3G71Z

Co-crystal structure of bruceantin bound to the large ribosomal subunit
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
73
structure length
73
Chain Sequence
b'SSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal RNA
molecule tags Ribosome
publication title U2504 determines the species specificity of the A-site cleft antibiotics: the structures of tiamulin, homoharringtonine, and bruceantin bound to the ribosome.
pubmed doi rcsb
total genus 8
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2009-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.30 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3g71Z00
3I55Z 3G6E1 3CCR1 3CC41 1S721 1NJI2 3I561 1K9M2 1KQSY 3CCJ1 1VQLZ 1K8A2 1K731 1YIJZ 3CCQ1 1VQM1 3CCEZ 3CCV1 3OW2Z 1VQ81 3CXCZ 1KD12 1VQP1 1VQN1 3G4S1 1YJN1 1N8R2 2QA41 1YJ9Z 1K8A1 1M902 1VQ5Z 3CPWY 3CCUZ 3CCE1 1K732 3CCS1 1YI21 2QA4Z 1YJW1 1YJNZ 3OW2Y 3CCLZ 1W2BY 1VQL1 1JJ2Z 1NJI1 1VQ6Z 3CCJZ 1M901 1QVGZ 1VQ61 1KC81 1YIJ1 1VQ51 1KD11 2OTLZ 3CCL1 1Q861 2OTL1 3CCVZ 1YI2Z 3CCM1 1Q821 1VQPZ 3CCMZ 3CCU1 1VQMZ 3CCQZ 3CMAZ 1M1K2 1YJWZ 1VQNZ 1W2BZ 1Q7Y1 1VQ8Z 3CC7Z 1Q862 1YJ91 3I551 3CCSZ 3CC4Z 1Q811 2QEX1 3CD6Z 3G6EZ 1VQ9Z 1Q822 1S72Z 3G4SZ 1VQ41 1VQKZ 1VQ4Z 1QVFY 3G71Z 3I56Z 1JJ2Y 3CPWZ 3CME1 3CCRZ 1KQSZ 1QVFZ 1M1K1 1Q7Y2 3CXCY 1VQ71 1YHQ1 3G711 1YHQZ 3CC2Z 2OTJ1 1Q812 3CC21 2OTJZ 3CC71 3CD61 1N8R1 3CMEZ 2QEXZ 1YITZ 1VQOZ 1K9M1 1VQ91 1QVGY 1KC82 1VQO1 1YIT1 1VQK1 1VQ7Z 3CMA1
chains in the Genus database with same CATH superfamily
3M4OI 2DE5A 1S721 3CCJ1 4MXUA 1I3QI 3I07A 2NVQI 4A3FI 1ZH1A 2VPWA 2IV2X 1K731 1TWAI 1FDOA 2BJOA 4RS4A 2OOYB 3CCQ1 3EERA 5D1PA 3NDJA 3CCEZ 3OW2Z 2Q51A 3CXCZ 3G4S1 5LL6f 4DQYB 1SFOI 1QXFA 2RHBA 3CPWY 4QTUA 1K732 1I6HI 3OW2Y 1VQL1 2LFUA 2V8KA 3CQZI 2E7ZA 3J81b 3J7A4 1VQ61 5D1OB 4MONA 5A2Qb 2IZ3A 3BG1B 2LEXA 3CCL1 1L1OC 4E2ZA 5T67A 1VQPZ 1PFTA 4E32A 3KIHA 1Y8CA 2R92I 2P28A 1M1K2 3PO3I 1ML8A 3GTPI 2QREB 4BBRI 1VQ8Z 3HOXI 2JUBA 2W04A 3P5JB 2E9HA 2RIQA 4MH4A 1WZNA 2V8JA 1Q822 3GTGI 2OOXB 3F3PC 2ZAEB 1ZB8A 3VMGA 2H85A 1QVFY 3G71Z 1JJ2Y 3VMHA 2YU9I 1TWCI 2JA6I 2P3YA 1Y1WI 1AA6A 4AYBA 1VQ71 5FLXf 1RQFA 1KRLA 3H0GI 2F4OA 3S16I 3GTKI 4BY7I 2JS4A 3M3YI 4A3GI 4E31A 2YADA 3CC21 2OTJZ 4NBBA 1I50I 2QEXZ 3D6WA 4XX2A 4QTTA 2PM9A 2RPRA 1QVGY 1KC82 3VMIA 4MRIA 3D9XA 3I55Z 3G6E1 1X3WA 3IF8A 2K3RA 3FQMA 4BY1I 3CC41 3HOUI 1NJI2 3I561 2O53A 3NH8A 2Y0SA 1VQLZ 2JIPA 3GTMS 2JIRA 1K8A2 1VLAA 1TWHI 3CCV1 3QWUA 1VQ81 3GTJI 1KD12 2QR1B 4NBFA 3GTQI 3JAMb 1VQ5Z 4HGYA 3CCE1 2JIOA 3IR7A 4NBHA 1YJNZ 2E2II 3CCLZ 1WW9A 3HOVI 3PO2I 4A3CI 3CCJZ 1QVGZ 1YIJ1 1KD11 2OZKA 3NH5A 5IT9b 3HOWI 2GU2A 2OTL1 4S1TA 2GTHA 2E2HI 3S15I 3CCM1 4E33A 2DE6A 5FLXb 3HOZI 3S17I 2AKLA 1YJWZ 4RVFA 1JWHC 4A3EI 4DK1A 2HF1A 4NH1C 1Q862 1WJ2A 1Y1VS 5IT9f 2J6AA 3I551 3CCSZ 3HKZA 3CC4Z 3S1RI 4NB9A 3CD6Z 4RVHA 1TWFI 3G6EZ 1S72Z 3F3FC 3S2HI 2I3CA 3FQQA 4BXXI 1VQ4Z 4Y7NI 3CME1 2JA5I 1X0TA 4A3LI 1Q7Y2 3CXCY 2NVXI 2NAPA 1FDIA 2G2KA 3GCFA 4RVGA 4TNUA 2QRDB 3G711 1YHQZ 1X3ZA 4X6AI 4MD8A 2KPIA 3D2LA 3CC71 3CD61 1YITZ 1K9M1 1P9NA 1LQLA 1YIT1 1VQK1 3CMA1 2F4MA 3I4MI 3CCR1 4HH4A 1K9M2 1USPB 1YUKA 3MZLB 1RO0A 3MZKB 4A3II 2QKDA 4NOZA 3Q87A 1VQP1 2KI7B 2JR6A 1VQN1 1N8R2 2QA41 1RNIA 1YJ9Z 1K8A1 1M902 3CCUZ 3TDHB 5CM2M 3CCS1 1YI21 2QA4Z 3H3VJ 2VPYA 1NP6A 5C4XI 1VQ6Z 2AYDA 2RT9A 1M901 4A3KI 1KC81 1VQ51 4E30A 5AN9F 4EWCA 1Q861 3CCVZ 1TFIA 1K83I 1Q821 3IX0A 3CCMZ 2JMOA 2IZ4A 3TE5B 3CCQZ 3S14I 3CMAZ 4A3JI 2M48A 2VUGA 1W2BZ 1Q7Y1 4NBAA 2JA8I 3CC7Z 3GKQA 5T64A 2PK7A 3HOYI 1Z02A 1YJ91 4NBCA 2WB1A 3VTNA 2K5RA 5C44I 2QEX1 2V45A 4E2WA 3EEDA 2DE7A 2VPXA 2GTIA 1WCMI 3BG0B 3NDIA 1R9TI 1VQ41 2Q4ZA 4A3BI 3FKII 3CPWZ 2VUMI 1QF8A 2JIQA 3PO3S 3CCRZ 1QVFZ 1M1K1 2QLVB 4A3DI 2QRCB 3J80b 3K7AI 3T4NB 3MONA 4MD7A 2O4HA 4NBEA 1Q812 4BBSI 1N8R1 1RO2A 1VQ91 3NH4A 3U50C 1Y1VI 3KIFA 4E2XA 3I4NI 2JNYA 2V8IA 3VB9A 3S2DI 4A93I 3LUSA 1NUIA 4A3MI 1KQSY 3JAMf 2R7ZI 3GTMI 3J80f 1YIJZ 1DL6A 1VQM1 5A2Qf 1RLYA 1YJN1 1YUAA 3RZOI 2M6NA 2VPZA 2WAQA 5T6BA 1YJW1 2JA7I 1W2BY 4E2YA 1JJ2Z 1NJI1 1Z03A 2PMZA 2NVYI 3S1NI 2LIYA 2R6MA 4DGLA 4NB8A 2OTLZ 3ESWA 2VF1A 5C4JI 1YI2Z 3NFZA 3CCU1 1VQMZ 4NBGA 4RV9A 1VQNZ 1WIIA 2HU9A 5FLMI 5IP7I 3J81f 3GTOI 1QYPA 1TWGI 1N2FA 3S1MI 1SIWA 2W03A 4MD9A 2EGTA 1Z01A 1ZB9A 1Q811 2RBLA 5C3EI 5IP9I 1VQ9Z 3G4SZ 1USPA 2JIMA 5D1OA 3RZDI 3S1QI 1Q16A 1VQKZ 3IFUA 2E2JI 3I56Z 1KQSZ 3GTLI 1S7MA 4Y52I 2B63I 1YHQ1 4NBDA 4RVDA 2NVTI 3CC2Z 2R93I 2OTJ1 4HGZA 1RO4A 3CMEZ 4CL1A 1VQOZ 1VQO1 2V3VA 4NFRA 1VQ7Z
chains in the Genus database with same CATH topology
3M4OI 2DE5A 1S721 3CCJ1 4MXUA 1I3QI 3I07A 2NVQI 4A3FI 1ZH1A 1K731 1TWAI 2BJOA 4RS4A 2OOYB 3CCQ1 3EERA 5D1PA 3NDJA 3CCEZ 3OW2Z 2Q51A 3CXCZ 3G4S1 5LL6f 4DQYB 1SFOI 2RHBA 3CPWY 4QTUA 1K732 1I6HI 3OW2Y 1VQL1 2LFUA 2V8KA 3CQZI 3J81b 3J7A4 1VQ61 5D1OB 4MONA 5A2Qb 2IZ3A 3BG1B 3CCL1 1L1OC 4E2ZA 5T67A 1VQPZ 1PFTA 4E32A 3KIHA 2R92I 2P28A 1M1K2 3PO3I 1ML8A 3GTPI 2QREB 4BBRI 1VQ8Z 3HOXI 2JUBA 2W04A 3P5JB 2E9HA 2RIQA 4MH4A 2V8JA 1Q822 3GTGI 2OOXB 3F3PC 2ZAEB 1ZB8A 3VMGA 2H85A 1QVFY 3G71Z 1JJ2Y 3VMHA 2YU9I 1TWCI 2JA6I 2P3YA 1Y1WI 4AYBA 1VQ71 5FLXf 1RQFA 1KRLA 3H0GI 2F4OA 3S16I 3GTKI 4BY7I 2JS4A 3M3YI 4A3GI 4E31A 2YADA 3CC21 2OTJZ 4NBBA 1I50I 2QEXZ 3D6WA 4XX2A 4QTTA 2PM9A 1QVGY 2RPRA 1KC82 3VMIA 4MRIA 3D9XA 3I55Z 3G6E1 1X3WA 3IF8A 2K3RA 3FQMA 4BY1I 3CC41 3HOUI 1NJI2 3I561 2O53A 3NH8A 2Y0SA 1VQLZ 3GTMS 1K8A2 1VLAA 1TWHI 3CCV1 3QWUA 1VQ81 3GTJI 1KD12 2QR1B 4NBFA 3GTQI 3JAMb 1VQ5Z 4HGYA 3CCE1 4NBHA 1YJNZ 2E2II 3CCLZ 1WW9A 3HOVI 3PO2I 4A3CI 3CCJZ 1QVGZ 1YIJ1 1KD11 2OZKA 3NH5A 5IT9b 3HOWI 2GU2A 2OTL1 4S1TA 2GTHA 2E2HI 3S15I 3CCM1 4E33A 2DE6A 5FLXb 3HOZI 3S17I 2AKLA 1YJWZ 4RVFA 1JWHC 4A3EI 4DK1A 2HF1A 4NH1C 1Q862 1Y1VS 5IT9f 2J6AA 3I551 3CCSZ 3HKZA 3CC4Z 3S1RI 4NB9A 3CD6Z 4RVHA 1TWFI 3G6EZ 1S72Z 3F3FC 3S2HI 2I3CA 3FQQA 4BXXI 1VQ4Z 4Y7NI 3CME1 2JA5I 1X0TA 4A3LI 1Q7Y2 3CXCY 2NVXI 2G2KA 4RVGA 3GCFA 4TNUA 2QRDB 3G711 1YHQZ 1X3ZA 4X6AI 4MD8A 2KPIA 3CC71 3CD61 1YITZ 1K9M1 1P9NA 1LQLA 1YIT1 1VQK1 3CMA1 2F4MA 3I4MI 3CCR1 4HH4A 1K9M2 1USPB 1YUKA 3MZLB 1RO0A 3MZKB 4A3II 2QKDA 4NOZA 3Q87A 1VQP1 2KI7B 2JR6A 1VQN1 1N8R2 2QA41 1RNIA 1YJ9Z 1K8A1 1M902 3CCUZ 3TDHB 5CM2M 3CCS1 1YI21 2QA4Z 3H3VJ 1NP6A 5C4XI 1VQ6Z 2RT9A 1M901 4A3KI 1KC81 1VQ51 4E30A 5AN9F 4EWCA 1Q861 3CCVZ 1TFIA 1K83I 1Q821 3IX0A 3CCMZ 2JMOA 2IZ4A 3TE5B 3CCQZ 3S14I 3CMAZ 4A3JI 2M48A 1Q7Y1 2VUGA 1W2BZ 4NBAA 2JA8I 3CC7Z 3GKQA 5T64A 2PK7A 3HOYI 1Z02A 1YJ91 4NBCA 2WB1A 3VTNA 2K5RA 5C44I 2QEX1 4E2WA 3EEDA 2DE7A 2GTIA 1WCMI 3BG0B 3NDIA 1R9TI 1VQ41 2Q4ZA 4A3BI 3FKII 3CPWZ 2VUMI 1QF8A 3PO3S 3CCRZ 1QVFZ 1M1K1 2QLVB 4A3DI 2QRCB 3J80b 3K7AI 3T4NB 3MONA 4MD7A 2O4HA 4NBEA 1Q812 4BBSI 1N8R1 1RO2A 1VQ91 3NH4A 3U50C 1Y1VI 3KIFA 4E2XA 3I4NI 2JNYA 2V8IA 3VB9A 3S2DI 4A93I 3LUSA 1NUIA 4A3MI 1KQSY 3JAMf 2R7ZI 3GTMI 3J80f 1YIJZ 1DL6A 1VQM1 5A2Qf 1RLYA 1YJN1 1YUAA 3RZOI 2M6NA 2WAQA 5T6BA 1YJW1 2JA7I 1W2BY 4E2YA 1JJ2Z 1NJI1 1Z03A 2PMZA 2NVYI 3S1NI 2LIYA 2R6MA 4DGLA 4NB8A 2OTLZ 3ESWA 2VF1A 5C4JI 1YI2Z 3NFZA 3CCU1 1VQMZ 4NBGA 4RV9A 1VQNZ 1WIIA 2HU9A 5FLMI 5IP7I 3J81f 3GTOI 1QYPA 1TWGI 1N2FA 3S1MI 2W03A 4MD9A 2EGTA 1Z01A 1ZB9A 1Q811 2RBLA 5C3EI 5IP9I 1VQ9Z 3G4SZ 1USPA 5D1OA 3RZDI 3S1QI 1VQKZ 3IFUA 2E2JI 3I56Z 1KQSZ 3GTLI 1S7MA 4Y52I 2B63I 1YHQ1 4NBDA 4RVDA 2NVTI 3CC2Z 2R93I 2OTJ1 4HGZA 1RO4A 3CMEZ 4CL1A 1VQOZ 1VQO1 4NFRA 1VQ7Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Z;  3G6E 1;  3CCR 1;  3CC4 1;  1S72 1;  1NJI 2;  3I56 1;  1K9M 2;  1KQS Y;  3CCJ 1;  1VQL Z;  1K8A 2;  1K73 1;  1YIJ Z;  3CCQ 1;  1VQM 1;  3CCE Z;  3CCV 1;  3OW2 Z;  1VQ8 1;  3CXC Z;  1KD1 2;  1VQP 1;  1VQN 1;  3G4S 1;  1YJN 1;  1N8R 2;  2QA4 1;  1YJ9 Z;  1K8A 1;  1M90 2;  1VQ5 Z;  3CPW Y;  3CCU Z;  3CCE 1;  1K73 2;  3CCS 1;  1YI2 1;  2QA4 Z;  1YJW 1;  1YJN Z;  3OW2 Y;  3CCL Z;  1W2B Y;  1VQL 1;  1JJ2 Z;  1NJI 1;  1VQ6 Z;  3CCJ Z;  1M90 1;  1QVG Z;  1VQ6 1;  1KC8 1;  1YIJ 1;  1VQ5 1;  1KD1 1;  2OTL Z;  3CCL 1;  1Q86 1;  2OTL 1;  3CCV Z;  1YI2 Z;  3CCM 1;  1Q82 1;  1VQP Z;  3CCM Z;  3CCU 1;  1VQM Z;  3CCQ Z;  3CMA Z;  1M1K 2;  1YJW Z;  1VQN Z;  1W2B Z;  1Q7Y 1;  1VQ8 Z;  3CC7 Z;  1Q86 2;  1YJ9 1;  3I55 1;  3CCS Z;  3CC4 Z;  1Q81 1;  2QEX 1;  3CD6 Z;  3G6E Z;  1VQ9 Z;  1Q82 2;  1S72 Z;  3G4S Z;  1VQ4 1;  1VQK Z;  1VQ4 Z;  1QVF Y;  3G71 Z;  3I56 Z;  1JJ2 Y;  3CPW Z;  3CME 1;  3CCR Z;  1KQS Z;  1QVF Z;  1M1K 1;  1Q7Y 2;  3CXC Y;  1VQ7 1;  1YHQ 1;  3G71 1;  1YHQ Z;  3CC2 Z;  2OTJ 1;  1Q81 2;  3CC2 1;  2OTJ Z;  3CC7 1;  3CD6 1;  1N8R 1;  3CME Z;  2QEX Z;  1YIT Z;  1VQO Z;  1K9M 1;  1VQ9 1;  1QVG Y;  1KC8 2;  1VQO 1;  1YIT 1;  1VQK 1;  1VQ7 Z;  3CMA 1; 
#chains in the Genus database with same CATH topology
 3M4O I;  2DE5 A;  1S72 1;  3CCJ 1;  4MXU A;  1I3Q I;  3I07 A;  2NVQ I;  4A3F I;  1ZH1 A;  2VPW A;  2IV2 X;  1K73 1;  1TWA I;  1FDO A;  2BJO A;  4RS4 A;  2OOY B;  3CCQ 1;  3EER A;  5D1P A;  3NDJ A;  3CCE Z;  3OW2 Z;  2Q51 A;  3CXC Z;  3G4S 1;  5LL6 f;  4DQY B;  1SFO I;  1QXF A;  2RHB A;  3CPW Y;  4QTU A;  1K73 2;  1I6H I;  3OW2 Y;  1VQL 1;  2LFU A;  2V8K A;  3CQZ I;  2E7Z A;  3J81 b;  3J7A 4;  1VQ6 1;  5D1O B;  4MON A;  5A2Q b;  2IZ3 A;  3BG1 B;  2LEX A;  3CCL 1;  1L1O C;  4E2Z A;  5T67 A;  1VQP Z;  1PFT A;  4E32 A;  3KIH A;  1Y8C A;  2R92 I;  2P28 A;  1M1K 2;  3PO3 I;  1ML8 A;  3GTP I;  2QRE B;  4BBR I;  1VQ8 Z;  3HOX I;  2JUB A;  2W04 A;  3P5J B;  2E9H A;  2RIQ A;  4MH4 A;  1WZN A;  2V8J A;  1Q82 2;  3GTG I;  2OOX B;  3F3P C;  2ZAE B;  1ZB8 A;  3VMG A;  2H85 A;  1QVF Y;  3G71 Z;  1JJ2 Y;  3VMH A;  2YU9 I;  1TWC I;  2JA6 I;  2P3Y A;  1Y1W I;  1AA6 A;  4AYB A;  1VQ7 1;  5FLX f;  1RQF A;  1KRL A;  3H0G I;  2F4O A;  3S16 I;  3GTK I;  4BY7 I;  2JS4 A;  3M3Y I;  4A3G I;  4E31 A;  2YAD A;  3CC2 1;  2OTJ Z;  4NBB A;  1I50 I;  2QEX Z;  3D6W A;  4XX2 A;  4QTT A;  2PM9 A;  2RPR A;  1QVG Y;  1KC8 2;  3VMI A;  4MRI A;  3D9X A;  3I55 Z;  3G6E 1;  1X3W A;  3IF8 A;  2K3R A;  3FQM A;  4BY1 I;  3CC4 1;  3HOU I;  1NJI 2;  3I56 1;  2O53 A;  3NH8 A;  2Y0S A;  1VQL Z;  2JIP A;  3GTM S;  2JIR A;  1K8A 2;  1VLA A;  1TWH I;  3CCV 1;  3QWU A;  1VQ8 1;  3GTJ I;  1KD1 2;  2QR1 B;  4NBF A;  3GTQ I;  3JAM b;  1VQ5 Z;  4HGY A;  3CCE 1;  2JIO A;  3IR7 A;  4NBH A;  1YJN Z;  2E2I I;  3CCL Z;  1WW9 A;  3HOV I;  3PO2 I;  4A3C I;  3CCJ Z;  1QVG Z;  1YIJ 1;  1KD1 1;  2OZK A;  3NH5 A;  5IT9 b;  3HOW I;  2GU2 A;  2OTL 1;  4S1T A;  2GTH A;  2E2H I;  3S15 I;  3CCM 1;  4E33 A;  2DE6 A;  5FLX b;  3HOZ I;  3S17 I;  2AKL A;  1YJW Z;  4RVF A;  1JWH C;  4A3E I;  4DK1 A;  2HF1 A;  4NH1 C;  1Q86 2;  1WJ2 A;  1Y1V S;  5IT9 f;  2J6A A;  3I55 1;  3CCS Z;  3HKZ A;  3CC4 Z;  3S1R I;  4NB9 A;  3CD6 Z;  4RVH A;  1TWF I;  3G6E Z;  1S72 Z;  3F3F C;  3S2H I;  2I3C A;  3FQQ A;  4BXX I;  1VQ4 Z;  4Y7N I;  3CME 1;  2JA5 I;  1X0T A;  4A3L I;  1Q7Y 2;  3CXC Y;  2NVX I;  2NAP A;  1FDI A;  2G2K A;  3GCF A;  4RVG A;  4TNU A;  2QRD B;  3G71 1;  1YHQ Z;  1X3Z A;  4X6A I;  4MD8 A;  2KPI A;  3D2L A;  3CC7 1;  3CD6 1;  1YIT Z;  1K9M 1;  1P9N A;  1LQL A;  1YIT 1;  1VQK 1;  3CMA 1;  2F4M A;  3I4M I;  3CCR 1;  4HH4 A;  1K9M 2;  1USP B;  1YUK A;  3MZL B;  1RO0 A;  3MZK B;  4A3I I;  2QKD A;  4NOZ A;  3Q87 A;  1VQP 1;  2KI7 B;  2JR6 A;  1VQN 1;  1N8R 2;  2QA4 1;  1RNI A;  1YJ9 Z;  1K8A 1;  1M90 2;  3CCU Z;  3TDH B;  5CM2 M;  3CCS 1;  1YI2 1;  2QA4 Z;  3H3V J;  2VPY A;  1NP6 A;  5C4X I;  1VQ6 Z;  2AYD A;  2RT9 A;  1M90 1;  4A3K I;  1KC8 1;  1VQ5 1;  4E30 A;  5AN9 F;  4EWC A;  1Q86 1;  3CCV Z;  1TFI A;  1K83 I;  1Q82 1;  3IX0 A;  3CCM Z;  2JMO A;  2IZ4 A;  3TE5 B;  3CCQ Z;  3S14 I;  3CMA Z;  4A3J I;  2M48 A;  2VUG A;  1W2B Z;  1Q7Y 1;  4NBA A;  2JA8 I;  3CC7 Z;  3GKQ A;  5T64 A;  2PK7 A;  3HOY I;  1Z02 A;  1YJ9 1;  4NBC A;  2WB1 A;  3VTN A;  2K5R A;  5C44 I;  2QEX 1;  2V45 A;  4E2W A;  3EED A;  2DE7 A;  2VPX A;  2GTI A;  1WCM I;  3BG0 B;  3NDI A;  1R9T I;  1VQ4 1;  2Q4Z A;  4A3B I;  3FKI I;  3CPW Z;  2VUM I;  1QF8 A;  2JIQ A;  3PO3 S;  3CCR Z;  1QVF Z;  1M1K 1;  2QLV B;  4A3D I;  2QRC B;  3J80 b;  3K7A I;  3T4N B;  3MON A;  4MD7 A;  2O4H A;  4NBE A;  1Q81 2;  4BBS I;  1N8R 1;  1RO2 A;  1VQ9 1;  3NH4 A;  3U50 C;  1Y1V I;  3KIF A;  4E2X A;  3I4N I;  2JNY A;  2V8I A;  3VB9 A;  3S2D I;  4A93 I;  3LUS A;  1NUI A;  4A3M I;  1KQS Y;  3JAM f;  2R7Z I;  3GTM I;  3J80 f;  1YIJ Z;  1DL6 A;  1VQM 1;  5A2Q f;  1RLY A;  1YJN 1;  1YUA A;  3RZO I;  2M6N A;  2VPZ A;  2WAQ A;  5T6B A;  1YJW 1;  2JA7 I;  1W2B Y;  4E2Y A;  1JJ2 Z;  1NJI 1;  1Z03 A;  2PMZ A;  2NVY I;  3S1N I;  2LIY A;  2R6M A;  4DGL A;  4NB8 A;  2OTL Z;  3ESW A;  2VF1 A;  5C4J I;  1YI2 Z;  3NFZ A;  3CCU 1;  1VQM Z;  4NBG A;  4RV9 A;  1VQN Z;  1WII A;  2HU9 A;  5FLM I;  5IP7 I;  3J81 f;  3GTO I;  1QYP A;  1TWG I;  1N2F A;  3S1M I;  1SIW A;  2W03 A;  4MD9 A;  2EGT A;  1Z01 A;  1ZB9 A;  1Q81 1;  2RBL A;  5C3E I;  5IP9 I;  1VQ9 Z;  3G4S Z;  1USP A;  2JIM A;  5D1O A;  3RZD I;  3S1Q I;  1Q16 A;  1VQK Z;  3IFU A;  2E2J I;  3I56 Z;  1KQS Z;  3GTL I;  1S7M A;  4Y52 I;  2B63 I;  1YHQ 1;  4NBD A;  4RVD A;  2NVT I;  3CC2 Z;  2R93 I;  2OTJ 1;  4HGZ A;  1RO4 A;  3CME Z;  4CL1 A;  1VQO Z;  1VQO 1;  2V3V A;  4NFR A;  1VQ7 Z; 
#chains in the Genus database with same CATH homology
 3M4O I;  2DE5 A;  1S72 1;  3CCJ 1;  4MXU A;  1I3Q I;  3I07 A;  2NVQ I;  4A3F I;  1ZH1 A;  1K73 1;  1TWA I;  2BJO A;  4RS4 A;  2OOY B;  3CCQ 1;  3EER A;  5D1P A;  3NDJ A;  3CCE Z;  3OW2 Z;  2Q51 A;  3CXC Z;  3G4S 1;  5LL6 f;  4DQY B;  1SFO I;  2RHB A;  3CPW Y;  4QTU A;  1K73 2;  1I6H I;  3OW2 Y;  1VQL 1;  2LFU A;  2V8K A;  3CQZ I;  3J81 b;  3J7A 4;  1VQ6 1;  5D1O B;  4MON A;  5A2Q b;  2IZ3 A;  3BG1 B;  3CCL 1;  1L1O C;  4E2Z A;  5T67 A;  1VQP Z;  1PFT A;  4E32 A;  3KIH A;  2R92 I;  2P28 A;  1M1K 2;  3PO3 I;  1ML8 A;  3GTP I;  2QRE B;  4BBR I;  1VQ8 Z;  3HOX I;  2JUB A;  2W04 A;  3P5J B;  2E9H A;  2RIQ A;  4MH4 A;  2V8J A;  1Q82 2;  3GTG I;  2OOX B;  3F3P C;  2ZAE B;  1ZB8 A;  3VMG A;  2H85 A;  1QVF Y;  3G71 Z;  1JJ2 Y;  3VMH A;  2YU9 I;  1TWC I;  2JA6 I;  2P3Y A;  1Y1W I;  4AYB A;  1VQ7 1;  5FLX f;  1RQF A;  1KRL A;  3H0G I;  2F4O A;  3S16 I;  3GTK I;  4BY7 I;  2JS4 A;  3M3Y I;  4A3G I;  4E31 A;  2YAD A;  3CC2 1;  2OTJ Z;  4NBB A;  1I50 I;  2QEX Z;  3D6W A;  4XX2 A;  4QTT A;  2PM9 A;  1QVG Y;  2RPR A;  1KC8 2;  3VMI A;  4MRI A;  3D9X A;  3I55 Z;  3G6E 1;  1X3W A;  3IF8 A;  2K3R A;  3FQM A;  4BY1 I;  3CC4 1;  3HOU I;  1NJI 2;  3I56 1;  2O53 A;  3NH8 A;  2Y0S A;  1VQL Z;  3GTM S;  1K8A 2;  1VLA A;  1TWH I;  3CCV 1;  3QWU A;  1VQ8 1;  3GTJ I;  1KD1 2;  2QR1 B;  4NBF A;  3GTQ I;  3JAM b;  1VQ5 Z;  4HGY A;  3CCE 1;  4NBH A;  1YJN Z;  2E2I I;  3CCL Z;  1WW9 A;  3HOV I;  3PO2 I;  4A3C I;  3CCJ Z;  1QVG Z;  1YIJ 1;  1KD1 1;  2OZK A;  3NH5 A;  5IT9 b;  3HOW I;  2GU2 A;  2OTL 1;  4S1T A;  2GTH A;  2E2H I;  3S15 I;  3CCM 1;  4E33 A;  2DE6 A;  5FLX b;  3HOZ I;  3S17 I;  2AKL A;  1YJW Z;  4RVF A;  1JWH C;  4A3E I;  4DK1 A;  2HF1 A;  4NH1 C;  1Q86 2;  1Y1V S;  5IT9 f;  2J6A A;  3I55 1;  3CCS Z;  3HKZ A;  3CC4 Z;  3S1R I;  4NB9 A;  3CD6 Z;  4RVH A;  1TWF I;  3G6E Z;  1S72 Z;  3F3F C;  3S2H I;  2I3C A;  3FQQ A;  4BXX I;  1VQ4 Z;  4Y7N I;  3CME 1;  2JA5 I;  1X0T A;  4A3L I;  1Q7Y 2;  3CXC Y;  2NVX I;  2G2K A;  4RVG A;  3GCF A;  4TNU A;  2QRD B;  3G71 1;  1YHQ Z;  1X3Z A;  4X6A I;  4MD8 A;  2KPI A;  3CC7 1;  3CD6 1;  1YIT Z;  1K9M 1;  1P9N A;  1LQL A;  1YIT 1;  1VQK 1;  3CMA 1;  2F4M A;  3I4M I;  3CCR 1;  4HH4 A;  1K9M 2;  1USP B;  1YUK A;  3MZL B;  1RO0 A;  3MZK B;  4A3I I;  2QKD A;  4NOZ A;  3Q87 A;  1VQP 1;  2KI7 B;  2JR6 A;  1VQN 1;  1N8R 2;  2QA4 1;  1RNI A;  1YJ9 Z;  1K8A 1;  1M90 2;  3CCU Z;  3TDH B;  5CM2 M;  3CCS 1;  1YI2 1;  2QA4 Z;  3H3V J;  1NP6 A;  5C4X I;  1VQ6 Z;  2RT9 A;  1M90 1;  4A3K I;  1KC8 1;  1VQ5 1;  4E30 A;  5AN9 F;  4EWC A;  1Q86 1;  3CCV Z;  1TFI A;  1K83 I;  1Q82 1;  3IX0 A;  3CCM Z;  2JMO A;  2IZ4 A;  3TE5 B;  3CCQ Z;  3S14 I;  3CMA Z;  4A3J I;  2M48 A;  1Q7Y 1;  2VUG A;  1W2B Z;  4NBA A;  2JA8 I;  3CC7 Z;  3GKQ A;  5T64 A;  2PK7 A;  3HOY I;  1Z02 A;  1YJ9 1;  4NBC A;  2WB1 A;  3VTN A;  2K5R A;  5C44 I;  2QEX 1;  4E2W A;  3EED A;  2DE7 A;  2GTI A;  1WCM I;  3BG0 B;  3NDI A;  1R9T I;  1VQ4 1;  2Q4Z A;  4A3B I;  3FKI I;  3CPW Z;  2VUM I;  1QF8 A;  3PO3 S;  3CCR Z;  1QVF Z;  1M1K 1;  2QLV B;  4A3D I;  2QRC B;  3J80 b;  3K7A I;  3T4N B;  3MON A;  4MD7 A;  2O4H A;  4NBE A;  1Q81 2;  4BBS I;  1N8R 1;  1RO2 A;  1VQ9 1;  3NH4 A;  3U50 C;  1Y1V I;  3KIF A;  4E2X A;  3I4N I;  2JNY A;  2V8I A;  3VB9 A;  3S2D I;  4A93 I;  3LUS A;  1NUI A;  4A3M I;  1KQS Y;  3JAM f;  2R7Z I;  3GTM I;  3J80 f;  1YIJ Z;  1DL6 A;  1VQM 1;  5A2Q f;  1RLY A;  1YJN 1;  1YUA A;  3RZO I;  2M6N A;  2WAQ A;  5T6B A;  1YJW 1;  2JA7 I;  1W2B Y;  4E2Y A;  1JJ2 Z;  1NJI 1;  1Z03 A;  2PMZ A;  2NVY I;  3S1N I;  2LIY A;  2R6M A;  4DGL A;  4NB8 A;  2OTL Z;  3ESW A;  2VF1 A;  5C4J I;  1YI2 Z;  3NFZ A;  3CCU 1;  1VQM Z;  4NBG A;  4RV9 A;  1VQN Z;  1WII A;  2HU9 A;  5FLM I;  5IP7 I;  3J81 f;  3GTO I;  1QYP A;  1TWG I;  1N2F A;  3S1M I;  2W03 A;  4MD9 A;  2EGT A;  1Z01 A;  1ZB9 A;  1Q81 1;  2RBL A;  5C3E I;  5IP9 I;  1VQ9 Z;  3G4S Z;  1USP A;  5D1O A;  3RZD I;  3S1Q I;  1VQK Z;  3IFU A;  2E2J I;  3I56 Z;  1KQS Z;  3GTL I;  1S7M A;  4Y52 I;  2B63 I;  1YHQ 1;  4NBD A;  4RVD A;  2NVT I;  3CC2 Z;  2R93 I;  2OTJ 1;  4HGZ A;  1RO4 A;  3CME Z;  4CL1 A;  1VQO Z;  1VQO 1;  4NFR A;  1VQ7 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...