3G71Z

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g71Z00
3CMAZ 3CCR1 1VQ7Z 1VQ41 1VQL1 1Q7Y1 2QA4Z 1YJNZ 1VQNZ 2OTJ1 1NJI2 3CCEZ 3CC21 3I56Z 2QEXZ 1S721 1KD11 1K732 3CC4Z 3CCM1 3CD61 3CCQZ 1VQO1 1YIJ1 3G711 3CCJZ 1YJWZ 1QVFY 3G4S1 1YITZ 1YJ91 3CCS1 1YHQZ 1Q861 1Q822 1N8R2 1VQK1 1QVFZ 2OTL1 3CCU1 2OTJZ 3CPWY 3G6EZ 1VQ81 1Q821 1N8R1 1NJI1 3CPWZ 3CMA1 3CCMZ 1W2BY 3CCV1 1YJN1 1M1K2 1K731 1VQM1 3CD6Z 1VQOZ 1YIJZ 3CCE1 1Q812 3I551 3CC7Z 3CCLZ 1W2BZ 2QEX1 3G71Z 1VQ6Z 1M1K1 3CCRZ 1YJ9Z 3CCSZ 1VQ4Z 1VQ51 1VQLZ 1K8A2 1VQKZ 3CCQ1 1VQP1 3CXCY 3CC2Z 1YI21 1QVGY 1K9M2 1VQ91 1S72Z 3CCJ1 1VQ8Z 1Q7Y2 1JJ2Y 3CME1 3CXCZ 1YIT1 1VQ71 1QVGZ 1M902 1YHQ1 2QA41 1VQN1 1K9M1 1JJ2Z 1KD12 3CCVZ 1KC82 1VQMZ 3I561 3OW2Y 1M901 3I55Z 3G6E1 1VQ61 3G4SZ 3OW2Z 3CC41 1Q811 1KC81 1VQ5Z 2OTLZ 3CCUZ 1KQSY 1VQPZ 1YJW1 1Q862 1YI2Z 1K8A1 3CC71 3CCL1 1VQ9Z 1KQSZ 3CMEZ
chains in the Genus database with same CATH superfamily
1VQ7Z 2E2HI 1VQL1 1Q7Y1 2QA4Z 2Y0SA 2OTJ1 3S17I 3VTNA 2DE6A 1QXFA 1KD11 5T6BA 2HU9A 1RO0A 3GTMI 4NBDA 3CD61 3S1MI 3HOXI 1YIJ1 1RO2A 4A3KI 2WAQA 2B63I 3CCJZ 1YITZ 1Y1WI 2P28A 3FKII 2V45A 4NOZA 1Q822 1N8R2 1VQK1 3S1RI 1QVFZ 2OTL1 1DL6A 1ZB8A 3CCU1 2M48A 1Z02A 3HOWI 5CM2M 3M3YI 3CPWZ 2LFUA 2OZKA 1W2BY 2JA6I 1USPA 3I551 1RQFA 2KPIA 1YJ9Z 2W04A 1FDOA 4QTTA 1VQ51 2HF1A 3GKQA 1VQLZ 5FLXf 5AN9F 5IP7I 3CQZI 1YUAA 3FQQA 3CXCY 1ML8A 1QVGY 2KI7B 1K9M2 4E2YA 2QRCB 2I3CA 4E32A 4DK1A 3CME1 1VQ71 3H0GI 1M902 2QA41 2WB1A 1Q16A 3NDIA 3CCVZ 2E2JI 1L1OC 4MONA 3G6E1 3NH8A 2P3YA 3OW2Z 2ZAEB 2O4HA 1KC81 2OTLZ 4NFRA 3TE5B 3IFUA 2VUGA 3CCUZ 3GCFA 4MXUA 4Y7NI 2DE5A 1P9NA 1YI2Z 4MH4A 3CC71 4NBCA 4DQYB 3S14I 5A2Qf 2LIYA 3F3PC 2JA8I 3CC21 2EGTA 1S721 2JA7I 2PMZA 1K732 3CC4Z 2V3VA 4AYBA 1NUIA 2VPYA 2JS4A 2W03A 1YJWZ 3GTQI 4NBHA 1USPB 1QVFY 1YJ91 4MRIA 5C4XI 4RVGA 1X0TA 2YU9I 3JAMb 1I50I 3CPWY 3FQMA 3G6EZ 2AKLA 5A2Qb 3CCMZ 3NH4A 2J6AA 3CCV1 2IZ3A 2GTHA 2PK7A 1K731 1VQOZ 2F4MA 3CC7Z 5D1OB 4RV9A 2OOYB 3D2LA 4QTUA 3TDHB 3J81b 1RO4A 2GTIA 2QKDA 4CL1A 3VMGA 1NP6A 2Q51A 3CCSZ 3F3FC 4XX2A 3GTJI 3CCQ1 4E31A 3CC2Z 2JIRA 1YI21 1S72Z 3IF8A 1S7MA 1VQ8Z 4E30A 1X3WA 5LL6f 1R9TI 2RT9A 4A93I 4A3FI 1Z03A 2RBLA 3GTKI 4NBBA 3PO2I 1TWHI 1WIIA 2JR6A 2V8JA 3OW2Y 1KC82 1TWAI 1ZB9A 2OOXB 3CC41 1FDIA 1TWCI 4NB9A 2K5RA 4BXXI 3ESWA 3RZDI 1RLYA 3LUSA 3RZOI 3Q87A 4HGYA 4DGLA 4A3GI 1YJW1 1Q862 4BY1I 1YUKA 3IR7A 1WW9A 1WCMI 4A3MI 1KQSZ 3HOZI 2G2KA 3EERA 3CCR1 1VQ41 2VF1A 3BG0B 5FLMI 3J80f 3I4MI 1NJI2 1Y8CA 4RS4A 3I56Z 1PFTA 1QYPA 4NBFA 3CCM1 2VPWA 2JNYA 3CCQZ 1VQO1 3S16I 2M6NA 1LQLA 5C4JI 3NFZA 2IZ4A 3CCS1 2YADA 2R93I 1Q861 2F4OA 3NH5A 5FLXb 4RVHA 3NDJA 2JIOA 3BG1B 3VB9A 1VQ81 4NB8A 3H3VJ 4RVFA 3HOUI 1NJI1 3HOYI 4Y52I 1WJ2A 2VPZA 3CMA1 3PO3S 2NVYI 2NAPA 4NBAA 4RVDA 1YJN1 1RNIA 1ZH1A 1AA6A 3CCE1 1SIWA 2QEX1 2JIQA 2R6MA 3G71Z 5C3EI 2VUMI 3VMHA 3CCRZ 1TWGI 2Q4ZA 1M1K1 1VQ4Z 2R92I 3IX0A 4A3LI 5T64A 3S2DI 4HGZA 1I3QI 4MD8A 4A3II 3K7AI 1YHQ1 2E7ZA 1JJ2Z 3D9XA 3I4NI 3GTLI 1VQMZ 3I561 2LEXA 2V8KA 4E2ZA 2VPXA 2JUBA 1KRLA 2V8IA 2H85A 1KQSY 1VQPZ 2JMOA 3CCL1 1VQ9Z 4NH1C 4E2XA 2QRDB 1VQ61 3CMAZ 3GTPI 4MD9A 1WZNA 2E9HA 2GU2A 1QF8A 4NBEA 1N2FA 1YJNZ 1VQNZ 4A3EI 3HOVI 3CCEZ 1K83I 2QEXZ 3VMIA 3MZKB 3PO3I 4E2WA 3M4OI 2NVQI 3P5JB 4BY7I 4TNUA 2JIMA 2NVTI 2BJOA 1Y1VS 4BBRI 4HH4A 3G711 2O53A 3QWUA 3G4S1 4X6AI 3S1NI 5IT9f 1YHQZ 3D6WA 1TFIA 2JA5I 2AYDA 2OTJZ 1Z01A 3KIFA 1Q821 1N8R1 3S15I 2E2II 2PM9A 3GTGI 2QLVB 5C44I 4A3BI 2IV2X 3GTMS 4NBGA 1M1K2 1VQM1 3CD6Z 1YIJZ 5D1OA 2RPRA 1Q812 3CCLZ 1W2BZ 1X3ZA 3HKZA 4MD7A 1VQ6Z 2QREB 3T4NB 1K8A2 2R7ZI 2K3RA 1VQKZ 2DE7A 2NVXI 4A3CI 1VQP1 3JAMf 1VQ91 3CCJ1 3MZLB 1Q7Y2 1JJ2Y 3S1QI 3GTOI 3CXCZ 1YIT1 1QVGZ 4S1TA 3KIHA 5T67A 5IT9b 3J80b 1VQN1 1K9M1 4EWCA 1VLAA 1KD12 3J7A4 4BBSI 5D1PA 3I07A 1M901 4E33A 4A3DI 2QR1B 2RHBA 3I55Z 2RIQA 3G4SZ 3J81f 1SFOI 1TWFI 1Q811 3EEDA 1Y1VI 1VQ5Z 3S2HI 1JWHC 5IP9I 3MONA 1K8A1 4A3JI 2JIPA 1I6HI 3CMEZ 3U50C
chains in the Genus database with same CATH topology
1VQ7Z 2E2HI 1VQL1 1Q7Y1 2QA4Z 2Y0SA 2OTJ1 3S17I 3VTNA 2DE6A 1KD11 5T6BA 2HU9A 1RO0A 3GTMI 4NBDA 3CD61 3S1MI 3HOXI 1YIJ1 1RO2A 4A3KI 2WAQA 2B63I 3CCJZ 1YITZ 1Y1WI 2P28A 3FKII 4NOZA 1Q822 1N8R2 1VQK1 3S1RI 1QVFZ 2OTL1 1DL6A 1ZB8A 3CCU1 2M48A 1Z02A 3HOWI 5CM2M 3M3YI 3CPWZ 2LFUA 2OZKA 1W2BY 2JA6I 1USPA 3I551 1RQFA 2KPIA 1YJ9Z 2W04A 4QTTA 1VQ51 2HF1A 3GKQA 1VQLZ 5FLXf 5AN9F 5IP7I 3CQZI 1YUAA 3FQQA 3CXCY 1ML8A 1QVGY 2KI7B 1K9M2 4E2YA 2QRCB 2I3CA 4E32A 4DK1A 3CME1 1VQ71 3H0GI 1M902 2QA41 2WB1A 3NDIA 3CCVZ 2E2JI 1L1OC 4MONA 3G6E1 3NH8A 2P3YA 3OW2Z 2ZAEB 2O4HA 1KC81 2OTLZ 4NFRA 3TE5B 3IFUA 2VUGA 3CCUZ 3GCFA 4MXUA 4Y7NI 2DE5A 1P9NA 1YI2Z 4MH4A 3CC71 4NBCA 4DQYB 3S14I 5A2Qf 2LIYA 3F3PC 2JA8I 3CC21 2EGTA 1S721 2JA7I 2PMZA 1K732 3CC4Z 4AYBA 1NUIA 2JS4A 2W03A 1YJWZ 3GTQI 4NBHA 1USPB 1QVFY 1YJ91 4MRIA 5C4XI 4RVGA 1X0TA 2YU9I 3JAMb 1I50I 3CPWY 3FQMA 3G6EZ 2AKLA 5A2Qb 3CCMZ 3NH4A 2J6AA 3CCV1 2IZ3A 2GTHA 2PK7A 1K731 1VQOZ 2F4MA 3CC7Z 5D1OB 4RV9A 2OOYB 4QTUA 3TDHB 3J81b 1RO4A 2GTIA 2QKDA 4CL1A 3VMGA 1NP6A 2Q51A 3CCSZ 3F3FC 4XX2A 3GTJI 3CCQ1 4E31A 3CC2Z 1YI21 1S72Z 3IF8A 1S7MA 1VQ8Z 4E30A 1X3WA 5LL6f 1R9TI 2RT9A 4A93I 4A3FI 1Z03A 2RBLA 3GTKI 4NBBA 3PO2I 1TWHI 1WIIA 2JR6A 2V8JA 3OW2Y 1KC82 1TWAI 1ZB9A 2OOXB 3CC41 4NB9A 1TWCI 2K5RA 4BXXI 3ESWA 3RZDI 1RLYA 3LUSA 3RZOI 3Q87A 4HGYA 4DGLA 4A3GI 1YJW1 1Q862 4BY1I 1YUKA 1WW9A 1WCMI 4A3MI 1KQSZ 3HOZI 2G2KA 3EERA 3CCR1 1VQ41 2VF1A 3BG0B 5FLMI 3J80f 3I4MI 1NJI2 4RS4A 3I56Z 1PFTA 1QYPA 4NBFA 3CCM1 2JNYA 3CCQZ 1VQO1 3S16I 2M6NA 1LQLA 5C4JI 3NFZA 2IZ4A 3CCS1 2YADA 2R93I 1Q861 2F4OA 3NH5A 5FLXb 4RVHA 3NDJA 3BG1B 3VB9A 1VQ81 4NB8A 3H3VJ 4RVFA 3HOUI 1NJI1 3HOYI 4Y52I 3CMA1 3PO3S 2NVYI 4NBAA 4RVDA 1YJN1 1RNIA 1ZH1A 3CCE1 2QEX1 2R6MA 3G71Z 5C3EI 2VUMI 1TWGI 3CCRZ 2Q4ZA 3VMHA 1M1K1 1VQ4Z 2R92I 3IX0A 4A3LI 5T64A 3S2DI 4HGZA 1I3QI 4MD8A 4A3II 3K7AI 1YHQ1 1JJ2Z 3D9XA 3I4NI 3GTLI 1VQMZ 3I561 2V8KA 4E2ZA 2JUBA 1KRLA 2V8IA 2H85A 1KQSY 1VQPZ 2JMOA 3CCL1 1VQ9Z 4NH1C 4E2XA 2QRDB 1VQ61 3CMAZ 3GTPI 4MD9A 2E9HA 2GU2A 1QF8A 4NBEA 1N2FA 1YJNZ 1VQNZ 4A3EI 3HOVI 3CCEZ 1K83I 2QEXZ 3VMIA 3MZKB 3PO3I 4E2WA 3M4OI 2NVQI 3P5JB 4BY7I 4TNUA 2NVTI 2BJOA 1Y1VS 4BBRI 4HH4A 3G711 2O53A 3QWUA 3G4S1 4X6AI 3S1NI 5IT9f 1YHQZ 3D6WA 1TFIA 2JA5I 2OTJZ 1Z01A 3KIFA 1Q821 1N8R1 3S15I 2E2II 2PM9A 3GTGI 2QLVB 5C44I 4A3BI 3GTMS 4NBGA 1M1K2 1VQM1 3CD6Z 1YIJZ 5D1OA 2RPRA 1Q812 3CCLZ 1W2BZ 1X3ZA 3HKZA 4MD7A 1VQ6Z 2QREB 3T4NB 1K8A2 2R7ZI 2K3RA 1VQKZ 2DE7A 2NVXI 4A3CI 1VQP1 3JAMf 1VQ91 3CCJ1 3MZLB 1Q7Y2 1JJ2Y 3S1QI 3GTOI 3CXCZ 1YIT1 1QVGZ 4S1TA 3KIHA 5T67A 5IT9b 3J80b 1VQN1 1K9M1 4EWCA 1VLAA 1KD12 3J7A4 4BBSI 5D1PA 3I07A 1M901 4E33A 4A3DI 2QR1B 2RHBA 3I55Z 2RIQA 3G4SZ 3J81f 1SFOI 1TWFI 1Q811 3EEDA 1Y1VI 1VQ5Z 3S2HI 1JWHC 5IP9I 3MONA 1K8A1 4A3JI 1I6HI 3CMEZ 3U50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA Z;  3CCR 1;  1VQ7 Z;  1VQ4 1;  1VQL 1;  1Q7Y 1;  2QA4 Z;  1YJN Z;  1VQN Z;  2OTJ 1;  1NJI 2;  3CCE Z;  3CC2 1;  3I56 Z;  2QEX Z;  1S72 1;  1KD1 1;  1K73 2;  3CC4 Z;  3CCM 1;  3CD6 1;  3CCQ Z;  1VQO 1;  1YIJ 1;  3G71 1;  3CCJ Z;  1YJW Z;  1QVF Y;  3G4S 1;  1YIT Z;  1YJ9 1;  3CCS 1;  1YHQ Z;  1Q86 1;  1Q82 2;  1N8R 2;  1VQK 1;  1QVF Z;  2OTL 1;  3CCU 1;  2OTJ Z;  3CPW Y;  3G6E Z;  1VQ8 1;  1Q82 1;  1N8R 1;  1NJI 1;  3CPW Z;  3CMA 1;  3CCM Z;  1W2B Y;  3CCV 1;  1YJN 1;  1M1K 2;  1K73 1;  1VQM 1;  3CD6 Z;  1VQO Z;  1YIJ Z;  3CCE 1;  1Q81 2;  3I55 1;  3CC7 Z;  3CCL Z;  1W2B Z;  2QEX 1;  3G71 Z;  1VQ6 Z;  1M1K 1;  3CCR Z;  1YJ9 Z;  3CCS Z;  1VQ4 Z;  1VQ5 1;  1VQL Z;  1K8A 2;  1VQK Z;  3CCQ 1;  1VQP 1;  3CXC Y;  3CC2 Z;  1YI2 1;  1QVG Y;  1K9M 2;  1VQ9 1;  1S72 Z;  3CCJ 1;  1VQ8 Z;  1Q7Y 2;  1JJ2 Y;  3CME 1;  3CXC Z;  1YIT 1;  1VQ7 1;  1QVG Z;  1M90 2;  1YHQ 1;  2QA4 1;  1VQN 1;  1K9M 1;  1JJ2 Z;  1KD1 2;  3CCV Z;  1KC8 2;  1VQM Z;  3I56 1;  3OW2 Y;  1M90 1;  3I55 Z;  3G6E 1;  1VQ6 1;  3G4S Z;  3OW2 Z;  3CC4 1;  1Q81 1;  1KC8 1;  1VQ5 Z;  2OTL Z;  3CCU Z;  1KQS Y;  1VQP Z;  1YJW 1;  1Q86 2;  1YI2 Z;  1K8A 1;  3CC7 1;  3CCL 1;  1VQ9 Z;  1KQS Z;  3CME Z; 
#chains in the Genus database with same CATH topology
 1VQ7 Z;  2E2H I;  1VQL 1;  1Q7Y 1;  2QA4 Z;  2Y0S A;  2OTJ 1;  3S17 I;  3VTN A;  2DE6 A;  1QXF A;  1KD1 1;  5T6B A;  2HU9 A;  1RO0 A;  3GTM I;  4NBD A;  3CD6 1;  3S1M I;  3HOX I;  1YIJ 1;  1RO2 A;  4A3K I;  2WAQ A;  2B63 I;  3CCJ Z;  1YIT Z;  1Y1W I;  2P28 A;  3FKI I;  2V45 A;  4NOZ A;  1Q82 2;  1N8R 2;  1VQK 1;  3S1R I;  1QVF Z;  2OTL 1;  1DL6 A;  1ZB8 A;  3CCU 1;  2M48 A;  1Z02 A;  3HOW I;  5CM2 M;  3M3Y I;  3CPW Z;  2LFU A;  2OZK A;  1W2B Y;  2JA6 I;  1USP A;  3I55 1;  1RQF A;  2KPI A;  1YJ9 Z;  2W04 A;  1FDO A;  4QTT A;  1VQ5 1;  2HF1 A;  3GKQ A;  1VQL Z;  5FLX f;  5AN9 F;  5IP7 I;  3CQZ I;  1YUA A;  3FQQ A;  3CXC Y;  1ML8 A;  1QVG Y;  2KI7 B;  1K9M 2;  4E2Y A;  2QRC B;  2I3C A;  4E32 A;  4DK1 A;  3CME 1;  1VQ7 1;  3H0G I;  1M90 2;  2QA4 1;  2WB1 A;  1Q16 A;  3NDI A;  3CCV Z;  2E2J I;  1L1O C;  4MON A;  3G6E 1;  3NH8 A;  2P3Y A;  3OW2 Z;  2ZAE B;  2O4H A;  1KC8 1;  2OTL Z;  4NFR A;  3TE5 B;  3IFU A;  2VUG A;  3CCU Z;  3GCF A;  4MXU A;  4Y7N I;  2DE5 A;  1P9N A;  1YI2 Z;  4MH4 A;  3CC7 1;  4NBC A;  4DQY B;  3S14 I;  5A2Q f;  2LIY A;  3F3P C;  2JA8 I;  3CC2 1;  2EGT A;  1S72 1;  2JA7 I;  2PMZ A;  1K73 2;  3CC4 Z;  2V3V A;  4AYB A;  1NUI A;  2VPY A;  2JS4 A;  2W03 A;  1YJW Z;  3GTQ I;  4NBH A;  1USP B;  1QVF Y;  1YJ9 1;  4MRI A;  5C4X I;  4RVG A;  1X0T A;  2YU9 I;  3JAM b;  1I50 I;  3CPW Y;  3FQM A;  3G6E Z;  2AKL A;  5A2Q b;  3CCM Z;  3NH4 A;  2J6A A;  3CCV 1;  2IZ3 A;  2GTH A;  2PK7 A;  1K73 1;  1VQO Z;  2F4M A;  3CC7 Z;  5D1O B;  4RV9 A;  2OOY B;  3D2L A;  4QTU A;  3TDH B;  3J81 b;  1RO4 A;  2GTI A;  2QKD A;  4CL1 A;  3VMG A;  1NP6 A;  2Q51 A;  3CCS Z;  3F3F C;  4XX2 A;  3GTJ I;  3CCQ 1;  4E31 A;  3CC2 Z;  2JIR A;  1YI2 1;  1S72 Z;  3IF8 A;  1S7M A;  1VQ8 Z;  4E30 A;  1X3W A;  5LL6 f;  1R9T I;  2RT9 A;  4A93 I;  4A3F I;  1Z03 A;  2RBL A;  3GTK I;  4NBB A;  3PO2 I;  1TWH I;  1WII A;  2JR6 A;  2V8J A;  3OW2 Y;  1KC8 2;  1TWA I;  1ZB9 A;  2OOX B;  3CC4 1;  1FDI A;  1TWC I;  4NB9 A;  2K5R A;  4BXX I;  3ESW A;  3RZD I;  1RLY A;  3LUS A;  3RZO I;  3Q87 A;  4HGY A;  4DGL A;  4A3G I;  1YJW 1;  1Q86 2;  4BY1 I;  1YUK A;  3IR7 A;  1WW9 A;  1WCM I;  4A3M I;  1KQS Z;  3HOZ I;  2G2K A;  3EER A;  3CCR 1;  1VQ4 1;  2VF1 A;  3BG0 B;  5FLM I;  3J80 f;  3I4M I;  1NJI 2;  1Y8C A;  4RS4 A;  3I56 Z;  1PFT A;  1QYP A;  4NBF A;  3CCM 1;  2VPW A;  2JNY A;  3CCQ Z;  1VQO 1;  3S16 I;  2M6N A;  1LQL A;  5C4J I;  3NFZ A;  2IZ4 A;  3CCS 1;  2YAD A;  2R93 I;  1Q86 1;  2F4O A;  3NH5 A;  5FLX b;  4RVH A;  3NDJ A;  2JIO A;  3BG1 B;  3VB9 A;  1VQ8 1;  4NB8 A;  3H3V J;  4RVF A;  3HOU I;  1NJI 1;  3HOY I;  4Y52 I;  1WJ2 A;  2VPZ A;  3CMA 1;  3PO3 S;  2NVY I;  2NAP A;  4NBA A;  4RVD A;  1YJN 1;  1RNI A;  1ZH1 A;  1AA6 A;  3CCE 1;  1SIW A;  2QEX 1;  2JIQ A;  2R6M A;  3G71 Z;  5C3E I;  2VUM I;  3VMH A;  3CCR Z;  1TWG I;  2Q4Z A;  1M1K 1;  1VQ4 Z;  2R92 I;  3IX0 A;  4A3L I;  5T64 A;  3S2D I;  4HGZ A;  1I3Q I;  4MD8 A;  4A3I I;  3K7A I;  1YHQ 1;  2E7Z A;  1JJ2 Z;  3D9X A;  3I4N I;  3GTL I;  1VQM Z;  3I56 1;  2LEX A;  2V8K A;  4E2Z A;  2VPX A;  2JUB A;  1KRL A;  2V8I A;  2H85 A;  1KQS Y;  1VQP Z;  2JMO A;  3CCL 1;  1VQ9 Z;  4NH1 C;  4E2X A;  2QRD B;  1VQ6 1;  3CMA Z;  3GTP I;  4MD9 A;  1WZN A;  2E9H A;  2GU2 A;  1QF8 A;  4NBE A;  1N2F A;  1YJN Z;  1VQN Z;  4A3E I;  3HOV I;  3CCE Z;  1K83 I;  2QEX Z;  3VMI A;  3MZK B;  3PO3 I;  4E2W A;  3M4O I;  2NVQ I;  3P5J B;  4BY7 I;  4TNU A;  2JIM A;  2NVT I;  2BJO A;  1Y1V S;  4BBR I;  4HH4 A;  3G71 1;  2O53 A;  3QWU A;  3G4S 1;  4X6A I;  3S1N I;  5IT9 f;  1YHQ Z;  3D6W A;  1TFI A;  2JA5 I;  2AYD A;  2OTJ Z;  1Z01 A;  3KIF A;  1Q82 1;  1N8R 1;  3S15 I;  2E2I I;  2PM9 A;  3GTG I;  2QLV B;  5C44 I;  4A3B I;  2IV2 X;  3GTM S;  4NBG A;  1M1K 2;  1VQM 1;  3CD6 Z;  1YIJ Z;  5D1O A;  2RPR A;  1Q81 2;  3CCL Z;  1W2B Z;  1X3Z A;  3HKZ A;  4MD7 A;  1VQ6 Z;  2QRE B;  3T4N B;  1K8A 2;  2R7Z I;  2K3R A;  1VQK Z;  2DE7 A;  2NVX I;  4A3C I;  1VQP 1;  3JAM f;  1VQ9 1;  3CCJ 1;  3MZL B;  1Q7Y 2;  1JJ2 Y;  3S1Q I;  3GTO I;  3CXC Z;  1YIT 1;  1QVG Z;  4S1T A;  3KIH A;  5T67 A;  5IT9 b;  3J80 b;  1VQN 1;  1K9M 1;  4EWC A;  1VLA A;  1KD1 2;  3J7A 4;  4BBS I;  5D1P A;  3I07 A;  1M90 1;  4E33 A;  4A3D I;  2QR1 B;  2RHB A;  3I55 Z;  2RIQ A;  3G4S Z;  3J81 f;  1SFO I;  1TWF I;  1Q81 1;  3EED A;  1Y1V I;  1VQ5 Z;  3S2H I;  1JWH C;  5IP9 I;  3MON A;  1K8A 1;  4A3J I;  2JIP A;  1I6H I;  3CME Z;  3U50 C; 
#chains in the Genus database with same CATH homology
 1VQ7 Z;  2E2H I;  1VQL 1;  1Q7Y 1;  2QA4 Z;  2Y0S A;  2OTJ 1;  3S17 I;  3VTN A;  2DE6 A;  1KD1 1;  5T6B A;  2HU9 A;  1RO0 A;  3GTM I;  4NBD A;  3CD6 1;  3S1M I;  3HOX I;  1YIJ 1;  1RO2 A;  4A3K I;  2WAQ A;  2B63 I;  3CCJ Z;  1YIT Z;  1Y1W I;  2P28 A;  3FKI I;  4NOZ A;  1Q82 2;  1N8R 2;  1VQK 1;  3S1R I;  1QVF Z;  2OTL 1;  1DL6 A;  1ZB8 A;  3CCU 1;  2M48 A;  1Z02 A;  3HOW I;  5CM2 M;  3M3Y I;  3CPW Z;  2LFU A;  2OZK A;  1W2B Y;  2JA6 I;  1USP A;  3I55 1;  1RQF A;  2KPI A;  1YJ9 Z;  2W04 A;  4QTT A;  1VQ5 1;  2HF1 A;  3GKQ A;  1VQL Z;  5FLX f;  5AN9 F;  5IP7 I;  3CQZ I;  1YUA A;  3FQQ A;  3CXC Y;  1ML8 A;  1QVG Y;  2KI7 B;  1K9M 2;  4E2Y A;  2QRC B;  2I3C A;  4E32 A;  4DK1 A;  3CME 1;  1VQ7 1;  3H0G I;  1M90 2;  2QA4 1;  2WB1 A;  3NDI A;  3CCV Z;  2E2J I;  1L1O C;  4MON A;  3G6E 1;  3NH8 A;  2P3Y A;  3OW2 Z;  2ZAE B;  2O4H A;  1KC8 1;  2OTL Z;  4NFR A;  3TE5 B;  3IFU A;  2VUG A;  3CCU Z;  3GCF A;  4MXU A;  4Y7N I;  2DE5 A;  1P9N A;  1YI2 Z;  4MH4 A;  3CC7 1;  4NBC A;  4DQY B;  3S14 I;  5A2Q f;  2LIY A;  3F3P C;  2JA8 I;  3CC2 1;  2EGT A;  1S72 1;  2JA7 I;  2PMZ A;  1K73 2;  3CC4 Z;  4AYB A;  1NUI A;  2JS4 A;  2W03 A;  1YJW Z;  3GTQ I;  4NBH A;  1USP B;  1QVF Y;  1YJ9 1;  4MRI A;  5C4X I;  4RVG A;  1X0T A;  2YU9 I;  3JAM b;  1I50 I;  3CPW Y;  3FQM A;  3G6E Z;  2AKL A;  5A2Q b;  3CCM Z;  3NH4 A;  2J6A A;  3CCV 1;  2IZ3 A;  2GTH A;  2PK7 A;  1K73 1;  1VQO Z;  2F4M A;  3CC7 Z;  5D1O B;  4RV9 A;  2OOY B;  4QTU A;  3TDH B;  3J81 b;  1RO4 A;  2GTI A;  2QKD A;  4CL1 A;  3VMG A;  1NP6 A;  2Q51 A;  3CCS Z;  3F3F C;  4XX2 A;  3GTJ I;  3CCQ 1;  4E31 A;  3CC2 Z;  1YI2 1;  1S72 Z;  3IF8 A;  1S7M A;  1VQ8 Z;  4E30 A;  1X3W A;  5LL6 f;  1R9T I;  2RT9 A;  4A93 I;  4A3F I;  1Z03 A;  2RBL A;  3GTK I;  4NBB A;  3PO2 I;  1TWH I;  1WII A;  2JR6 A;  2V8J A;  3OW2 Y;  1KC8 2;  1TWA I;  1ZB9 A;  2OOX B;  3CC4 1;  4NB9 A;  1TWC I;  2K5R A;  4BXX I;  3ESW A;  3RZD I;  1RLY A;  3LUS A;  3RZO I;  3Q87 A;  4HGY A;  4DGL A;  4A3G I;  1YJW 1;  1Q86 2;  4BY1 I;  1YUK A;  1WW9 A;  1WCM I;  4A3M I;  1KQS Z;  3HOZ I;  2G2K A;  3EER A;  3CCR 1;  1VQ4 1;  2VF1 A;  3BG0 B;  5FLM I;  3J80 f;  3I4M I;  1NJI 2;  4RS4 A;  3I56 Z;  1PFT A;  1QYP A;  4NBF A;  3CCM 1;  2JNY A;  3CCQ Z;  1VQO 1;  3S16 I;  2M6N A;  1LQL A;  5C4J I;  3NFZ A;  2IZ4 A;  3CCS 1;  2YAD A;  2R93 I;  1Q86 1;  2F4O A;  3NH5 A;  5FLX b;  4RVH A;  3NDJ A;  3BG1 B;  3VB9 A;  1VQ8 1;  4NB8 A;  3H3V J;  4RVF A;  3HOU I;  1NJI 1;  3HOY I;  4Y52 I;  3CMA 1;  3PO3 S;  2NVY I;  4NBA A;  4RVD A;  1YJN 1;  1RNI A;  1ZH1 A;  3CCE 1;  2QEX 1;  2R6M A;  3G71 Z;  5C3E I;  2VUM I;  1TWG I;  3CCR Z;  2Q4Z A;  3VMH A;  1M1K 1;  1VQ4 Z;  2R92 I;  3IX0 A;  4A3L I;  5T64 A;  3S2D I;  4HGZ A;  1I3Q I;  4MD8 A;  4A3I I;  3K7A I;  1YHQ 1;  1JJ2 Z;  3D9X A;  3I4N I;  3GTL I;  1VQM Z;  3I56 1;  2V8K A;  4E2Z A;  2JUB A;  1KRL A;  2V8I A;  2H85 A;  1KQS Y;  1VQP Z;  2JMO A;  3CCL 1;  1VQ9 Z;  4NH1 C;  4E2X A;  2QRD B;  1VQ6 1;  3CMA Z;  3GTP I;  4MD9 A;  2E9H A;  2GU2 A;  1QF8 A;  4NBE A;  1N2F A;  1YJN Z;  1VQN Z;  4A3E I;  3HOV I;  3CCE Z;  1K83 I;  2QEX Z;  3VMI A;  3MZK B;  3PO3 I;  4E2W A;  3M4O I;  2NVQ I;  3P5J B;  4BY7 I;  4TNU A;  2NVT I;  2BJO A;  1Y1V S;  4BBR I;  4HH4 A;  3G71 1;  2O53 A;  3QWU A;  3G4S 1;  4X6A I;  3S1N I;  5IT9 f;  1YHQ Z;  3D6W A;  1TFI A;  2JA5 I;  2OTJ Z;  1Z01 A;  3KIF A;  1Q82 1;  1N8R 1;  3S15 I;  2E2I I;  2PM9 A;  3GTG I;  2QLV B;  5C44 I;  4A3B I;  3GTM S;  4NBG A;  1M1K 2;  1VQM 1;  3CD6 Z;  1YIJ Z;  5D1O A;  2RPR A;  1Q81 2;  3CCL Z;  1W2B Z;  1X3Z A;  3HKZ A;  4MD7 A;  1VQ6 Z;  2QRE B;  3T4N B;  1K8A 2;  2R7Z I;  2K3R A;  1VQK Z;  2DE7 A;  2NVX I;  4A3C I;  1VQP 1;  3JAM f;  1VQ9 1;  3CCJ 1;  3MZL B;  1Q7Y 2;  1JJ2 Y;  3S1Q I;  3GTO I;  3CXC Z;  1YIT 1;  1QVG Z;  4S1T A;  3KIH A;  5T67 A;  5IT9 b;  3J80 b;  1VQN 1;  1K9M 1;  4EWC A;  1VLA A;  1KD1 2;  3J7A 4;  4BBS I;  5D1P A;  3I07 A;  1M90 1;  4E33 A;  4A3D I;  2QR1 B;  2RHB A;  3I55 Z;  2RIQ A;  3G4S Z;  3J81 f;  1SFO I;  1TWF I;  1Q81 1;  3EED A;  1Y1V I;  1VQ5 Z;  3S2H I;  1JWH C;  5IP9 I;  3MON A;  1K8A 1;  4A3J I;  1I6H I;  3CME Z;  3U50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...