3G71Z

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g71Z00
3CD6Z 3I56Z 1S72Z 1NJI2 1VQ7Z 1K8A1 1Q862 2OTLZ 3CC71 1VQL1 1VQPZ 2QEX1 1JJ2Z 1YIJ1 3CMA1 1Q822 3CD61 3I561 1S721 1N8R2 1VQ71 1KD12 2QA4Z 3CCRZ 1VQP1 3CC2Z 1QVFZ 3CCEZ 1YJ91 3CCJZ 1VQ5Z 1M1K2 1VQKZ 3OW2Y 1VQ81 1NJI1 1Q861 2QA41 3CCR1 1W2BY 1KQSZ 1VQOZ 3CCE1 3CCLZ 1M902 1VQ4Z 1Q821 3CCJ1 1VQ51 1YJWZ 1VQK1 1N8R1 1KD11 2OTJ1 3OW2Z 1VQO1 3CCL1 1VQ41 3G6EZ 1M1K1 1YJW1 3CC4Z 3CCQZ 1K9M2 2OTL1 3CCUZ 1K731 1QVGY 1KC82 1M901 1VQNZ 1YHQZ 3G6E1 3CC41 3CCQ1 1K732 3I55Z 3CC21 3G4SZ 3CCU1 1YJNZ 1Q7Y2 1VQN1 1YHQ1 3CPWY 1QVGZ 1K9M1 1YITZ 3CCMZ 3CXCY 3I551 1YJN1 3G4S1 1KC81 1JJ2Y 1W2BZ 1VQ6Z 1YIT1 3CCM1 1VQMZ 1Q7Y1 1Q812 3CXCZ 1YI2Z 1VQ61 3CCVZ 1VQ9Z 1VQM1 3G71Z 1YJ9Z 1VQ8Z 1KQSY 1K8A2 1YI21 3CCV1 3CCSZ 1VQ91 3G711 1Q811 3CMEZ 3CC7Z 1VQLZ 3CPWZ 2QEXZ 3CCS1 2OTJZ 1YIJZ 3CMAZ 3CME1 1QVFY
chains in the Genus database with same CATH superfamily
4S1TA 2JIPA 3M4OI 1VQL1 1PFTA 2QEX1 3K7AI 3IX0A 1Q16A 4NH1C 3CMA1 5C3EI 3I561 1S721 1ZB9A 1VQ71 1KD12 3S16I 1VQP1 3GTJI 4NBHA 5CM2M 5A2Qf 3EEDA 1LQLA 3CCJZ 2F4MA 4NBCA 1VQKZ 3S2DI 1NJI1 2JA5I 1Q861 4BY7I 4E30A 1X3WA 3I07A 3JAMb 2LEXA 1Q821 1QF8A 1YJWZ 2VUMI 1N8R1 3GTOI 3I4NI 2JR6A 3IF8A 3J80f 3CCL1 4A3LI 2H85A 1L1OC 3FQQA 2NVXI 3FQMA 2VUGA 5A2Qb 3VMHA 1M901 3PO3I 1YHQZ 2DE5A 2KI7B 3HOUI 3CC41 2JS4A 4MD9A 1TFIA 1TWHI 1USPA 1YJNZ 1Q7Y2 2M48A 2QRCB 3GTPI 2NVTI 4X6AI 4Y52I 3CXCY 3G4S1 3J80b 2RPRA 1KC81 2R92I 1JJ2Y 2Q51A 4Y7NI 2GU2A 3HOZI 1VQ6Z 2V45A 4NBGA 3S1QI 4MXUA 1VQMZ 1WW9A 3CXCZ 1Z01A 1ZH1A 1KRLA 2JA6I 2OOYB 1Z02A 2JNYA 3H0GI 4QTTA 1KQSY 2JIQA 1ML8A 4TNUA 3CCSZ 4QTUA 2VPWA 3LUSA 3NH8A 1P9NA 1VQLZ 3CPWZ 1I50I 2QEXZ 3I4MI 3CMAZ 2JIMA 4MD8A 3H3VJ 3CME1 2V8IA 3I56Z 1S72Z 2P28A 1VQ7Z 2JIOA 3S1MI 2OTLZ 3VTNA 4RVGA 5D1OB 2DE7A 1VQPZ 1YIJ1 3CD61 2JA8I 2OZKA 5T64A 4NBDA 1FDIA 4BXXI 3GTLI 3GCFA 5C44I 3CQZI 4RVHA 1ZB8A 2QA41 3IFUA 4NB8A 4NFRA 1I3QI 3T4NB 3CCE1 3CCLZ 3D2LA 3GTMS 3Q87A 4NBFA 1Y8CA 1KD11 4MRIA 1VQO1 1VQ41 4NB9A 3CC4Z 2OTL1 1JWHC 5IP7I 2I3CA 1QVGY 1FDOA 3ESWA 1Y1VS 2R6MA 4DQYB 2PM9A 1QXFA 5IT9f 3P5JB 2NVYI 3HOXI 3G4SZ 2ZAEB 1VQN1 3S1RI 2PK7A 1QVGZ 1RNIA 2R93I 3NFZA 4BBRI 3I551 3EERA 1SFOI 2F4OA 2E7ZA 3VMGA 3NDIA 3IR7A 2RT9A 1YIT1 2NVQI 1Q7Y1 4CL1A 5IT9b 3HOVI 1AA6A 5C4XI 2WAQA 3D9XA 2IZ4A 4MH4A 2J6AA 2KPIA 1VQ8Z 4A3DI 2BJOA 2GTIA 1K8A2 3CCV1 4EWCA 3G711 4AYBA 3CMEZ 2K5RA 2E9HA 3GTGI 1YIJZ 3MZLB 3NH4A 3CD6Z 2G2KA 1RO2A 4BBSI 3CC71 2E2HI 1S7MA 1JJ2Z 4MONA 3KIFA 4E2XA 1RLYA 3MONA 2QA4Z 3MZKB 4E31A 2QR1B 3CC2Z 3CCEZ 4BY1I 1M1K2 1VQ81 4NBAA 3J81f 2QLVB 3HKZA 3CCR1 2QREB 1W2BY 1KQSZ 1VQOZ 3S17I 1VQ4Z 2IV2X 1WJ2A 2E2II 2VF1A 1VQ51 2V3VA 3VB9A 3PO2I 3S2HI 1R9TI 3GTMI 4NOZA 1WIIA 1K9M2 2B63I 1K731 4A3KI 3KIHA 1RQFA 1VQNZ 2JA7I 3G6E1 2JIRA 3J81b 2O53A 3CCQ1 4A3JI 3M3YI 4E33A 1Y1VI 1K732 1I6HI 1DL6A 2Q4ZA 3I55Z 3CC21 3CCU1 2JMOA 3BG0B 3S14I 2IZ3A 5D1PA 4A3FI 2OOXB 1YITZ 5D1OA 3S15I 5T6BA 3RZOI 3F3PC 1RO4A 1TWFI 3GTQI 4A3EI 2P3YA 4A93I 4A3CI 1Y1WI 1Z03A 3CCM1 3TE5B 1Q812 4RV9A 1RO0A 1K83I 2VPXA 3S1NI 3J7A4 3FKII 3CCVZ 3G71Z 1YJ9Z 1QYPA 4XX2A 1YI21 1VQ91 2HU9A 2V8JA 5FLXf 1TWCI 3CC7Z 4RVFA 1USPB 4E2WA 1NP6A 2OTJZ 1QVFY 1NJI2 2W04A 1Q862 1K8A1 5IP9I 4RS4A 4RVDA 1WZNA 3NDJA 1Q822 2W03A 4A3GI 2Y0SA 2E2JI 2YU9I 1N8R2 2PMZA 4NBBA 3CCRZ 1VLAA 2LFUA 2RHBA 1QVFZ 2V8KA 1YJ91 5FLXb 3GKQA 4HGYA 1VQ5Z 4HH4A 3OW2Y 5C4JI 2RBLA 1SIWA 4E32A 1M902 2K3RA 3CCJ1 4A3MI 2RIQA 1VQK1 2JUBA 3F3FC 2VPZA 1TWGI 1YUKA 5AN9F 2OTJ1 3OW2Z 2AYDA 3G6EZ 3PO3S 1M1K1 2R7ZI 1YJW1 3CCQZ 4A3II 3CCUZ 3VMIA 1KC82 2DE6A 1X3ZA 3NH5A 3D6WA 4HGZA 4DK1A 1YUAA 1YHQ1 2AKLA 3BG1B 4MD7A 3TDHB 3CPWY 1K9M1 2GTHA 3CCMZ 1YJN1 5FLMI 4A3BI 2LIYA 2O4HA 2HF1A 1W2BZ 3HOWI 1WCMI 4E2ZA 1NUIA 1X0TA 1N2FA 1YI2Z 1VQ61 2NAPA 1VQ9Z 1VQM1 3U50C 2VPYA 1TWAI 2QRDB 3RZDI 2EGTA 2M6NA 5T67A 2YADA 5LL6f 4NBEA 1Q811 2WB1A 3QWUA 3HOYI 2QKDA 4DGLA 3CCS1 3GTKI 4E2YA 3JAMf
chains in the Genus database with same CATH topology
4S1TA 3M4OI 1VQL1 1PFTA 2QEX1 3K7AI 3IX0A 4NH1C 3CMA1 5C3EI 3I561 1S721 1ZB9A 1VQ71 1KD12 3S16I 1VQP1 3GTJI 4NBHA 5CM2M 5A2Qf 3EEDA 1LQLA 3CCJZ 2F4MA 4NBCA 1VQKZ 3S2DI 1NJI1 2JA5I 1Q861 4BY7I 4E30A 1X3WA 3I07A 3JAMb 1Q821 1QF8A 1YJWZ 2VUMI 1N8R1 3GTOI 3I4NI 2JR6A 3IF8A 3J80f 3CCL1 4A3LI 2H85A 1L1OC 3FQQA 2NVXI 3FQMA 2VUGA 5A2Qb 3VMHA 1M901 3PO3I 1YHQZ 2DE5A 2KI7B 3HOUI 3CC41 2JS4A 4MD9A 1TFIA 1TWHI 1USPA 1YJNZ 1Q7Y2 2M48A 2QRCB 3GTPI 2NVTI 4X6AI 4Y52I 3CXCY 3G4S1 3J80b 2RPRA 1KC81 2R92I 1JJ2Y 2Q51A 4Y7NI 2GU2A 3HOZI 1VQ6Z 4NBGA 3S1QI 4MXUA 1VQMZ 1WW9A 3CXCZ 1Z01A 1ZH1A 1KRLA 2JA6I 2OOYB 1Z02A 2JNYA 3H0GI 4QTTA 1KQSY 1ML8A 4TNUA 3CCSZ 4QTUA 3LUSA 3NH8A 1P9NA 1VQLZ 3CPWZ 1I50I 2QEXZ 3I4MI 3CMAZ 4MD8A 3H3VJ 3CME1 2V8IA 3I56Z 1S72Z 2P28A 1VQ7Z 3S1MI 2OTLZ 3VTNA 4RVGA 5D1OB 2DE7A 1VQPZ 1YIJ1 3CD61 2JA8I 2OZKA 5T64A 4NBDA 4BXXI 3GTLI 3GCFA 5C44I 3CQZI 4RVHA 1ZB8A 2QA41 3IFUA 4NB8A 4NFRA 1I3QI 3T4NB 3CCE1 3CCLZ 3GTMS 3Q87A 4NBFA 1KD11 4MRIA 1VQO1 1VQ41 4NB9A 3CC4Z 2OTL1 1JWHC 5IP7I 2I3CA 1QVGY 3ESWA 1Y1VS 2R6MA 4DQYB 2PM9A 5IT9f 3P5JB 2NVYI 3HOXI 3G4SZ 2ZAEB 1VQN1 3S1RI 2PK7A 1QVGZ 1RNIA 2R93I 3NFZA 4BBRI 3I551 3EERA 1SFOI 2F4OA 3VMGA 3NDIA 2RT9A 1YIT1 2NVQI 1Q7Y1 4CL1A 5IT9b 3HOVI 5C4XI 2WAQA 3D9XA 2IZ4A 4MH4A 2J6AA 2KPIA 1VQ8Z 4A3DI 2BJOA 2GTIA 1K8A2 3CCV1 4EWCA 3G711 4AYBA 3CMEZ 2K5RA 2E9HA 3GTGI 1YIJZ 3MZLB 3NH4A 3CD6Z 2G2KA 1RO2A 4BBSI 3CC71 2E2HI 1S7MA 1JJ2Z 4MONA 3KIFA 4E2XA 1RLYA 3MONA 2QA4Z 3MZKB 4E31A 2QR1B 3CC2Z 3CCEZ 4BY1I 1M1K2 1VQ81 4NBAA 3J81f 2QLVB 3HKZA 3CCR1 2QREB 1W2BY 1KQSZ 1VQOZ 3S17I 1VQ4Z 2E2II 2VF1A 1VQ51 3VB9A 3PO2I 3S2HI 1R9TI 3GTMI 4NOZA 1WIIA 1K9M2 2B63I 1K731 4A3KI 3KIHA 1RQFA 1VQNZ 2JA7I 3G6E1 3J81b 2O53A 3CCQ1 4A3JI 3M3YI 4E33A 1Y1VI 1K732 1I6HI 1DL6A 2Q4ZA 3I55Z 3CC21 3CCU1 2JMOA 3BG0B 3S14I 2IZ3A 5D1PA 4A3FI 2OOXB 1YITZ 5D1OA 3S15I 5T6BA 3RZOI 3F3PC 1RO4A 1TWFI 3GTQI 4A3EI 2P3YA 4A93I 4A3CI 1Y1WI 1Z03A 3CCM1 3TE5B 1Q812 4RV9A 1RO0A 1K83I 3S1NI 3J7A4 3FKII 3CCVZ 3G71Z 1YJ9Z 1QYPA 4XX2A 1YI21 1VQ91 2HU9A 2V8JA 5FLXf 1TWCI 3CC7Z 4RVFA 1USPB 4E2WA 1NP6A 2OTJZ 1QVFY 1NJI2 2W04A 1Q862 1K8A1 5IP9I 4RS4A 4RVDA 3NDJA 1Q822 2W03A 4A3GI 2Y0SA 2E2JI 2YU9I 1N8R2 2PMZA 4NBBA 3CCRZ 1VLAA 2LFUA 2RHBA 1QVFZ 2V8KA 1YJ91 5FLXb 3GKQA 4HGYA 1VQ5Z 4HH4A 3OW2Y 5C4JI 2RBLA 4E32A 1M902 2K3RA 3CCJ1 4A3MI 2RIQA 1VQK1 2JUBA 3F3FC 1TWGI 1YUKA 5AN9F 2OTJ1 3OW2Z 3G6EZ 3PO3S 1M1K1 2R7ZI 1YJW1 3CCQZ 4A3II 3CCUZ 3VMIA 1KC82 2DE6A 1X3ZA 3NH5A 3D6WA 4HGZA 4DK1A 1YHQ1 1YUAA 2AKLA 3BG1B 4MD7A 3TDHB 3CPWY 1K9M1 2GTHA 3CCMZ 1YJN1 5FLMI 4A3BI 2LIYA 2O4HA 2HF1A 1W2BZ 3HOWI 1WCMI 4E2ZA 1NUIA 1X0TA 1N2FA 1YI2Z 1VQ61 1VQ9Z 1VQM1 3U50C 1TWAI 2QRDB 3RZDI 2EGTA 2M6NA 5T67A 2YADA 5LL6f 4NBEA 1Q811 2WB1A 3QWUA 3HOYI 2QKDA 4DGLA 3CCS1 3GTKI 4E2YA 3JAMf
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CD6 Z;  3I56 Z;  1S72 Z;  1NJI 2;  1VQ7 Z;  1K8A 1;  1Q86 2;  2OTL Z;  3CC7 1;  1VQL 1;  1VQP Z;  2QEX 1;  1JJ2 Z;  1YIJ 1;  3CMA 1;  1Q82 2;  3CD6 1;  3I56 1;  1S72 1;  1N8R 2;  1VQ7 1;  1KD1 2;  2QA4 Z;  3CCR Z;  1VQP 1;  3CC2 Z;  1QVF Z;  3CCE Z;  1YJ9 1;  3CCJ Z;  1VQ5 Z;  1M1K 2;  1VQK Z;  3OW2 Y;  1VQ8 1;  1NJI 1;  1Q86 1;  2QA4 1;  3CCR 1;  1W2B Y;  1KQS Z;  1VQO Z;  3CCE 1;  3CCL Z;  1M90 2;  1VQ4 Z;  1Q82 1;  3CCJ 1;  1VQ5 1;  1YJW Z;  1VQK 1;  1N8R 1;  1KD1 1;  2OTJ 1;  3OW2 Z;  1VQO 1;  3CCL 1;  1VQ4 1;  3G6E Z;  1M1K 1;  1YJW 1;  3CC4 Z;  3CCQ Z;  1K9M 2;  2OTL 1;  3CCU Z;  1K73 1;  1QVG Y;  1KC8 2;  1M90 1;  1VQN Z;  1YHQ Z;  3G6E 1;  3CC4 1;  3CCQ 1;  1K73 2;  3I55 Z;  3CC2 1;  3G4S Z;  3CCU 1;  1YJN Z;  1Q7Y 2;  1VQN 1;  1YHQ 1;  3CPW Y;  1QVG Z;  1K9M 1;  1YIT Z;  3CCM Z;  3CXC Y;  3I55 1;  1YJN 1;  3G4S 1;  1KC8 1;  1JJ2 Y;  1W2B Z;  1VQ6 Z;  1YIT 1;  3CCM 1;  1VQM Z;  1Q7Y 1;  1Q81 2;  3CXC Z;  1YI2 Z;  1VQ6 1;  3CCV Z;  1VQ9 Z;  1VQM 1;  3G71 Z;  1YJ9 Z;  1VQ8 Z;  1KQS Y;  1K8A 2;  1YI2 1;  3CCV 1;  3CCS Z;  1VQ9 1;  3G71 1;  1Q81 1;  3CME Z;  3CC7 Z;  1VQL Z;  3CPW Z;  2QEX Z;  3CCS 1;  2OTJ Z;  1YIJ Z;  3CMA Z;  3CME 1;  1QVF Y; 
#chains in the Genus database with same CATH topology
 4S1T A;  2JIP A;  3M4O I;  1VQL 1;  1PFT A;  2QEX 1;  3K7A I;  3IX0 A;  1Q16 A;  4NH1 C;  3CMA 1;  5C3E I;  3I56 1;  1S72 1;  1ZB9 A;  1VQ7 1;  1KD1 2;  3S16 I;  1VQP 1;  3GTJ I;  4NBH A;  5CM2 M;  5A2Q f;  3EED A;  1LQL A;  3CCJ Z;  2F4M A;  4NBC A;  1VQK Z;  3S2D I;  1NJI 1;  2JA5 I;  1Q86 1;  4BY7 I;  4E30 A;  1X3W A;  3I07 A;  3JAM b;  2LEX A;  1Q82 1;  1QF8 A;  1YJW Z;  2VUM I;  1N8R 1;  3GTO I;  3I4N I;  2JR6 A;  3IF8 A;  3J80 f;  3CCL 1;  4A3L I;  2H85 A;  1L1O C;  3FQQ A;  2NVX I;  3FQM A;  2VUG A;  5A2Q b;  3VMH A;  1M90 1;  3PO3 I;  1YHQ Z;  2DE5 A;  2KI7 B;  3HOU I;  3CC4 1;  2JS4 A;  4MD9 A;  1TFI A;  1TWH I;  1USP A;  1YJN Z;  1Q7Y 2;  2M48 A;  2QRC B;  3GTP I;  2NVT I;  4X6A I;  4Y52 I;  3CXC Y;  3G4S 1;  3J80 b;  2RPR A;  1KC8 1;  2R92 I;  1JJ2 Y;  2Q51 A;  4Y7N I;  2GU2 A;  3HOZ I;  1VQ6 Z;  2V45 A;  4NBG A;  3S1Q I;  4MXU A;  1VQM Z;  1WW9 A;  3CXC Z;  1Z01 A;  1ZH1 A;  1KRL A;  2JA6 I;  2OOY B;  1Z02 A;  2JNY A;  3H0G I;  4QTT A;  1KQS Y;  2JIQ A;  1ML8 A;  4TNU A;  3CCS Z;  4QTU A;  2VPW A;  3LUS A;  3NH8 A;  1P9N A;  1VQL Z;  3CPW Z;  1I50 I;  2QEX Z;  3I4M I;  3CMA Z;  2JIM A;  4MD8 A;  3H3V J;  3CME 1;  2V8I A;  3I56 Z;  1S72 Z;  2P28 A;  1VQ7 Z;  2JIO A;  3S1M I;  2OTL Z;  3VTN A;  4RVG A;  5D1O B;  2DE7 A;  1VQP Z;  1YIJ 1;  3CD6 1;  2JA8 I;  2OZK A;  5T64 A;  4NBD A;  1FDI A;  4BXX I;  3GTL I;  3GCF A;  5C44 I;  3CQZ I;  4RVH A;  1ZB8 A;  2QA4 1;  3IFU A;  4NB8 A;  4NFR A;  1I3Q I;  3T4N B;  3CCE 1;  3CCL Z;  3D2L A;  3GTM S;  3Q87 A;  4NBF A;  1Y8C A;  1KD1 1;  4MRI A;  1VQO 1;  1VQ4 1;  4NB9 A;  3CC4 Z;  2OTL 1;  1JWH C;  5IP7 I;  2I3C A;  1QVG Y;  1FDO A;  3ESW A;  1Y1V S;  2R6M A;  4DQY B;  2PM9 A;  1QXF A;  5IT9 f;  3P5J B;  2NVY I;  3HOX I;  3G4S Z;  2ZAE B;  1VQN 1;  3S1R I;  2PK7 A;  1QVG Z;  1RNI A;  2R93 I;  3NFZ A;  4BBR I;  3I55 1;  3EER A;  1SFO I;  2F4O A;  2E7Z A;  3VMG A;  3NDI A;  3IR7 A;  2RT9 A;  1YIT 1;  2NVQ I;  1Q7Y 1;  4CL1 A;  5IT9 b;  3HOV I;  1AA6 A;  5C4X I;  2WAQ A;  3D9X A;  2IZ4 A;  4MH4 A;  2J6A A;  2KPI A;  1VQ8 Z;  4A3D I;  2BJO A;  2GTI A;  1K8A 2;  3CCV 1;  4EWC A;  3G71 1;  4AYB A;  3CME Z;  2K5R A;  2E9H A;  3GTG I;  1YIJ Z;  3MZL B;  3NH4 A;  3CD6 Z;  2G2K A;  1RO2 A;  4BBS I;  3CC7 1;  2E2H I;  1S7M A;  1JJ2 Z;  4MON A;  3KIF A;  4E2X A;  1RLY A;  3MON A;  2QA4 Z;  3MZK B;  4E31 A;  2QR1 B;  3CC2 Z;  3CCE Z;  4BY1 I;  1M1K 2;  1VQ8 1;  4NBA A;  3J81 f;  2QLV B;  3HKZ A;  3CCR 1;  2QRE B;  1W2B Y;  1KQS Z;  1VQO Z;  3S17 I;  1VQ4 Z;  2IV2 X;  1WJ2 A;  2E2I I;  2VF1 A;  1VQ5 1;  2V3V A;  3VB9 A;  3PO2 I;  3S2H I;  1R9T I;  3GTM I;  4NOZ A;  1WII A;  1K9M 2;  2B63 I;  1K73 1;  4A3K I;  3KIH A;  1RQF A;  1VQN Z;  2JA7 I;  3G6E 1;  2JIR A;  3J81 b;  2O53 A;  3CCQ 1;  4A3J I;  3M3Y I;  4E33 A;  1Y1V I;  1K73 2;  1I6H I;  1DL6 A;  2Q4Z A;  3I55 Z;  3CC2 1;  3CCU 1;  2JMO A;  3BG0 B;  3S14 I;  2IZ3 A;  5D1P A;  4A3F I;  2OOX B;  1YIT Z;  5D1O A;  3S15 I;  5T6B A;  3RZO I;  3F3P C;  1RO4 A;  1TWF I;  3GTQ I;  4A3E I;  2P3Y A;  4A93 I;  4A3C I;  1Y1W I;  1Z03 A;  3CCM 1;  3TE5 B;  1Q81 2;  4RV9 A;  1RO0 A;  1K83 I;  2VPX A;  3S1N I;  3J7A 4;  3FKI I;  3CCV Z;  3G71 Z;  1YJ9 Z;  1QYP A;  4XX2 A;  1YI2 1;  1VQ9 1;  2HU9 A;  2V8J A;  5FLX f;  1TWC I;  3CC7 Z;  4RVF A;  1USP B;  4E2W A;  1NP6 A;  2OTJ Z;  1QVF Y;  1NJI 2;  2W04 A;  1Q86 2;  1K8A 1;  5IP9 I;  4RS4 A;  4RVD A;  1WZN A;  3NDJ A;  1Q82 2;  2W03 A;  4A3G I;  2Y0S A;  2E2J I;  2YU9 I;  1N8R 2;  2PMZ A;  4NBB A;  3CCR Z;  1VLA A;  2LFU A;  2RHB A;  1QVF Z;  2V8K A;  1YJ9 1;  5FLX b;  3GKQ A;  4HGY A;  1VQ5 Z;  4HH4 A;  3OW2 Y;  5C4J I;  2RBL A;  1SIW A;  4E32 A;  1M90 2;  2K3R A;  3CCJ 1;  4A3M I;  2RIQ A;  1VQK 1;  2JUB A;  3F3F C;  2VPZ A;  1TWG I;  1YUK A;  5AN9 F;  2OTJ 1;  3OW2 Z;  2AYD A;  3G6E Z;  3PO3 S;  1M1K 1;  2R7Z I;  1YJW 1;  3CCQ Z;  4A3I I;  3CCU Z;  3VMI A;  1KC8 2;  2DE6 A;  1X3Z A;  3NH5 A;  3D6W A;  4HGZ A;  4DK1 A;  1YUA A;  1YHQ 1;  2AKL A;  3BG1 B;  4MD7 A;  3TDH B;  3CPW Y;  1K9M 1;  2GTH A;  3CCM Z;  1YJN 1;  5FLM I;  4A3B I;  2LIY A;  2O4H A;  2HF1 A;  1W2B Z;  3HOW I;  1WCM I;  4E2Z A;  1NUI A;  1X0T A;  1N2F A;  1YI2 Z;  1VQ6 1;  2NAP A;  1VQ9 Z;  1VQM 1;  3U50 C;  2VPY A;  1TWA I;  2QRD B;  3RZD I;  2EGT A;  2M6N A;  5T67 A;  2YAD A;  5LL6 f;  4NBE A;  1Q81 1;  2WB1 A;  3QWU A;  3HOY I;  2QKD A;  4DGL A;  3CCS 1;  3GTK I;  4E2Y A;  3JAM f; 
#chains in the Genus database with same CATH homology
 4S1T A;  3M4O I;  1VQL 1;  1PFT A;  2QEX 1;  3K7A I;  3IX0 A;  4NH1 C;  3CMA 1;  5C3E I;  3I56 1;  1S72 1;  1ZB9 A;  1VQ7 1;  1KD1 2;  3S16 I;  1VQP 1;  3GTJ I;  4NBH A;  5CM2 M;  5A2Q f;  3EED A;  1LQL A;  3CCJ Z;  2F4M A;  4NBC A;  1VQK Z;  3S2D I;  1NJI 1;  2JA5 I;  1Q86 1;  4BY7 I;  4E30 A;  1X3W A;  3I07 A;  3JAM b;  1Q82 1;  1QF8 A;  1YJW Z;  2VUM I;  1N8R 1;  3GTO I;  3I4N I;  2JR6 A;  3IF8 A;  3J80 f;  3CCL 1;  4A3L I;  2H85 A;  1L1O C;  3FQQ A;  2NVX I;  3FQM A;  2VUG A;  5A2Q b;  3VMH A;  1M90 1;  3PO3 I;  1YHQ Z;  2DE5 A;  2KI7 B;  3HOU I;  3CC4 1;  2JS4 A;  4MD9 A;  1TFI A;  1TWH I;  1USP A;  1YJN Z;  1Q7Y 2;  2M48 A;  2QRC B;  3GTP I;  2NVT I;  4X6A I;  4Y52 I;  3CXC Y;  3G4S 1;  3J80 b;  2RPR A;  1KC8 1;  2R92 I;  1JJ2 Y;  2Q51 A;  4Y7N I;  2GU2 A;  3HOZ I;  1VQ6 Z;  4NBG A;  3S1Q I;  4MXU A;  1VQM Z;  1WW9 A;  3CXC Z;  1Z01 A;  1ZH1 A;  1KRL A;  2JA6 I;  2OOY B;  1Z02 A;  2JNY A;  3H0G I;  4QTT A;  1KQS Y;  1ML8 A;  4TNU A;  3CCS Z;  4QTU A;  3LUS A;  3NH8 A;  1P9N A;  1VQL Z;  3CPW Z;  1I50 I;  2QEX Z;  3I4M I;  3CMA Z;  4MD8 A;  3H3V J;  3CME 1;  2V8I A;  3I56 Z;  1S72 Z;  2P28 A;  1VQ7 Z;  3S1M I;  2OTL Z;  3VTN A;  4RVG A;  5D1O B;  2DE7 A;  1VQP Z;  1YIJ 1;  3CD6 1;  2JA8 I;  2OZK A;  5T64 A;  4NBD A;  4BXX I;  3GTL I;  3GCF A;  5C44 I;  3CQZ I;  4RVH A;  1ZB8 A;  2QA4 1;  3IFU A;  4NB8 A;  4NFR A;  1I3Q I;  3T4N B;  3CCE 1;  3CCL Z;  3GTM S;  3Q87 A;  4NBF A;  1KD1 1;  4MRI A;  1VQO 1;  1VQ4 1;  4NB9 A;  3CC4 Z;  2OTL 1;  1JWH C;  5IP7 I;  2I3C A;  1QVG Y;  3ESW A;  1Y1V S;  2R6M A;  4DQY B;  2PM9 A;  5IT9 f;  3P5J B;  2NVY I;  3HOX I;  3G4S Z;  2ZAE B;  1VQN 1;  3S1R I;  2PK7 A;  1QVG Z;  1RNI A;  2R93 I;  3NFZ A;  4BBR I;  3I55 1;  3EER A;  1SFO I;  2F4O A;  3VMG A;  3NDI A;  2RT9 A;  1YIT 1;  2NVQ I;  1Q7Y 1;  4CL1 A;  5IT9 b;  3HOV I;  5C4X I;  2WAQ A;  3D9X A;  2IZ4 A;  4MH4 A;  2J6A A;  2KPI A;  1VQ8 Z;  4A3D I;  2BJO A;  2GTI A;  1K8A 2;  3CCV 1;  4EWC A;  3G71 1;  4AYB A;  3CME Z;  2K5R A;  2E9H A;  3GTG I;  1YIJ Z;  3MZL B;  3NH4 A;  3CD6 Z;  2G2K A;  1RO2 A;  4BBS I;  3CC7 1;  2E2H I;  1S7M A;  1JJ2 Z;  4MON A;  3KIF A;  4E2X A;  1RLY A;  3MON A;  2QA4 Z;  3MZK B;  4E31 A;  2QR1 B;  3CC2 Z;  3CCE Z;  4BY1 I;  1M1K 2;  1VQ8 1;  4NBA A;  3J81 f;  2QLV B;  3HKZ A;  3CCR 1;  2QRE B;  1W2B Y;  1KQS Z;  1VQO Z;  3S17 I;  1VQ4 Z;  2E2I I;  2VF1 A;  1VQ5 1;  3VB9 A;  3PO2 I;  3S2H I;  1R9T I;  3GTM I;  4NOZ A;  1WII A;  1K9M 2;  2B63 I;  1K73 1;  4A3K I;  3KIH A;  1RQF A;  1VQN Z;  2JA7 I;  3G6E 1;  3J81 b;  2O53 A;  3CCQ 1;  4A3J I;  3M3Y I;  4E33 A;  1Y1V I;  1K73 2;  1I6H I;  1DL6 A;  2Q4Z A;  3I55 Z;  3CC2 1;  3CCU 1;  2JMO A;  3BG0 B;  3S14 I;  2IZ3 A;  5D1P A;  4A3F I;  2OOX B;  1YIT Z;  5D1O A;  3S15 I;  5T6B A;  3RZO I;  3F3P C;  1RO4 A;  1TWF I;  3GTQ I;  4A3E I;  2P3Y A;  4A93 I;  4A3C I;  1Y1W I;  1Z03 A;  3CCM 1;  3TE5 B;  1Q81 2;  4RV9 A;  1RO0 A;  1K83 I;  3S1N I;  3J7A 4;  3FKI I;  3CCV Z;  3G71 Z;  1YJ9 Z;  1QYP A;  4XX2 A;  1YI2 1;  1VQ9 1;  2HU9 A;  2V8J A;  5FLX f;  1TWC I;  3CC7 Z;  4RVF A;  1USP B;  4E2W A;  1NP6 A;  2OTJ Z;  1QVF Y;  1NJI 2;  2W04 A;  1Q86 2;  1K8A 1;  5IP9 I;  4RS4 A;  4RVD A;  3NDJ A;  1Q82 2;  2W03 A;  4A3G I;  2Y0S A;  2E2J I;  2YU9 I;  1N8R 2;  2PMZ A;  4NBB A;  3CCR Z;  1VLA A;  2LFU A;  2RHB A;  1QVF Z;  2V8K A;  1YJ9 1;  5FLX b;  3GKQ A;  4HGY A;  1VQ5 Z;  4HH4 A;  3OW2 Y;  5C4J I;  2RBL A;  4E32 A;  1M90 2;  2K3R A;  3CCJ 1;  4A3M I;  2RIQ A;  1VQK 1;  2JUB A;  3F3F C;  1TWG I;  1YUK A;  5AN9 F;  2OTJ 1;  3OW2 Z;  3G6E Z;  3PO3 S;  1M1K 1;  2R7Z I;  1YJW 1;  3CCQ Z;  4A3I I;  3CCU Z;  3VMI A;  1KC8 2;  2DE6 A;  1X3Z A;  3NH5 A;  3D6W A;  4HGZ A;  4DK1 A;  1YHQ 1;  1YUA A;  2AKL A;  3BG1 B;  4MD7 A;  3TDH B;  3CPW Y;  1K9M 1;  2GTH A;  3CCM Z;  1YJN 1;  5FLM I;  4A3B I;  2LIY A;  2O4H A;  2HF1 A;  1W2B Z;  3HOW I;  1WCM I;  4E2Z A;  1NUI A;  1X0T A;  1N2F A;  1YI2 Z;  1VQ6 1;  1VQ9 Z;  1VQM 1;  3U50 C;  1TWA I;  2QRD B;  3RZD I;  2EGT A;  2M6N A;  5T67 A;  2YAD A;  5LL6 f;  4NBE A;  1Q81 1;  2WB1 A;  3QWU A;  3HOY I;  2QKD A;  4DGL A;  3CCS 1;  3GTK I;  4E2Y A;  3JAM f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...