3RZDI

Rna polymerase ii initiation complex with a 5-nt rna
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2011-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01096 TFIIS_C Transcription factor S-II (TFIIS)
I PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzdI01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3rzdI02
3HOZI 5C44I 1SFOI 3I4NI 4A3BI 4BY7I 1X3ZA 4A3EI 2NVXI 2E2HI 4BY1I 3GTMI 3M3YI 4X6AI 4BXXI 3VMGA 4A3MI 4NBGA 1TWGI 2JNYA 3RZOI 3HOVI 5IP9I 5C4XI 3PO3I 2HF1A 1WCMI 1TWFI 2DE7A 1K83I 3GTOI 1I6HI 3M4OI 1I50I 4A3II 3S2HI 3S1QI 3GTLI 3S1NI 3VMHA 1RLYA 4NBFA 4A3KI 3S15I 3ESWA 5C4JI 4A3LI 3GTPI 1ZB9A 5CM2M 2JA8I 1ZB8A 2AKLA 4NOZA 3S16I 2BJOA 2R93I 2J6AA 2K5RA 1USPB 1LQLA 3HOUI 2F4MA 2PK7A 4Y7NI 3S1RI 3VMIA 3FKII 3HOXI 1QYPA 2F4OA 3GTMS 4A3FI 3GKQA 2NVYI 3PO3S 2JA5I 1DL6A 3PO2I 1I3QI 1YUAA 3GCFA 4QTTA 3CQZI 2NVTI 3HOWI 2E2II 3LUSA 3K7AI 3HOYI 3I4MI 4A3GI 1TWAI 2VUMI 3H0GI 4NB9A 2DE5A 2KPIA 4XX2A 2YU9I 2JA7I 2RBLA 2JA6I 1X3WA 3EERA 5C3EI 3S1MI 1USPA 4A3CI 2E2JI 4NBDA 4NBBA 5FLMI 1N2FA 3I07A 3GTKI 1PFTA 3D6WA 3GTQI 4NBEA 3S17I 3Q87A 4BBRI 4QTUA 2R7ZI 4NBHA 1Y1VI 1L1OC 5IP7I 4NBCA 2NVQI 3H3VJ 3GTGI 2R92I 1RO4A 4MH4A 2DE6A 4A93I 4NBAA 3GTJI 4A3JI 2B63I 4A3DI 1NUIA 1R9TI 3VB9A 2JS4A 1VLAA 3U50C 1Y1VS 3RZDI 3S2DI 3S14I 1ML8A 4Y52I 4BBSI 4NB8A 1WW9A 1TWCI 1TFIA 2JR6A 1Y1WI 2P3YA 1TWHI
chains in the Genus database with same CATH superfamily
3HOZI 5C44I 3I4NI 4A3BI 3FQQA 4A3EI 4A3MI 2O4HA 1VQN1 3HOVI 3PO3I 1TWFI 4E2XA 1I6HI 2YADA 3J80f 3KIHA 3S2HI 3CCQ1 2I3CA 3JAMb 4TNUA 2RT9A 1Q861 2LIYA 1VQLZ 3CCJ1 2VPXA 3VTNA 3CMEZ 3S16I 2V3VA 3NH4A 2AYDA 1Q822 1VQO1 1VQ5Z 2Y0SA 3CD61 3NDJA 2WAQA 1M901 3CXCY 2HU9A 1JJ2Y 1NP6A 1Q7Y1 3GKQA 1VQKZ 3IF8A 3G6E1 1I3QI 3CC71 3CCJZ 3NH5A 4E2WA 1K8A2 5FLXb 3CCM1 5IT9b 4A3GI 2V8JA 1VQOZ 2JUBA 3EERA 5C3EI 2Q4ZA 3S1MI 1RQFA 1QVFZ 4HGYA 1RNIA 3D6WA 3Q87A 4CL1A 1X0TA 4QTUA 2R7ZI 2RIQA 2OOXB 5T6BA 1Y1VI 1L1OC 1VQM1 3CC7Z 3H3VJ 1JWHC 2K3RA 1RO4A 3HKZA 3CCMZ 4NBAA 1NJI1 2B63I 2KI7B 1NUIA 4MXUA 3VB9A 3J7A4 1YI21 5D1OB 1M1K1 3RZDI 3S14I 4E30A 3G4S1 2VUGA 4NB8A 1TWCI 1TFIA 4MD7A 1TWHI 3NH8A 3CCL1 1RO0A 1X3ZA 2NVXI 4DGLA 2E2HI 3M3YI 1Q811 3VMGA 2R6MA 1Z02A 2HF1A 1WCMI 1QVGZ 1VQMZ 1K83I 3GTOI 2PM9A 1VQ61 3CCR1 2VPZA 1Y8CA 1I50I 2VPWA 3S1QI 1S721 1Q862 4MD8A 4A3KI 3I561 2PMZA 3ESWA 3G4SZ 3MONA 3J81b 2JA8I 3CMA1 3I55Z 4E32A 3CCLZ 2BJOA 1QVFY 2K5RA 1LQLA 2OTL1 2ZAEB 3HOUI 5IT9f 4DQYB 1M902 2F4MA 2PK7A 4RVHA 5A2Qf 1Q7Y2 1VQ6Z 3S1RI 3VMIA 3HOXI 2GTIA 3CPWZ 4DK1A 3GTMS 1S72Z 4A3FI 5LL6f 4E31A 1K731 3CCE1 2NVYI 1VQ91 3I56Z 2JA5I 1DL6A 3PO2I 2JIMA 1YUAA 5T67A 1VQPZ 4QTTA 2QRCB 1KD11 1VQNZ 3P5JB 4NB9A 2DE5A 2KPIA 2YU9I 2OTLZ 2JA7I 2RBLA 2JA6I 4HGZA 3D2LA 1QVGY 4A3CI 1YJN1 2E2JI 1YHQ1 4NBBA 5FLMI 3D9XA 3CCQZ 1N2FA 1KC81 3CCV1 2IZ3A 3CCU1 4NBEA 1VQ9Z 4AYBA 1W2BZ 3IX0A 4NBHA 5IP7I 1NJI2 4MD9A 1WJ2A 3GTGI 2M48A 1YJW1 3KIFA 3CC41 2EGTA 2JIPA 2V8IA 2M6NA 3TDHB 1VLAA 1Y1VS 2WB1A 1ML8A 1VQ81 3CD6Z 1Q812 4BBSI 1WW9A 1Y1WI 1P9NA 2P3YA 2E7ZA 1YIJ1 3CCVZ 4BY7I 3CPWY 3CCUZ 4BY1I 4X6AI 1VQ41 4NBGA 1TWGI 3G6EZ 3RZOI 5C4XI 3J80b 1K9M1 2QKDA 4A3II 3S1NI 3VMHA 4MONA 1RLYA 1AA6A 3S15I 4RS4A 1VQ8Z 3JAMf 5C4JI 3OW2Z 3GTPI 5D1OA 1N8R1 4RVGA 2VF1A 3BG1B 1VQ4Z 2IZ4A 1USPB 1W2BY 3CCS1 4Y7NI 2LFUA 1RO2A 4MRIA 3FKII 3IR7A 2RPRA 1YI2Z 3PO3S 1KD12 4RV9A 1KRLA 2OTJ1 3GCFA 3T4NB 3CQZI 2NVTI 3HOWI 3TE5B 2JMOA 5FLXf 1YJ91 2OZKA 2VUMI 1Z01A 1Q16A 3G711 3CCSZ 1KC82 3CCRZ 1YUKA 4NBDA 1VQL1 2QRDB 3I07A 3GTKI 1WZNA 1PFTA 3GTQI 4BBRI 1ZH1A 4NH1C 2OTJZ 4NBCA 3CMAZ 1KQSZ 4NFRA 1FDOA 3OW2Y 2W04A 1VQ51 2R92I 4MH4A 5T64A 2DE6A 4EWCA 4A93I 1YJ9Z 4A3JI 4A3DI 2IV2X 1R9TI 3G71Z 5D1PA 2QR1B 1VQK1 4HH4A 3EEDA 3CCEZ 1SFOI 1WIIA 3GTMI 1K9M2 4BXXI 2P28A 2JNYA 5IP9I 4E33A 2DE7A 2JIRA 1M1K2 3M4OI 2NAPA 2QEX1 2V8KA 2E9HA 3GTLI 2QA41 2JIOA 1N8R2 4NBFA 2O53A 1YJNZ 3CC21 3QWUA 1YHQZ 2VPYA 4A3LI 1ZB9A 5CM2M 1ZB8A 2AKLA 4NOZA 1VQ71 3J81f 2R93I 2J6AA 1Z03A 5A2Qb 2GTHA 1YIT1 1FDIA 2GU2A 1KQSY 1YJWZ 2Q51A 2W03A 3CC4Z 4E2ZA 1QYPA 2F4OA 1Q821 2QEXZ 5AN9F 2H85A 2QA4Z 2G2KA 2OOYB 1QF8A 3BG0B 3NFZA 3F3PC 3CC2Z 2LEXA 1S7MA 2RHBA 3MZKB 1YIJZ 4E2YA 1VQ7Z 2E2II 3LUSA 3K7AI 3HOYI 3I4MI 3F3FC 1TWAI 1SIWA 3H0GI 1K8A1 2QREB 4XX2A 3FQMA 1X3WA 1K732 1YITZ 1USPA 2V45A 1QXFA 4RVFA 4S1TA 4RVDA 3I551 3S17I 2NVQI 3CXCZ 1JJ2Z 2JIQA 3GTJI 3MZLB 3IFUA 2JS4A 3U50C 2QLVB 3NDIA 3S2DI 2JR6A 1VQP1 4Y52I 3CME1
chains in the Genus database with same CATH topology
3HOZI 5C44I 3I4NI 4A3BI 3FQQA 4A3EI 4A3MI 2O4HA 1VQN1 3HOVI 3PO3I 1TWFI 4E2XA 1I6HI 2YADA 3J80f 3KIHA 3S2HI 3CCQ1 2I3CA 3JAMb 4TNUA 2RT9A 1Q861 2LIYA 1VQLZ 3CCJ1 3VTNA 3CMEZ 3S16I 3NH4A 1Q822 1VQO1 1VQ5Z 2Y0SA 3CD61 3NDJA 2WAQA 1M901 3CXCY 2HU9A 1JJ2Y 1NP6A 1Q7Y1 3GKQA 1VQKZ 3IF8A 3G6E1 1I3QI 3CC71 3CCJZ 3NH5A 4E2WA 1K8A2 5FLXb 3CCM1 5IT9b 4A3GI 2V8JA 1VQOZ 2JUBA 3EERA 5C3EI 2Q4ZA 3S1MI 1RQFA 1QVFZ 4HGYA 1RNIA 3D6WA 3Q87A 4CL1A 1X0TA 4QTUA 2R7ZI 2RIQA 2OOXB 5T6BA 1Y1VI 1L1OC 1VQM1 3CC7Z 3H3VJ 1JWHC 2K3RA 1RO4A 3HKZA 3CCMZ 4NBAA 1NJI1 2B63I 2KI7B 1NUIA 4MXUA 3VB9A 3J7A4 1YI21 5D1OB 1M1K1 3RZDI 3S14I 4E30A 3G4S1 2VUGA 4NB8A 1TWCI 1TFIA 4MD7A 1TWHI 3NH8A 3CCL1 1RO0A 1X3ZA 2NVXI 4DGLA 2E2HI 3M3YI 1Q811 3VMGA 2R6MA 1Z02A 2HF1A 1WCMI 1QVGZ 1VQMZ 1K83I 3GTOI 2PM9A 1VQ61 3CCR1 1I50I 3S1QI 1S721 1Q862 4MD8A 4A3KI 3I561 2PMZA 3ESWA 3G4SZ 3MONA 3J81b 2JA8I 3CMA1 3I55Z 4E32A 3CCLZ 2BJOA 1QVFY 2K5RA 1LQLA 2OTL1 2ZAEB 3HOUI 5IT9f 4DQYB 1M902 2F4MA 2PK7A 4RVHA 5A2Qf 1Q7Y2 1VQ6Z 3S1RI 3VMIA 3HOXI 2GTIA 3CPWZ 4DK1A 3GTMS 1S72Z 4A3FI 5LL6f 4E31A 1K731 3CCE1 2NVYI 1VQ91 3I56Z 2JA5I 1DL6A 3PO2I 1YUAA 5T67A 1VQPZ 4QTTA 2QRCB 1KD11 1VQNZ 3P5JB 4NB9A 2DE5A 2KPIA 2YU9I 2OTLZ 2JA7I 2RBLA 2JA6I 4HGZA 1QVGY 4A3CI 1YJN1 2E2JI 1YHQ1 4NBBA 5FLMI 3D9XA 3CCQZ 1N2FA 1KC81 3CCV1 2IZ3A 3CCU1 4NBEA 1VQ9Z 4AYBA 1W2BZ 3IX0A 4NBHA 5IP7I 1NJI2 4MD9A 3GTGI 2M48A 1YJW1 3KIFA 3CC41 2EGTA 2V8IA 2M6NA 3TDHB 1VLAA 1Y1VS 2WB1A 1ML8A 1VQ81 3CD6Z 1Q812 4BBSI 1WW9A 1Y1WI 1P9NA 2P3YA 1YIJ1 3CCVZ 4BY7I 3CPWY 3CCUZ 4BY1I 4X6AI 1VQ41 4NBGA 1TWGI 3G6EZ 3RZOI 5C4XI 3J80b 1K9M1 2QKDA 4A3II 3S1NI 3VMHA 4MONA 1RLYA 3S15I 4RS4A 1VQ8Z 3JAMf 5C4JI 3OW2Z 3GTPI 5D1OA 1N8R1 4RVGA 2VF1A 3BG1B 1VQ4Z 2IZ4A 1USPB 1W2BY 3CCS1 4Y7NI 2LFUA 1RO2A 4MRIA 3FKII 2RPRA 1YI2Z 3PO3S 1KD12 4RV9A 1KRLA 2OTJ1 3GCFA 3T4NB 3CQZI 2NVTI 3HOWI 3TE5B 2JMOA 5FLXf 1YJ91 2OZKA 2VUMI 1Z01A 3G711 3CCSZ 1KC82 3CCRZ 1YUKA 4NBDA 1VQL1 2QRDB 3I07A 3GTKI 1PFTA 3GTQI 4BBRI 1ZH1A 4NH1C 2OTJZ 4NBCA 3CMAZ 1KQSZ 4NFRA 3OW2Y 2W04A 1VQ51 2R92I 4MH4A 5T64A 2DE6A 4EWCA 4A93I 1YJ9Z 4A3JI 4A3DI 1R9TI 3G71Z 5D1PA 2QR1B 1VQK1 4HH4A 3EEDA 3CCEZ 1SFOI 1WIIA 3GTMI 1K9M2 4BXXI 2P28A 2JNYA 5IP9I 4E33A 2DE7A 1M1K2 3M4OI 2QEX1 2V8KA 2E9HA 3GTLI 2QA41 1N8R2 4NBFA 2O53A 1YJNZ 3CC21 1YHQZ 3QWUA 4A3LI 1ZB9A 5CM2M 1ZB8A 2AKLA 4NOZA 1VQ71 3J81f 2R93I 2J6AA 1Z03A 5A2Qb 2GTHA 1YIT1 2GU2A 1KQSY 1YJWZ 2Q51A 2W03A 3CC4Z 4E2ZA 1QYPA 2F4OA 1Q821 2QEXZ 5AN9F 2H85A 2QA4Z 2G2KA 2OOYB 1QF8A 3BG0B 3NFZA 3F3PC 3CC2Z 1S7MA 2RHBA 3MZKB 1YIJZ 4E2YA 1VQ7Z 2E2II 3LUSA 3K7AI 3HOYI 3I4MI 3F3FC 1TWAI 3H0GI 1K8A1 2QREB 4XX2A 3FQMA 1X3WA 1K732 1YITZ 1USPA 4RVFA 4S1TA 4RVDA 3I551 3S17I 2NVQI 3CXCZ 1JJ2Z 3GTJI 3MZLB 3IFUA 2JS4A 3U50C 2QLVB 3NDIA 3S2DI 2JR6A 1VQP1 4Y52I 3CME1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOZ I;  5C44 I;  1SFO I;  3I4N I;  4A3B I;  4BY7 I;  1X3Z A;  4A3E I;  2NVX I;  2E2H I;  4BY1 I;  3GTM I;  3M3Y I;  4X6A I;  4BXX I;  3VMG A;  4A3M I;  4NBG A;  1TWG I;  2JNY A;  3RZO I;  3HOV I;  5IP9 I;  5C4X I;  3PO3 I;  2HF1 A;  1WCM I;  1TWF I;  2DE7 A;  1K83 I;  3GTO I;  1I6H I;  3M4O I;  1I50 I;  4A3I I;  3S2H I;  3S1Q I;  3GTL I;  3S1N I;  3VMH A;  1RLY A;  4NBF A;  4A3K I;  3S15 I;  3ESW A;  5C4J I;  4A3L I;  3GTP I;  1ZB9 A;  5CM2 M;  2JA8 I;  1ZB8 A;  2AKL A;  4NOZ A;  3S16 I;  2BJO A;  2R93 I;  2J6A A;  2K5R A;  1USP B;  1LQL A;  3HOU I;  2F4M A;  2PK7 A;  4Y7N I;  3S1R I;  3VMI A;  3FKI I;  3HOX I;  1QYP A;  2F4O A;  3GTM S;  4A3F I;  3GKQ A;  2NVY I;  3PO3 S;  2JA5 I;  1DL6 A;  3PO2 I;  1I3Q I;  1YUA A;  3GCF A;  4QTT A;  3CQZ I;  2NVT I;  3HOW I;  2E2I I;  3LUS A;  3K7A I;  3HOY I;  3I4M I;  4A3G I;  1TWA I;  2VUM I;  3H0G I;  4NB9 A;  2DE5 A;  2KPI A;  4XX2 A;  2YU9 I;  2JA7 I;  2RBL A;  2JA6 I;  1X3W A;  3EER A;  5C3E I;  3S1M I;  1USP A;  4A3C I;  2E2J I;  4NBD A;  4NBB A;  5FLM I;  1N2F A;  3I07 A;  3GTK I;  1PFT A;  3D6W A;  3GTQ I;  4NBE A;  3S17 I;  3Q87 A;  4BBR I;  4QTU A;  2R7Z I;  4NBH A;  1Y1V I;  1L1O C;  5IP7 I;  4NBC A;  2NVQ I;  3H3V J;  3GTG I;  2R92 I;  1RO4 A;  4MH4 A;  2DE6 A;  4A93 I;  4NBA A;  3GTJ I;  4A3J I;  2B63 I;  4A3D I;  1NUI A;  1R9T I;  3VB9 A;  2JS4 A;  1VLA A;  3U50 C;  1Y1V S;  3RZD I;  3S2D I;  3S14 I;  1ML8 A;  4Y52 I;  4BBS I;  4NB8 A;  1WW9 A;  1TWC I;  1TFI A;  2JR6 A;  1Y1W I;  2P3Y A;  1TWH I; 
#chains in the Genus database with same CATH topology
 3HOZ I;  5C44 I;  3I4N I;  4A3B I;  3FQQ A;  4A3E I;  4A3M I;  2O4H A;  1VQN 1;  3HOV I;  3PO3 I;  1TWF I;  4E2X A;  1I6H I;  2YAD A;  3J80 f;  3KIH A;  3S2H I;  3CCQ 1;  2I3C A;  3JAM b;  4TNU A;  2RT9 A;  1Q86 1;  2LIY A;  1VQL Z;  3CCJ 1;  2VPX A;  3VTN A;  3CME Z;  3S16 I;  2V3V A;  3NH4 A;  2AYD A;  1Q82 2;  1VQO 1;  1VQ5 Z;  2Y0S A;  3CD6 1;  3NDJ A;  2WAQ A;  1M90 1;  3CXC Y;  2HU9 A;  1JJ2 Y;  1NP6 A;  1Q7Y 1;  3GKQ A;  1VQK Z;  3IF8 A;  3G6E 1;  1I3Q I;  3CC7 1;  3CCJ Z;  3NH5 A;  4E2W A;  1K8A 2;  5FLX b;  3CCM 1;  5IT9 b;  4A3G I;  2V8J A;  1VQO Z;  2JUB A;  3EER A;  5C3E I;  2Q4Z A;  3S1M I;  1RQF A;  1QVF Z;  4HGY A;  1RNI A;  3D6W A;  3Q87 A;  4CL1 A;  1X0T A;  4QTU A;  2R7Z I;  2RIQ A;  2OOX B;  5T6B A;  1Y1V I;  1L1O C;  1VQM 1;  3CC7 Z;  3H3V J;  1JWH C;  2K3R A;  1RO4 A;  3HKZ A;  3CCM Z;  4NBA A;  1NJI 1;  2B63 I;  2KI7 B;  1NUI A;  4MXU A;  3VB9 A;  3J7A 4;  1YI2 1;  5D1O B;  1M1K 1;  3RZD I;  3S14 I;  4E30 A;  3G4S 1;  2VUG A;  4NB8 A;  1TWC I;  1TFI A;  4MD7 A;  1TWH I;  3NH8 A;  3CCL 1;  1RO0 A;  1X3Z A;  2NVX I;  4DGL A;  2E2H I;  3M3Y I;  1Q81 1;  3VMG A;  2R6M A;  1Z02 A;  2HF1 A;  1WCM I;  1QVG Z;  1VQM Z;  1K83 I;  3GTO I;  2PM9 A;  1VQ6 1;  3CCR 1;  2VPZ A;  1Y8C A;  1I50 I;  2VPW A;  3S1Q I;  1S72 1;  1Q86 2;  4MD8 A;  4A3K I;  3I56 1;  2PMZ A;  3ESW A;  3G4S Z;  3MON A;  3J81 b;  2JA8 I;  3CMA 1;  3I55 Z;  4E32 A;  3CCL Z;  2BJO A;  1QVF Y;  2K5R A;  1LQL A;  2OTL 1;  2ZAE B;  3HOU I;  5IT9 f;  4DQY B;  1M90 2;  2F4M A;  2PK7 A;  4RVH A;  5A2Q f;  1Q7Y 2;  1VQ6 Z;  3S1R I;  3VMI A;  3HOX I;  2GTI A;  3CPW Z;  4DK1 A;  3GTM S;  1S72 Z;  4A3F I;  5LL6 f;  4E31 A;  1K73 1;  3CCE 1;  2NVY I;  1VQ9 1;  3I56 Z;  2JA5 I;  1DL6 A;  3PO2 I;  2JIM A;  1YUA A;  5T67 A;  1VQP Z;  4QTT A;  2QRC B;  1KD1 1;  1VQN Z;  3P5J B;  4NB9 A;  2DE5 A;  2KPI A;  2YU9 I;  2OTL Z;  2JA7 I;  2RBL A;  2JA6 I;  4HGZ A;  3D2L A;  1QVG Y;  4A3C I;  1YJN 1;  2E2J I;  1YHQ 1;  4NBB A;  5FLM I;  3D9X A;  3CCQ Z;  1N2F A;  1KC8 1;  3CCV 1;  2IZ3 A;  3CCU 1;  4NBE A;  1VQ9 Z;  4AYB A;  1W2B Z;  3IX0 A;  4NBH A;  5IP7 I;  1NJI 2;  4MD9 A;  1WJ2 A;  3GTG I;  2M48 A;  1YJW 1;  3KIF A;  3CC4 1;  2EGT A;  2JIP A;  2V8I A;  2M6N A;  3TDH B;  1VLA A;  1Y1V S;  2WB1 A;  1ML8 A;  1VQ8 1;  3CD6 Z;  1Q81 2;  4BBS I;  1WW9 A;  1Y1W I;  1P9N A;  2P3Y A;  2E7Z A;  1YIJ 1;  3CCV Z;  4BY7 I;  3CPW Y;  3CCU Z;  4BY1 I;  4X6A I;  1VQ4 1;  4NBG A;  1TWG I;  3G6E Z;  3RZO I;  5C4X I;  3J80 b;  1K9M 1;  2QKD A;  4A3I I;  3S1N I;  3VMH A;  4MON A;  1RLY A;  1AA6 A;  3S15 I;  4RS4 A;  1VQ8 Z;  3JAM f;  5C4J I;  3OW2 Z;  3GTP I;  5D1O A;  1N8R 1;  4RVG A;  2VF1 A;  3BG1 B;  1VQ4 Z;  2IZ4 A;  1USP B;  1W2B Y;  3CCS 1;  4Y7N I;  2LFU A;  1RO2 A;  4MRI A;  3FKI I;  3IR7 A;  2RPR A;  1YI2 Z;  3PO3 S;  1KD1 2;  4RV9 A;  1KRL A;  2OTJ 1;  3GCF A;  3T4N B;  3CQZ I;  2NVT I;  3HOW I;  3TE5 B;  2JMO A;  5FLX f;  1YJ9 1;  2OZK A;  2VUM I;  1Z01 A;  1Q16 A;  3G71 1;  3CCS Z;  1KC8 2;  3CCR Z;  1YUK A;  4NBD A;  1VQL 1;  2QRD B;  3I07 A;  3GTK I;  1WZN A;  1PFT A;  3GTQ I;  4BBR I;  1ZH1 A;  4NH1 C;  2OTJ Z;  4NBC A;  3CMA Z;  1KQS Z;  4NFR A;  1FDO A;  3OW2 Y;  2W04 A;  1VQ5 1;  2R92 I;  4MH4 A;  5T64 A;  2DE6 A;  4EWC A;  4A93 I;  1YJ9 Z;  4A3J I;  4A3D I;  2IV2 X;  1R9T I;  3G71 Z;  5D1P A;  2QR1 B;  1VQK 1;  4HH4 A;  3EED A;  3CCE Z;  1SFO I;  1WII A;  3GTM I;  1K9M 2;  4BXX I;  2P28 A;  2JNY A;  5IP9 I;  4E33 A;  2DE7 A;  2JIR A;  1M1K 2;  3M4O I;  2NAP A;  2QEX 1;  2V8K A;  2E9H A;  3GTL I;  2QA4 1;  2JIO A;  1N8R 2;  4NBF A;  2O53 A;  1YJN Z;  3CC2 1;  3QWU A;  1YHQ Z;  2VPY A;  4A3L I;  1ZB9 A;  5CM2 M;  1ZB8 A;  2AKL A;  4NOZ A;  1VQ7 1;  3J81 f;  2R93 I;  2J6A A;  1Z03 A;  5A2Q b;  2GTH A;  1YIT 1;  1FDI A;  2GU2 A;  1KQS Y;  1YJW Z;  2Q51 A;  2W03 A;  3CC4 Z;  4E2Z A;  1QYP A;  2F4O A;  1Q82 1;  2QEX Z;  5AN9 F;  2H85 A;  2QA4 Z;  2G2K A;  2OOY B;  1QF8 A;  3BG0 B;  3NFZ A;  3F3P C;  3CC2 Z;  2LEX A;  1S7M A;  2RHB A;  3MZK B;  1YIJ Z;  4E2Y A;  1VQ7 Z;  2E2I I;  3LUS A;  3K7A I;  3HOY I;  3I4M I;  3F3F C;  1TWA I;  1SIW A;  3H0G I;  1K8A 1;  2QRE B;  4XX2 A;  3FQM A;  1X3W A;  1K73 2;  1YIT Z;  1USP A;  2V45 A;  1QXF A;  4RVF A;  4S1T A;  4RVD A;  3I55 1;  3S17 I;  2NVQ I;  3CXC Z;  1JJ2 Z;  2JIQ A;  3GTJ I;  3MZL B;  3IFU A;  2JS4 A;  3U50 C;  2QLV B;  3NDI A;  3S2D I;  2JR6 A;  1VQP 1;  4Y52 I;  3CME 1; 
#chains in the Genus database with same CATH homology
 3HOZ I;  5C44 I;  3I4N I;  4A3B I;  3FQQ A;  4A3E I;  4A3M I;  2O4H A;  1VQN 1;  3HOV I;  3PO3 I;  1TWF I;  4E2X A;  1I6H I;  2YAD A;  3J80 f;  3KIH A;  3S2H I;  3CCQ 1;  2I3C A;  3JAM b;  4TNU A;  2RT9 A;  1Q86 1;  2LIY A;  1VQL Z;  3CCJ 1;  3VTN A;  3CME Z;  3S16 I;  3NH4 A;  1Q82 2;  1VQO 1;  1VQ5 Z;  2Y0S A;  3CD6 1;  3NDJ A;  2WAQ A;  1M90 1;  3CXC Y;  2HU9 A;  1JJ2 Y;  1NP6 A;  1Q7Y 1;  3GKQ A;  1VQK Z;  3IF8 A;  3G6E 1;  1I3Q I;  3CC7 1;  3CCJ Z;  3NH5 A;  4E2W A;  1K8A 2;  5FLX b;  3CCM 1;  5IT9 b;  4A3G I;  2V8J A;  1VQO Z;  2JUB A;  3EER A;  5C3E I;  2Q4Z A;  3S1M I;  1RQF A;  1QVF Z;  4HGY A;  1RNI A;  3D6W A;  3Q87 A;  4CL1 A;  1X0T A;  4QTU A;  2R7Z I;  2RIQ A;  2OOX B;  5T6B A;  1Y1V I;  1L1O C;  1VQM 1;  3CC7 Z;  3H3V J;  1JWH C;  2K3R A;  1RO4 A;  3HKZ A;  3CCM Z;  4NBA A;  1NJI 1;  2B63 I;  2KI7 B;  1NUI A;  4MXU A;  3VB9 A;  3J7A 4;  1YI2 1;  5D1O B;  1M1K 1;  3RZD I;  3S14 I;  4E30 A;  3G4S 1;  2VUG A;  4NB8 A;  1TWC I;  1TFI A;  4MD7 A;  1TWH I;  3NH8 A;  3CCL 1;  1RO0 A;  1X3Z A;  2NVX I;  4DGL A;  2E2H I;  3M3Y I;  1Q81 1;  3VMG A;  2R6M A;  1Z02 A;  2HF1 A;  1WCM I;  1QVG Z;  1VQM Z;  1K83 I;  3GTO I;  2PM9 A;  1VQ6 1;  3CCR 1;  1I50 I;  3S1Q I;  1S72 1;  1Q86 2;  4MD8 A;  4A3K I;  3I56 1;  2PMZ A;  3ESW A;  3G4S Z;  3MON A;  3J81 b;  2JA8 I;  3CMA 1;  3I55 Z;  4E32 A;  3CCL Z;  2BJO A;  1QVF Y;  2K5R A;  1LQL A;  2OTL 1;  2ZAE B;  3HOU I;  5IT9 f;  4DQY B;  1M90 2;  2F4M A;  2PK7 A;  4RVH A;  5A2Q f;  1Q7Y 2;  1VQ6 Z;  3S1R I;  3VMI A;  3HOX I;  2GTI A;  3CPW Z;  4DK1 A;  3GTM S;  1S72 Z;  4A3F I;  5LL6 f;  4E31 A;  1K73 1;  3CCE 1;  2NVY I;  1VQ9 1;  3I56 Z;  2JA5 I;  1DL6 A;  3PO2 I;  1YUA A;  5T67 A;  1VQP Z;  4QTT A;  2QRC B;  1KD1 1;  1VQN Z;  3P5J B;  4NB9 A;  2DE5 A;  2KPI A;  2YU9 I;  2OTL Z;  2JA7 I;  2RBL A;  2JA6 I;  4HGZ A;  1QVG Y;  4A3C I;  1YJN 1;  2E2J I;  1YHQ 1;  4NBB A;  5FLM I;  3D9X A;  3CCQ Z;  1N2F A;  1KC8 1;  3CCV 1;  2IZ3 A;  3CCU 1;  4NBE A;  1VQ9 Z;  4AYB A;  1W2B Z;  3IX0 A;  4NBH A;  5IP7 I;  1NJI 2;  4MD9 A;  3GTG I;  2M48 A;  1YJW 1;  3KIF A;  3CC4 1;  2EGT A;  2V8I A;  2M6N A;  3TDH B;  1VLA A;  1Y1V S;  2WB1 A;  1ML8 A;  1VQ8 1;  3CD6 Z;  1Q81 2;  4BBS I;  1WW9 A;  1Y1W I;  1P9N A;  2P3Y A;  1YIJ 1;  3CCV Z;  4BY7 I;  3CPW Y;  3CCU Z;  4BY1 I;  4X6A I;  1VQ4 1;  4NBG A;  1TWG I;  3G6E Z;  3RZO I;  5C4X I;  3J80 b;  1K9M 1;  2QKD A;  4A3I I;  3S1N I;  3VMH A;  4MON A;  1RLY A;  3S15 I;  4RS4 A;  1VQ8 Z;  3JAM f;  5C4J I;  3OW2 Z;  3GTP I;  5D1O A;  1N8R 1;  4RVG A;  2VF1 A;  3BG1 B;  1VQ4 Z;  2IZ4 A;  1USP B;  1W2B Y;  3CCS 1;  4Y7N I;  2LFU A;  1RO2 A;  4MRI A;  3FKI I;  2RPR A;  1YI2 Z;  3PO3 S;  1KD1 2;  4RV9 A;  1KRL A;  2OTJ 1;  3GCF A;  3T4N B;  3CQZ I;  2NVT I;  3HOW I;  3TE5 B;  2JMO A;  5FLX f;  1YJ9 1;  2OZK A;  2VUM I;  1Z01 A;  3G71 1;  3CCS Z;  1KC8 2;  3CCR Z;  1YUK A;  4NBD A;  1VQL 1;  2QRD B;  3I07 A;  3GTK I;  1PFT A;  3GTQ I;  4BBR I;  1ZH1 A;  4NH1 C;  2OTJ Z;  4NBC A;  3CMA Z;  1KQS Z;  4NFR A;  3OW2 Y;  2W04 A;  1VQ5 1;  2R92 I;  4MH4 A;  5T64 A;  2DE6 A;  4EWC A;  4A93 I;  1YJ9 Z;  4A3J I;  4A3D I;  1R9T I;  3G71 Z;  5D1P A;  2QR1 B;  1VQK 1;  4HH4 A;  3EED A;  3CCE Z;  1SFO I;  1WII A;  3GTM I;  1K9M 2;  4BXX I;  2P28 A;  2JNY A;  5IP9 I;  4E33 A;  2DE7 A;  1M1K 2;  3M4O I;  2QEX 1;  2V8K A;  2E9H A;  3GTL I;  2QA4 1;  1N8R 2;  4NBF A;  2O53 A;  1YJN Z;  3CC2 1;  1YHQ Z;  3QWU A;  4A3L I;  1ZB9 A;  5CM2 M;  1ZB8 A;  2AKL A;  4NOZ A;  1VQ7 1;  3J81 f;  2R93 I;  2J6A A;  1Z03 A;  5A2Q b;  2GTH A;  1YIT 1;  2GU2 A;  1KQS Y;  1YJW Z;  2Q51 A;  2W03 A;  3CC4 Z;  4E2Z A;  1QYP A;  2F4O A;  1Q82 1;  2QEX Z;  5AN9 F;  2H85 A;  2QA4 Z;  2G2K A;  2OOY B;  1QF8 A;  3BG0 B;  3NFZ A;  3F3P C;  3CC2 Z;  1S7M A;  2RHB A;  3MZK B;  1YIJ Z;  4E2Y A;  1VQ7 Z;  2E2I I;  3LUS A;  3K7A I;  3HOY I;  3I4M I;  3F3F C;  1TWA I;  3H0G I;  1K8A 1;  2QRE B;  4XX2 A;  3FQM A;  1X3W A;  1K73 2;  1YIT Z;  1USP A;  4RVF A;  4S1T A;  4RVD A;  3I55 1;  3S17 I;  2NVQ I;  3CXC Z;  1JJ2 Z;  3GTJ I;  3MZL B;  3IFU A;  2JS4 A;  3U50 C;  2QLV B;  3NDI A;  3S2D I;  2JR6 A;  1VQP 1;  4Y52 I;  3CME 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...