3VMIA 3OW2Y 1Q821 3IX0A 1VQLZ 3HOVI 2OOYB 2PM9A 5CM2M 1KC81 3KIHA 3HOXI 2OTJZ 3MZKB 3NH4A 2E9HA 1VQKZ 3CCEZ 1YJWZ 1X0TA 1KQSY 1X3WA 1RQFA 2DE6A 2JS4A 4E2XA 1YJN1 1VQ5Z 4BXXI 1NJI2 4MRIA 2QEX1 4A3BI 1YIJZ 1Q822 1VQN1 3GTMS 5D1PA 1KC82 2LFUA 3G4S1 2QKDA 1QVFY 1I50I 4BY1I 1Z02A 3CC41 3G6E1 1YI21 2DE5A 1W2BZ 4A3FI 3I551 1S72Z 4NB9A 4E30A 1VQL1 2VUGA 1QYPA 3CCRZ 1M901 1WIIA 2E2HI 3VTNA 3CCE1 2O53A 2V8KA 2DE7A 3HKZA 3CCLZ 4NBEA 5A2Qf 4A3EI 2JA7I 3G711 3FQMA 3HOWI 5IP9I 1VQ51 4S1TA 4A3CI 3CCVZ 3EERA 1YIJ1 1I6HI 3F3FC 2R93I 2HU9A 1RO4A 1Q811 3I4MI 2QR1B 3PO3I 1VQ9Z 1ML8A 3F3PC 4CL1A 1M902 1K732 1Y1VI 2JA5I 1VQM1 2AKLA 1W2BY 3J7A4 4NBHA 2Q51A 1S721 4QTTA 2BJOA 4DQYB 4MH4A 3Q87A 1VQ7Z 5FLMI 4EWCA 5C4XI 3CCR1 4A3II 4A3DI 3CD6Z 4DGLA 1Z01A 3CC21 3GTLI 2JNYA 4A3KI 3GTQI 4DK1A 3PO3S 3TDHB 3CMAZ 1VQ4Z 2RBLA 3LUSA 2JMOA 1Y1VS 3T4NB 1K9M1 4QTUA 1VQ91 2KI7B 1ZB8A 2Q4ZA 1WW9A 5IT9b 1ZB9A 1RO2A 2V8JA 3ESWA 1TWHI 4NOZA 2WB1A 1VLAA 4HGZA 3J81b 1VQ6Z 1LQLA 3NFZA 1YJ9Z 1TWCI 3GTOI 5D1OA 3KIFA 3HOUI 4E31A 2F4MA 1KD11 4A3GI 2M6NA 3S1NI 3CD61 1S7MA 3MONA 1K9M2 5FLXb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H I;  5C4J I;  2DE7 A;  2NVX I;  3I4N I;  3S2H I;  2P3Y A;  1TWA I;  4NBE A;  5C3E I;  2KPI A;  4A3E I;  2K5R A;  2JA7 I;  3HOW I;  2YU9 I;  5IP9 I;  3HOY I;  3FKI I;  3GTK I;  1USP B;  3S1Q I;  1N2F A;  1Y1W I;  2E2J I;  4A3C I;  3EER A;  1SFO I;  1I6H I;  3M4O I;  2R93 I;  3VMH A;  1RO4 A;  3I4M I;  3PO3 I;  4NBA A;  2R7Z I;  1ML8 A;  1TWG I;  1YUA A;  3H0G I;  3S1M I;  2E2I I;  4BY7 I;  1Y1V I;  4NBG A;  2JA5 I;  2AKL A;  3K7A I;  3S17 I;  3GTM I;  2NVY I;  1R9T I;  4NBD A;  4A3J I;  3GTG I;  3I07 A;  4X6A I;  4NBF A;  4NBH A;  3D6W A;  3U50 C;  3RZD I;  4NB8 A;  3VB9 A;  4QTT A;  1X3Z A;  2BJO A;  3PO2 I;  4MH4 A;  3Q87 A;  3VMI A;  2JA8 I;  3HOZ I;  2PK7 A;  1RLY A;  5FLM I;  5C4X I;  3HOV I;  3CQZ I;  4A3I I;  4A3D I;  2NVQ I;  1TWF I;  5CM2 M;  3HOX I;  2HF1 A;  5IP7 I;  4XX2 A;  3S1R I;  3S14 I;  1USP A;  2R92 I;  2F4O A;  4A3L I;  3S16 I;  1X3W A;  3S15 I;  3GTL I;  4BBS I;  3GKQ A;  2JNY A;  4A3K I;  2DE6 A;  2JR6 A;  2JS4 A;  2B63 I;  3GTQ I;  1L1O C;  3RZO I;  3PO3 S;  4BXX I;  1DL6 A;  4A3B I;  2RBL A;  3LUS A;  4BBR I;  1Y1V S;  4NBB A;  1WCM I;  4Y7N I;  4QTU A;  3GTM S;  3GCF A;  1ZB8 A;  4A93 I;  1I3Q I;  5C44 I;  1WW9 A;  2VUM I;  3S2D I;  1PFT A;  3H3V J;  1ZB9 A;  1NUI A;  3ESW A;  2NVT I;  1TFI A;  1TWH I;  4NOZ A;  1K83 I;  1VLA A;  1I50 I;  3GTJ I;  4BY1 I;  1LQL A;  4NBC A;  1TWC I;  3GTO I;  4Y52 I;  2DE5 A;  4A3F I;  3GTP I;  2J6A A;  2JA6 I;  3HOU I;  4A3M I;  4NB9 A;  1QYP A;  3VMG A;  2F4M A;  4A3G I;  3S1N I;  3M3Y I; 
#chains in the Genus database with same CATH topology
 3CXC Y;  2RHB A;  2QRD B;  3S2H I;  2P3Y A;  5C3E I;  3CC7 1;  2KPI A;  1Q16 A;  2YU9 I;  2IZ4 A;  3GTK I;  1USP B;  1N2F A;  1Y1W I;  2E2J I;  2VPX A;  2RT9 A;  3M4O I;  3VMH A;  2OTJ 1;  4NBA A;  1QVG Z;  3S1M I;  1KD1 2;  1QXF A;  1VQK 1;  3IF8 A;  3K7A I;  3S17 I;  3IFU A;  1YJW 1;  1R9T I;  4MD7 A;  4A3J I;  1YJ9 1;  4NFR A;  4X6A I;  2RIQ A;  3RZD I;  3JAM f;  4NB8 A;  2Y0S A;  3CME Z;  3PO2 I;  1Q86 1;  2JA8 I;  1RLY A;  3CCS Z;  3MZL B;  4E33 A;  3J80 f;  1ZH1 A;  1TWF I;  3I56 Z;  2PMZ A;  2VF1 A;  2RPR A;  3CCQ Z;  1VQ8 Z;  4HH4 A;  2HF1 A;  5IP7 I;  4XX2 A;  3S1R I;  2QLV B;  2QRC B;  1USP A;  5T64 A;  2R92 I;  5LL6 f;  4A3L I;  3S16 I;  2EGT A;  3S15 I;  2JUB A;  4BBS I;  3GKQ A;  2QA4 Z;  2O4H A;  3CCJ Z;  1L1O C;  1DL6 A;  3CCM Z;  4Y7N I;  2JIO A;  3OW2 Z;  3NDJ A;  1Q86 2;  3GCF A;  2JIM A;  1JJ2 Z;  1I3Q I;  5C44 I;  1VQO Z;  2VUM I;  1WZN A;  1PFT A;  3H3V J;  1Q81 2;  1NUI A;  3CCL 1;  2YAD A;  1K83 I;  4NBC A;  1YIT Z;  5A2Q b;  2VPW A;  2E7Z A;  5T6B A;  3GTP I;  2J6A A;  2JA6 I;  3CCV 1;  3CCS 1;  1YHQ Z;  4NH1 C;  1FDI A;  3I56 1;  3VMG A;  3BG0 B;  5AN9 F;  2GTI A;  1Q7Y 1;  2ZAE B;  5C4J I;  2NVX I;  3I4N I;  3NDI A;  1QF8 A;  1TWA I;  3G4S Z;  3P5J B;  2LIY A;  2R6M A;  3CPW Z;  2OTL Z;  2K5R A;  1QVF Z;  1M1K 1;  3HOY I;  3CCJ 1;  3FKI I;  3CCM 1;  1SFO I;  1N8R 1;  1JJ2 Y;  1VQ7 1;  1RNI A;  1VQO 1;  1TWG I;  1YUA A;  3CCU Z;  3H0G I;  2E2I I;  3BG1 B;  4BY7 I;  1Z03 A;  4MON A;  1KRL A;  1Q7Y 2;  4NBD A;  4HGY A;  3FQQ A;  1YIT 1;  3NH5 A;  3G71 Z;  3GTG I;  2OOX B;  3U50 C;  2IV2 X;  1X3Z A;  4TNU A;  2P28 A;  1VQ4 1;  3CMA 1;  1M1K 2;  3HOZ I;  2PK7 A;  1YHQ 1;  3NH8 A;  3CQZ I;  3D9X A;  2NVQ I;  1YUK A;  1N8R 2;  3S14 I;  3CPW Y;  1VQM Z;  2OTL 1;  2WAQ A;  2F4O A;  1VQ6 1;  4RV9 A;  2JR6 A;  2B63 I;  3RZO I;  3TE5 B;  4BBR I;  4NBB A;  1WCM I;  1K73 1;  2H85 A;  3CCU 1;  4A93 I;  1AA6 A;  1P9N A;  3S2D I;  2QRE B;  5T67 A;  1VQP Z;  2NVT I;  1TFI A;  4AYB A;  3GTJ I;  3CC2 Z;  2G2K A;  4Y52 I;  2JIR A;  1RO0 A;  4A3M I;  1QVG Y;  2IZ3 A;  4RS4 A;  2GTH A;  2W04 A;  2JIP A;  5IT9 f;  2JIQ A;  1K8A 1;  3M3Y I;  3J81 f;  2K3R A;  2W03 A;  4E2Y A;  1NP6 A;  3QWU A;  1KQS Z;  1YJN Z;  3S1Q I;  3CME 1;  4E32 A;  2VPZ A;  3JAM b;  2QEX Z;  2V8I A;  2GU2 A;  4E2W A;  5FLX f;  5D1O B;  1VQN Z;  2R7Z I;  3CCQ 1;  2LEX A;  4RVG A;  1VQ8 1;  3EED A;  3J80 b;  1VQP 1;  4RVH A;  4NBG A;  4MD9 A;  2I3C A;  4E2Z A;  3CXC Z;  3GTM I;  1JWH C;  1K8A 2;  2NVY I;  3CC7 Z;  2OZK A;  4MXU A;  2NAP A;  3CC4 Z;  4MD8 A;  1NJI 1;  3I07 A;  4NBF A;  2QA4 1;  3G6E Z;  3D6W A;  1YI2 Z;  3VB9 A;  3I55 Z;  4RVF A;  2M48 A;  4RVD A;  3VMI A;  3OW2 Y;  1Q82 1;  3IX0 A;  3D2L A;  1WJ2 A;  1VQL Z;  3HOV I;  2OOY B;  2PM9 A;  5CM2 M;  1KC8 1;  3KIH A;  3HOX I;  2OTJ Z;  3MZK B;  3NH4 A;  2E9H A;  1VQK Z;  3CCE Z;  1YJW Z;  1X0T A;  1KQS Y;  1X3W A;  1RQF A;  2DE6 A;  2JS4 A;  4E2X A;  1YJN 1;  1VQ5 Z;  4BXX I;  1NJI 2;  4MRI A;  2QEX 1;  4A3B I;  1YIJ Z;  1Q82 2;  1VQN 1;  3GTM S;  1SIW A;  5D1P A;  1KC8 2;  2LFU A;  3G4S 1;  2QKD A;  1QVF Y;  1I50 I;  4BY1 I;  1Z02 A;  3CC4 1;  3G6E 1;  1YI2 1;  2DE5 A;  1W2B Z;  4A3F I;  3I55 1;  1S72 Z;  4NB9 A;  4E30 A;  1VQL 1;  2V45 A;  2VUG A;  1QYP A;  3CCR Z;  1M90 1;  1WII A;  2E2H I;  3VTN A;  3CCE 1;  2O53 A;  2V8K A;  2V3V A;  2DE7 A;  3IR7 A;  3HKZ A;  3CCL Z;  4NBE A;  1Y8C A;  5A2Q f;  4A3E I;  2JA7 I;  3G71 1;  3FQM A;  3HOW I;  5IP9 I;  1VQ5 1;  4S1T A;  4A3C I;  3CCV Z;  3EER A;  1YIJ 1;  1I6H I;  3F3F C;  2R93 I;  2HU9 A;  1RO4 A;  1Q81 1;  3I4M I;  2QR1 B;  3PO3 I;  1VQ9 Z;  1ML8 A;  3F3P C;  4CL1 A;  1M90 2;  1K73 2;  1Y1V I;  2JA5 I;  1VQM 1;  2AKL A;  2VPY A;  1W2B Y;  3J7A 4;  4NBH A;  2Q51 A;  1S72 1;  4QTT A;  2BJO A;  4DQY B;  4MH4 A;  3Q87 A;  1VQ7 Z;  5FLM I;  4EWC A;  5C4X I;  3CCR 1;  4A3I I;  4A3D I;  3CD6 Z;  4DGL A;  1Z01 A;  3CC2 1;  3GTL I;  2JNY A;  4A3K I;  3GTQ I;  4DK1 A;  3PO3 S;  3TDH B;  3CMA Z;  1VQ4 Z;  2RBL A;  3LUS A;  2JMO A;  1Y1V S;  3T4N B;  1K9M 1;  4QTU A;  1VQ9 1;  2KI7 B;  1ZB8 A;  2Q4Z A;  1WW9 A;  5IT9 b;  1ZB9 A;  1RO2 A;  2V8J A;  3ESW A;  1TWH I;  4NOZ A;  1FDO A;  1VLA A;  2WB1 A;  4HGZ A;  3J81 b;  1VQ6 Z;  1LQL A;  3NFZ A;  1YJ9 Z;  1TWC I;  3GTO I;  5D1O A;  3KIF A;  3HOU I;  4E31 A;  2AYD A;  2F4M A;  1KD1 1;  4A3G I;  2M6N A;  3S1N I;  3CD6 1;  1S7M A;  3MON A;  1K9M 2;  5FLX b; 
#chains in the Genus database with same CATH homology
 3CXC Y;  2RHB A;  2QRD B;  3S2H I;  2P3Y A;  5C3E I;  3CC7 1;  2KPI A;  2YU9 I;  2IZ4 A;  3GTK I;  1USP B;  1N2F A;  1Y1W I;  2E2J I;  2RT9 A;  3M4O I;  3VMH A;  2OTJ 1;  4NBA A;  1QVG Z;  3S1M I;  1KD1 2;  1VQK 1;  3IF8 A;  3K7A I;  3S17 I;  3IFU A;  1YJW 1;  1R9T I;  4MD7 A;  4A3J I;  1YJ9 1;  4NFR A;  4X6A I;  2RIQ A;  3RZD I;  3JAM f;  4NB8 A;  2Y0S A;  3CME Z;  3PO2 I;  1Q86 1;  2JA8 I;  1RLY A;  3CCS Z;  3MZL B;  4E33 A;  3J80 f;  1ZH1 A;  1TWF I;  3I56 Z;  2PMZ A;  2VF1 A;  2RPR A;  3CCQ Z;  1VQ8 Z;  4HH4 A;  2HF1 A;  5IP7 I;  4XX2 A;  3S1R I;  2QLV B;  2QRC B;  1USP A;  5T64 A;  2R92 I;  5LL6 f;  4A3L I;  3S16 I;  2EGT A;  3S15 I;  2JUB A;  4BBS I;  3GKQ A;  2QA4 Z;  2O4H A;  3CCJ Z;  1L1O C;  1DL6 A;  3CCM Z;  4Y7N I;  3OW2 Z;  3NDJ A;  1Q86 2;  3GCF A;  1JJ2 Z;  1I3Q I;  5C44 I;  1VQO Z;  2VUM I;  1PFT A;  3H3V J;  1Q81 2;  1NUI A;  3CCL 1;  2YAD A;  1K83 I;  4NBC A;  1YIT Z;  5A2Q b;  5T6B A;  3GTP I;  2J6A A;  2JA6 I;  3CCV 1;  3CCS 1;  1YHQ Z;  4NH1 C;  3I56 1;  3VMG A;  3BG0 B;  5AN9 F;  2GTI A;  1Q7Y 1;  2ZAE B;  5C4J I;  2NVX I;  3I4N I;  3NDI A;  1QF8 A;  1TWA I;  3G4S Z;  3P5J B;  2LIY A;  2R6M A;  3CPW Z;  2OTL Z;  2K5R A;  1QVF Z;  1M1K 1;  3HOY I;  3CCJ 1;  3FKI I;  3CCM 1;  1SFO I;  1N8R 1;  1JJ2 Y;  1VQ7 1;  1RNI A;  1VQO 1;  1TWG I;  1YUA A;  3CCU Z;  3H0G I;  2E2I I;  3BG1 B;  4BY7 I;  1Z03 A;  4MON A;  1KRL A;  1Q7Y 2;  4NBD A;  4HGY A;  3FQQ A;  1YIT 1;  3NH5 A;  3G71 Z;  3GTG I;  2OOX B;  3U50 C;  1X3Z A;  4TNU A;  2P28 A;  1VQ4 1;  3CMA 1;  1M1K 2;  3HOZ I;  2PK7 A;  1YHQ 1;  3NH8 A;  3CQZ I;  3D9X A;  2NVQ I;  1YUK A;  1N8R 2;  3S14 I;  3CPW Y;  1VQM Z;  2OTL 1;  2WAQ A;  2F4O A;  1VQ6 1;  4RV9 A;  2JR6 A;  2B63 I;  3RZO I;  3TE5 B;  4BBR I;  4NBB A;  1WCM I;  1K73 1;  2H85 A;  3CCU 1;  4A93 I;  1P9N A;  3S2D I;  2QRE B;  5T67 A;  1VQP Z;  2NVT I;  1TFI A;  4AYB A;  3GTJ I;  3CC2 Z;  2G2K A;  4Y52 I;  1RO0 A;  4A3M I;  1QVG Y;  2IZ3 A;  4RS4 A;  2GTH A;  2W04 A;  5IT9 f;  1K8A 1;  3M3Y I;  3J81 f;  2K3R A;  2W03 A;  4E2Y A;  1NP6 A;  3QWU A;  1KQS Z;  1YJN Z;  3S1Q I;  3CME 1;  4E32 A;  3JAM b;  2QEX Z;  2V8I A;  2GU2 A;  4E2W A;  5FLX f;  5D1O B;  1VQN Z;  2R7Z I;  3CCQ 1;  1VQ8 1;  4RVG A;  3EED A;  3J80 b;  1VQP 1;  4RVH A;  4NBG A;  4MD9 A;  2I3C A;  4E2Z A;  3CXC Z;  3GTM I;  1JWH C;  1K8A 2;  2NVY I;  3CC7 Z;  2OZK A;  4MXU A;  3CC4 Z;  4MD8 A;  1NJI 1;  3I07 A;  4NBF A;  2QA4 1;  3G6E Z;  3D6W A;  1YI2 Z;  3VB9 A;  3I55 Z;  4RVF A;  2M48 A;  4RVD A;  3VMI A;  3OW2 Y;  1Q82 1;  3IX0 A;  1VQL Z;  3HOV I;  2OOY B;  2PM9 A;  5CM2 M;  1KC8 1;  3KIH A;  3HOX I;  2OTJ Z;  3MZK B;  3NH4 A;  2E9H A;  1VQK Z;  3CCE Z;  1YJW Z;  1X0T A;  1KQS Y;  1X3W A;  1RQF A;  2DE6 A;  2JS4 A;  4E2X A;  1YJN 1;  1VQ5 Z;  4BXX I;  1NJI 2;  4MRI A;  2QEX 1;  4A3B I;  1YIJ Z;  1Q82 2;  1VQN 1;  3GTM S;  5D1P A;  1KC8 2;  2LFU A;  3G4S 1;  2QKD A;  1QVF Y;  1I50 I;  4BY1 I;  1Z02 A;  3CC4 1;  3G6E 1;  1YI2 1;  2DE5 A;  1W2B Z;  4A3F I;  3I55 1;  1S72 Z;  4NB9 A;  4E30 A;  1VQL 1;  2VUG A;  1QYP A;  3CCR Z;  1M90 1;  1WII A;  2E2H I;  3VTN A;  3CCE 1;  2O53 A;  2V8K A;  2DE7 A;  3HKZ A;  3CCL Z;  4NBE A;  5A2Q f;  4A3E I;  2JA7 I;  3G71 1;  3FQM A;  3HOW I;  5IP9 I;  1VQ5 1;  4S1T A;  4A3C I;  3CCV Z;  3EER A;  1YIJ 1;  1I6H I;  3F3F C;  2R93 I;  2HU9 A;  1RO4 A;  1Q81 1;  3I4M I;  2QR1 B;  3PO3 I;  1VQ9 Z;  1ML8 A;  3F3P C;  4CL1 A;  1M90 2;  1K73 2;  1Y1V I;  2JA5 I;  1VQM 1;  2AKL A;  1W2B Y;  3J7A 4;  4NBH A;  2Q51 A;  1S72 1;  4QTT A;  2BJO A;  4DQY B;  4MH4 A;  3Q87 A;  1VQ7 Z;  5FLM I;  4EWC A;  5C4X I;  3CCR 1;  4A3I I;  4A3D I;  3CD6 Z;  4DGL A;  1Z01 A;  3CC2 1;  3GTL I;  2JNY A;  4A3K I;  3GTQ I;  4DK1 A;  3PO3 S;  3TDH B;  3CMA Z;  1VQ4 Z;  2RBL A;  3LUS A;  2JMO A;  1Y1V S;  3T4N B;  1K9M 1;  4QTU A;  1VQ9 1;  2KI7 B;  1ZB8 A;  2Q4Z A;  1WW9 A;  5IT9 b;  1ZB9 A;  1RO2 A;  2V8J A;  3ESW A;  1TWH I;  4NOZ A;  2WB1 A;  1VLA A;  4HGZ A;  3J81 b;  1VQ6 Z;  1LQL A;  3NFZ A;  1YJ9 Z;  1TWC I;  3GTO I;  5D1O A;  3KIF A;  3HOU I;  4E31 A;  2F4M A;  1KD1 1;  4A3G I;  2M6N A;  3S1N I;  3CD6 1;  1S7M A;  3MON A;  1K9M 2;  5FLX b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...