3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
3FKII 1USPA 2R92I 2HF1A 4NBBA 3S1QI 1I3QI 2P3YA 2F4OA 4BXXI 4NBHA 1RLYA 3U50C 2DE5A 3M4OI 1ML8A 3GTMI 3HOXI 2KPIA 3VMHA 1PFTA 5C4JI 2JS4A 4A3CI 3I4NI 3S1MI 2YU9I 1WCMI 3S15I 4MH4A 4XX2A 3I07A 4NBDA 5C4XI 4NOZA 4NB8A 3S1NI 3GTMS 3RZOI 4A3DI 3GTLI 3GTJI 2PK7A 4A3II 3H0GI 5C3EI 1TWAI 4A3FI 5IP7I 2B63I 4NBCA 2NVTI 2NVXI 4A3KI 4NBGA 1N2FA 4A3EI 3HOZI 1ZB9A 3GKQA 3LUSA 1X3WA 5IP9I 4Y7NI 1L1OC 3EERA 4BBRI 5FLMI 4NBAA 2NVQI 2E2HI 3S14I 4NBFA 1K83I 4QTUA 1QYPA 3CQZI 4A3JI 3S17I 2NVYI 4Y52I 2DE7A 2K5RA 1USPB 1X3ZA 3M3YI 4X6AI 2E2II 1DL6A 1NUIA 1TWCI 1Y1VI 2F4MA 3GTGI 2JNYA 1TWGI 4NB9A 3S2DI 3S1RI 3K7AI 2JR6A 1YUAA 1Y1WI 1WW9A 3VB9A 1Y1VS 5CM2M 3RZDI 2E2JI 1SFOI 4A3LI 1VLAA 3VMIA 2J6AA 3Q87A 2VUMI 4A3MI 1RO4A 4BY7I 3HOVI 4BY1I 4A93I 2JA8I 3H3VJ 3PO3I 4QTTA 1I6HI 3S2HI 4BBSI 4NBEA 1R9TI 3D6WA 1I50I 1ZB8A 5C44I 3PO2I 3HOYI 3I4MI 3S16I 2RBLA 1TWHI 3PO3S 2DE6A 2AKLA 3GTPI 2R7ZI 1TWFI 2BJOA 4A3GI 2JA6I 3ESWA 3GCFA 3GTOI 2R93I 3GTQI 3HOUI 3GTKI 2JA7I 1LQLA 3VMGA 4A3BI 1TFIA 2JA5I 3HOWI
chains in the Genus database with same CATH superfamily
1KQSZ 2HF1A 1KQSY 1ZH1A 1VQMZ 5FLXf 1VQN1 4DK1A 5A2Qf 4E32A 3CCE1 3CCM1 3I551 1RNIA 4NBHA 5T6BA 3NH5A 2GU2A 1YJ9Z 2OOYB 1YJWZ 1K9M2 2JIPA 5IT9f 3CCJZ 5D1OA 1QXFA 3I07A 2JUBA 3CCSZ 3RZOI 2QA41 2PMZA 1N8R1 3H0GI 4RVHA 1Z03A 2NVTI 4DQYB 2W04A 3LUSA 1X3WA 1YJW1 2NAPA 5IP9I 4Y7NI 3EERA 1YHQ1 3EEDA 4NBFA 3CMEZ 4Y52I 2K5RA 3CCVZ 1VQOZ 3OW2Z 4EWCA 1YJN1 3OW2Y 3CXCZ 2V8JA 1S7MA 1RO0A 4E2ZA 3J80f 2R6MA 2IV2X 2KI7B 1TWGI 3CMA1 4DGLA 3CC71 3CCQ1 2LFUA 5AN9F 1WW9A 3RZDI 1Q822 1YUKA 2E2JI 3CCV1 5D1PA 1SFOI 2M48A 2OTJZ 3Q87A 2IZ3A 4BY7I 2JIRA 3CCR1 4NBEA 2WAQA 2K3RA 3I561 2QEXZ 3FQQA 3HOYI 1TWHI 3PO3S 1VQ9Z 2R7ZI 1Q862 1Q811 4E2XA 2V45A 3CD6Z 3CPWZ 1KD12 3GTOI 3GTQI 3IFUA 2IZ4A 4TNUA 4A3BI 1FDOA 1VQL1 2AYDA 2JIOA 2JA5I 2RT9A 3FKII 3CC21 1RQFA 1QVGZ 1VQ61 1K732 1QVGY 2RIQA 3CD61 1VQNZ 3U50C 1M1K2 2DE5A 3CCEZ 3I55Z 2Q4ZA 2QRCB 1PFTA 5C4JI 2OTL1 3KIFA 2YU9I 5FLXb 3S15I 2OOXB 4NOZA 4AYBA 1K9M1 4A3DI 3GTLI 2H85A 4E31A 2PK7A 3VTNA 4A3II 5C3EI 1RO2A 2JMOA 1S72Z 1TWAI 4A3FI 1Q16A 1M902 2QA4Z 2VF1A 1VQ41 2VPXA 2Q51A 2P28A 2NVQI 1L1OC 5IT9b 3S14I 3J81b 1P9NA 4QTUA 1QYPA 1VQ81 2NVYI 1USPB 1X3ZA 1YHQZ 4RV9A 2ZAEB 4RVFA 2V8KA 2QKDA 2W03A 5T67A 1S721 1NUIA 1TWCI 1Y1VI 3T4NB 1YJNZ 3G711 4NB9A 3S2DI 3MONA 3K7AI 2JR6A 1YUAA 1Y1WI 4HH4A 3G4S1 3VB9A 5CM2M 3CMAZ 3CC7Z 3CCQZ 4S1TA 1VQP1 1RO4A 3J80b 3CCL1 4A93I 1Z01A 3H3VJ 1WZNA 4QTTA 2LEXA 1I6HI 3S2HI 2O53A 2VPYA 1I50I 3CXCY 1FDIA 3CCRZ 2RBLA 3I56Z 3NH4A 1TWFI 2BJOA 4A3GI 3FQMA 2YADA 2WB1A 1W2BZ 1VQ71 2JA7I 1NJI1 4MXUA 1N8R2 3VMGA 1TFIA 1QF8A 3HOWI 1YI21 2R92I 2O4HA 3S1QI 1VQLZ 2RPRA 2P3YA 2E9HA 3MZLB 3CC2Z 1VQ6Z 1Y8CA 1K731 1K8A1 4RVGA 3BG0B 3M4OI 1ML8A 1Q7Y2 3GTMI 2KPIA 3F3PC 3CPWY 4A3CI 1WCMI 5C4XI 4NB8A 4E2WA 2OTLZ 1QVFZ 3S1NI 4RVDA 2PM9A 1AA6A 5IP7I 3CC41 3NH8A 4NBCA 2JIQA 4A3KI 4NBGA 2GTHA 1ZB9A 1KRLA 3GKQA 2VPWA 4BBRI 5FLMI 4NBAA 4MRIA 1M901 1VQ4Z 1K83I 3CQZI 4A3JI 3S17I 4X6AI 2E2II 1VQ8Z 1DL6A 5A2Qb 2F4MA 2M6NA 3GTGI 2JNYA 1NP6A 3IX0A 1Q812 4MD9A 3G71Z 1Y1VS 2OZKA 3MZKB 3G6E1 4MD7A 3TE5B 1VQ51 1KC82 1YIJZ 5D1OB 3G4SZ 2VUMI 4BY1I 4BBSI 1R9TI 1VQPZ 2EGTA 3F3FC 3CCLZ 3PO2I 3TDHB 2JIMA 4RS4A 1JWHC 3JAMf 3S16I 4NFRA 3IF8A 3J7A4 3GTPI 1YIJ1 1Z02A 3ESWA 3GCFA 1VQK1 3CCUZ 2R93I 3HOUI 3GTKI 1X0TA 2RHBA 3J81f 3NDIA 1Q821 1VQM1 1SIWA 1VQ7Z 3IR7A 1USPA 4NBBA 5LL6f 2QRDB 1I3QI 2F4OA 2VUGA 1YI2Z 4BXXI 1YJ91 2VPZA 1RLYA 3CCU1 1JJ2Z 3CCJ1 3HOXI 1JJ2Y 3VMHA 1W2BY 3CCS1 2JS4A 1Q861 3I4NI 3S1MI 2QR1B 1Q7Y1 1YITZ 1KD11 4MH4A 4XX2A 4NBDA 3QWUA 3GTMS 3GTJI 1WIIA 2B63I 2HU9A 4HGZA 2NVXI 4A3EI 1N2FA 3HOZI 3NDJA 4E33A 3CC4Z 3CME1 1VQO1 2E2HI 1YIT1 2QLVB 2DE7A 1M1K1 3P5JB 5T64A 3M3YI 4NH1C 2LIYA 1QVFY 2V8IA 3S1RI 3D9XA 1NJI2 2OTJ1 3BG1B 2QREB 4HGYA 4A3LI 1VLAA 3VMIA 2J6AA 4CL1A 2Y0SA 3G6EZ 4A3MI 3HOVI 2V3VA 4E2YA 2JA8I 1VQ5Z 1KC81 3PO3I 2QEX1 4E30A 3D6WA 4MD8A 3D2LA 1ZB8A 2E7ZA 5C44I 1VQ91 1K8A2 3NFZA 3HKZA 3I4MI 3KIHA 2DE6A 1WJ2A 2AKLA 3CCMZ 4MONA 2JA6I 2GTIA 1LQLA 1VQKZ 2G2KA 2I3CA 3JAMb
chains in the Genus database with same CATH topology
1KQSZ 2HF1A 1KQSY 1ZH1A 1VQMZ 5FLXf 1VQN1 4DK1A 5A2Qf 4E32A 3CCE1 3CCM1 3I551 1RNIA 4NBHA 5T6BA 3NH5A 2GU2A 1YJ9Z 2OOYB 1YJWZ 1K9M2 5IT9f 3CCJZ 5D1OA 3I07A 2JUBA 3CCSZ 3RZOI 2QA41 2PMZA 1N8R1 3H0GI 4RVHA 1Z03A 2NVTI 4DQYB 2W04A 3LUSA 1X3WA 1YJW1 5IP9I 4Y7NI 3EERA 1YHQ1 3EEDA 4NBFA 3CMEZ 4Y52I 2K5RA 3CCVZ 1VQOZ 3OW2Z 4EWCA 1YJN1 3OW2Y 3CXCZ 2V8JA 1S7MA 1RO0A 4E2ZA 3J80f 2R6MA 2KI7B 1TWGI 3CMA1 4DGLA 3CC71 3CCQ1 2LFUA 5AN9F 1WW9A 3RZDI 1Q822 1YUKA 2E2JI 3CCV1 5D1PA 1SFOI 2M48A 2OTJZ 3Q87A 2IZ3A 4BY7I 3CCR1 4NBEA 2WAQA 2K3RA 3I561 2QEXZ 3FQQA 3HOYI 1TWHI 3PO3S 1VQ9Z 2R7ZI 1Q862 1Q811 4E2XA 3CD6Z 3CPWZ 1KD12 3GTOI 3GTQI 3IFUA 2IZ4A 4TNUA 4A3BI 1VQL1 2JA5I 2RT9A 3FKII 3CC21 1RQFA 1QVGZ 1VQ61 1K732 1QVGY 2RIQA 3CD61 1VQNZ 3U50C 1M1K2 2DE5A 3CCEZ 3I55Z 2Q4ZA 2QRCB 1PFTA 5C4JI 2OTL1 3KIFA 2YU9I 5FLXb 3S15I 2OOXB 4NOZA 4AYBA 1K9M1 4A3DI 3GTLI 2H85A 4E31A 2PK7A 3VTNA 4A3II 5C3EI 1RO2A 2JMOA 1S72Z 1TWAI 4A3FI 1M902 2QA4Z 2VF1A 1VQ41 2Q51A 2P28A 2NVQI 1L1OC 5IT9b 3S14I 3J81b 1P9NA 4QTUA 1QYPA 1VQ81 2NVYI 1USPB 1X3ZA 1YHQZ 4RV9A 2ZAEB 4RVFA 2V8KA 2QKDA 2W03A 5T67A 1S721 1NUIA 1TWCI 1Y1VI 3T4NB 1YJNZ 3G711 4NB9A 3S2DI 3MONA 3K7AI 2JR6A 1YUAA 1Y1WI 4HH4A 3G4S1 3VB9A 5CM2M 3CMAZ 3CC7Z 3CCQZ 4S1TA 1VQP1 1RO4A 3J80b 3CCL1 4A93I 1Z01A 3H3VJ 4QTTA 1I6HI 3S2HI 2O53A 1I50I 3CXCY 3CCRZ 2RBLA 3I56Z 3NH4A 1TWFI 2BJOA 4A3GI 3FQMA 2YADA 2WB1A 1W2BZ 1VQ71 2JA7I 1NJI1 4MXUA 1N8R2 3VMGA 1TFIA 1QF8A 3HOWI 1YI21 2R92I 2O4HA 3S1QI 1VQLZ 2RPRA 2P3YA 2E9HA 3MZLB 3CC2Z 1VQ6Z 1K731 1K8A1 4RVGA 3BG0B 3M4OI 1ML8A 1Q7Y2 3GTMI 2KPIA 3F3PC 3CPWY 4A3CI 1WCMI 5C4XI 4NB8A 4E2WA 2OTLZ 1QVFZ 3S1NI 4RVDA 2PM9A 5IP7I 3CC41 3NH8A 4NBCA 4A3KI 4NBGA 2GTHA 1ZB9A 1KRLA 3GKQA 4BBRI 5FLMI 4NBAA 4MRIA 1M901 1VQ4Z 1K83I 3CQZI 4A3JI 3S17I 4X6AI 2E2II 1VQ8Z 1DL6A 5A2Qb 2F4MA 2M6NA 3GTGI 2JNYA 1NP6A 3IX0A 1Q812 4MD9A 3G71Z 1Y1VS 2OZKA 3MZKB 3G6E1 4MD7A 3TE5B 1VQ51 1KC82 1YIJZ 5D1OB 3G4SZ 2VUMI 4BY1I 4BBSI 1R9TI 1VQPZ 2EGTA 3F3FC 3CCLZ 3PO2I 3TDHB 4RS4A 1JWHC 3JAMf 3S16I 4NFRA 3IF8A 3J7A4 3GTPI 1YIJ1 1Z02A 3ESWA 3GCFA 1VQK1 3CCUZ 2R93I 3HOUI 3GTKI 1X0TA 2RHBA 3J81f 3NDIA 1Q821 1VQM1 1VQ7Z 1USPA 4NBBA 5LL6f 2QRDB 1I3QI 2F4OA 2VUGA 1YI2Z 4BXXI 1YJ91 1RLYA 3CCU1 1JJ2Z 3CCJ1 3HOXI 1JJ2Y 3VMHA 1W2BY 3CCS1 2JS4A 1Q861 3I4NI 3S1MI 2QR1B 1Q7Y1 1YITZ 1KD11 4MH4A 4XX2A 4NBDA 3QWUA 3GTMS 3GTJI 1WIIA 2B63I 2HU9A 4HGZA 2NVXI 4A3EI 1N2FA 3HOZI 3NDJA 4E33A 3CC4Z 3CME1 1VQO1 2E2HI 1YIT1 2QLVB 2DE7A 1M1K1 3P5JB 5T64A 3M3YI 4NH1C 2LIYA 1QVFY 2V8IA 3S1RI 3D9XA 1NJI2 2OTJ1 3BG1B 2QREB 4HGYA 4A3LI 1VLAA 3VMIA 2J6AA 4CL1A 2Y0SA 3G6EZ 4A3MI 3HOVI 4E2YA 2JA8I 1VQ5Z 1KC81 3PO3I 2QEX1 4E30A 3D6WA 4MD8A 1ZB8A 5C44I 1VQ91 1K8A2 3NFZA 3HKZA 3I4MI 3KIHA 2DE6A 2AKLA 3CCMZ 4MONA 2JA6I 2GTIA 1LQLA 1VQKZ 2G2KA 2I3CA 3JAMb
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI I;  1USP A;  2R92 I;  2HF1 A;  4NBB A;  3S1Q I;  1I3Q I;  2P3Y A;  2F4O A;  4BXX I;  4NBH A;  1RLY A;  3U50 C;  2DE5 A;  3M4O I;  1ML8 A;  3GTM I;  3HOX I;  2KPI A;  3VMH A;  1PFT A;  5C4J I;  2JS4 A;  4A3C I;  3I4N I;  3S1M I;  2YU9 I;  1WCM I;  3S15 I;  4MH4 A;  4XX2 A;  3I07 A;  4NBD A;  5C4X I;  4NOZ A;  4NB8 A;  3S1N I;  3GTM S;  3RZO I;  4A3D I;  3GTL I;  3GTJ I;  2PK7 A;  4A3I I;  3H0G I;  5C3E I;  1TWA I;  4A3F I;  5IP7 I;  2B63 I;  4NBC A;  2NVT I;  2NVX I;  4A3K I;  4NBG A;  1N2F A;  4A3E I;  3HOZ I;  1ZB9 A;  3GKQ A;  3LUS A;  1X3W A;  5IP9 I;  4Y7N I;  1L1O C;  3EER A;  4BBR I;  5FLM I;  4NBA A;  2NVQ I;  2E2H I;  3S14 I;  4NBF A;  1K83 I;  4QTU A;  1QYP A;  3CQZ I;  4A3J I;  3S17 I;  2NVY I;  4Y52 I;  2DE7 A;  2K5R A;  1USP B;  1X3Z A;  3M3Y I;  4X6A I;  2E2I I;  1DL6 A;  1NUI A;  1TWC I;  1Y1V I;  2F4M A;  3GTG I;  2JNY A;  1TWG I;  4NB9 A;  3S2D I;  3S1R I;  3K7A I;  2JR6 A;  1YUA A;  1Y1W I;  1WW9 A;  3VB9 A;  1Y1V S;  5CM2 M;  3RZD I;  2E2J I;  1SFO I;  4A3L I;  1VLA A;  3VMI A;  2J6A A;  3Q87 A;  2VUM I;  4A3M I;  1RO4 A;  4BY7 I;  3HOV I;  4BY1 I;  4A93 I;  2JA8 I;  3H3V J;  3PO3 I;  4QTT A;  1I6H I;  3S2H I;  4BBS I;  4NBE A;  1R9T I;  3D6W A;  1I50 I;  1ZB8 A;  5C44 I;  3PO2 I;  3HOY I;  3I4M I;  3S16 I;  2RBL A;  1TWH I;  3PO3 S;  2DE6 A;  2AKL A;  3GTP I;  2R7Z I;  1TWF I;  2BJO A;  4A3G I;  2JA6 I;  3ESW A;  3GCF A;  3GTO I;  2R93 I;  3GTQ I;  3HOU I;  3GTK I;  2JA7 I;  1LQL A;  3VMG A;  4A3B I;  1TFI A;  2JA5 I;  3HOW I; 
#chains in the Genus database with same CATH topology
 1KQS Z;  2HF1 A;  1KQS Y;  1ZH1 A;  1VQM Z;  5FLX f;  1VQN 1;  4DK1 A;  5A2Q f;  4E32 A;  3CCE 1;  3CCM 1;  3I55 1;  1RNI A;  4NBH A;  5T6B A;  3NH5 A;  2GU2 A;  1YJ9 Z;  2OOY B;  1YJW Z;  1K9M 2;  2JIP A;  5IT9 f;  3CCJ Z;  5D1O A;  1QXF A;  3I07 A;  2JUB A;  3CCS Z;  3RZO I;  2QA4 1;  2PMZ A;  1N8R 1;  3H0G I;  4RVH A;  1Z03 A;  2NVT I;  4DQY B;  2W04 A;  3LUS A;  1X3W A;  1YJW 1;  2NAP A;  5IP9 I;  4Y7N I;  3EER A;  1YHQ 1;  3EED A;  4NBF A;  3CME Z;  4Y52 I;  2K5R A;  3CCV Z;  1VQO Z;  3OW2 Z;  4EWC A;  1YJN 1;  3OW2 Y;  3CXC Z;  2V8J A;  1S7M A;  1RO0 A;  4E2Z A;  3J80 f;  2R6M A;  2IV2 X;  2KI7 B;  1TWG I;  3CMA 1;  4DGL A;  3CC7 1;  3CCQ 1;  2LFU A;  5AN9 F;  1WW9 A;  3RZD I;  1Q82 2;  1YUK A;  2E2J I;  3CCV 1;  5D1P A;  1SFO I;  2M48 A;  2OTJ Z;  3Q87 A;  2IZ3 A;  4BY7 I;  2JIR A;  3CCR 1;  4NBE A;  2WAQ A;  2K3R A;  3I56 1;  2QEX Z;  3FQQ A;  3HOY I;  1TWH I;  3PO3 S;  1VQ9 Z;  2R7Z I;  1Q86 2;  1Q81 1;  4E2X A;  2V45 A;  3CD6 Z;  3CPW Z;  1KD1 2;  3GTO I;  3GTQ I;  3IFU A;  2IZ4 A;  4TNU A;  4A3B I;  1FDO A;  1VQL 1;  2AYD A;  2JIO A;  2JA5 I;  2RT9 A;  3FKI I;  3CC2 1;  1RQF A;  1QVG Z;  1VQ6 1;  1K73 2;  1QVG Y;  2RIQ A;  3CD6 1;  1VQN Z;  3U50 C;  1M1K 2;  2DE5 A;  3CCE Z;  3I55 Z;  2Q4Z A;  2QRC B;  1PFT A;  5C4J I;  2OTL 1;  3KIF A;  2YU9 I;  5FLX b;  3S15 I;  2OOX B;  4NOZ A;  4AYB A;  1K9M 1;  4A3D I;  3GTL I;  2H85 A;  4E31 A;  2PK7 A;  3VTN A;  4A3I I;  5C3E I;  1RO2 A;  2JMO A;  1S72 Z;  1TWA I;  4A3F I;  1Q16 A;  1M90 2;  2QA4 Z;  2VF1 A;  1VQ4 1;  2VPX A;  2Q51 A;  2P28 A;  2NVQ I;  1L1O C;  5IT9 b;  3S14 I;  3J81 b;  1P9N A;  4QTU A;  1QYP A;  1VQ8 1;  2NVY I;  1USP B;  1X3Z A;  1YHQ Z;  4RV9 A;  2ZAE B;  4RVF A;  2V8K A;  2QKD A;  2W03 A;  5T67 A;  1S72 1;  1NUI A;  1TWC I;  1Y1V I;  3T4N B;  1YJN Z;  3G71 1;  4NB9 A;  3S2D I;  3MON A;  3K7A I;  2JR6 A;  1YUA A;  1Y1W I;  4HH4 A;  3G4S 1;  3VB9 A;  5CM2 M;  3CMA Z;  3CC7 Z;  3CCQ Z;  4S1T A;  1VQP 1;  1RO4 A;  3J80 b;  3CCL 1;  4A93 I;  1Z01 A;  3H3V J;  1WZN A;  4QTT A;  2LEX A;  1I6H I;  3S2H I;  2O53 A;  2VPY A;  1I50 I;  3CXC Y;  1FDI A;  3CCR Z;  2RBL A;  3I56 Z;  3NH4 A;  1TWF I;  2BJO A;  4A3G I;  3FQM A;  2YAD A;  2WB1 A;  1W2B Z;  1VQ7 1;  2JA7 I;  1NJI 1;  4MXU A;  1N8R 2;  3VMG A;  1TFI A;  1QF8 A;  3HOW I;  1YI2 1;  2R92 I;  2O4H A;  3S1Q I;  1VQL Z;  2RPR A;  2P3Y A;  2E9H A;  3MZL B;  3CC2 Z;  1VQ6 Z;  1Y8C A;  1K73 1;  1K8A 1;  4RVG A;  3BG0 B;  3M4O I;  1ML8 A;  1Q7Y 2;  3GTM I;  2KPI A;  3F3P C;  3CPW Y;  4A3C I;  1WCM I;  5C4X I;  4NB8 A;  4E2W A;  2OTL Z;  1QVF Z;  3S1N I;  4RVD A;  2PM9 A;  1AA6 A;  5IP7 I;  3CC4 1;  3NH8 A;  4NBC A;  2JIQ A;  4A3K I;  4NBG A;  2GTH A;  1ZB9 A;  1KRL A;  3GKQ A;  2VPW A;  4BBR I;  5FLM I;  4NBA A;  4MRI A;  1M90 1;  1VQ4 Z;  1K83 I;  3CQZ I;  4A3J I;  3S17 I;  4X6A I;  2E2I I;  1VQ8 Z;  1DL6 A;  5A2Q b;  2F4M A;  2M6N A;  3GTG I;  2JNY A;  1NP6 A;  3IX0 A;  1Q81 2;  4MD9 A;  3G71 Z;  1Y1V S;  2OZK A;  3MZK B;  3G6E 1;  4MD7 A;  3TE5 B;  1VQ5 1;  1KC8 2;  1YIJ Z;  5D1O B;  3G4S Z;  2VUM I;  4BY1 I;  4BBS I;  1R9T I;  1VQP Z;  2EGT A;  3F3F C;  3CCL Z;  3PO2 I;  3TDH B;  2JIM A;  4RS4 A;  1JWH C;  3JAM f;  3S16 I;  4NFR A;  3IF8 A;  3J7A 4;  3GTP I;  1YIJ 1;  1Z02 A;  3ESW A;  3GCF A;  1VQK 1;  3CCU Z;  2R93 I;  3HOU I;  3GTK I;  1X0T A;  2RHB A;  3J81 f;  3NDI A;  1Q82 1;  1VQM 1;  1SIW A;  1VQ7 Z;  3IR7 A;  1USP A;  4NBB A;  5LL6 f;  2QRD B;  1I3Q I;  2F4O A;  2VUG A;  1YI2 Z;  4BXX I;  1YJ9 1;  2VPZ A;  1RLY A;  3CCU 1;  1JJ2 Z;  3CCJ 1;  3HOX I;  1JJ2 Y;  3VMH A;  1W2B Y;  3CCS 1;  2JS4 A;  1Q86 1;  3I4N I;  3S1M I;  2QR1 B;  1Q7Y 1;  1YIT Z;  1KD1 1;  4MH4 A;  4XX2 A;  4NBD A;  3QWU A;  3GTM S;  3GTJ I;  1WII A;  2B63 I;  2HU9 A;  4HGZ A;  2NVX I;  4A3E I;  1N2F A;  3HOZ I;  3NDJ A;  4E33 A;  3CC4 Z;  3CME 1;  1VQO 1;  2E2H I;  1YIT 1;  2QLV B;  2DE7 A;  1M1K 1;  3P5J B;  5T64 A;  3M3Y I;  4NH1 C;  2LIY A;  1QVF Y;  2V8I A;  3S1R I;  3D9X A;  1NJI 2;  2OTJ 1;  3BG1 B;  2QRE B;  4HGY A;  4A3L I;  1VLA A;  3VMI A;  2J6A A;  4CL1 A;  2Y0S A;  3G6E Z;  4A3M I;  3HOV I;  2V3V A;  4E2Y A;  2JA8 I;  1VQ5 Z;  1KC8 1;  3PO3 I;  2QEX 1;  4E30 A;  3D6W A;  4MD8 A;  3D2L A;  1ZB8 A;  2E7Z A;  5C44 I;  1VQ9 1;  1K8A 2;  3NFZ A;  3HKZ A;  3I4M I;  3KIH A;  2DE6 A;  1WJ2 A;  2AKL A;  3CCM Z;  4MON A;  2JA6 I;  2GTI A;  1LQL A;  1VQK Z;  2G2K A;  2I3C A;  3JAM b; 
#chains in the Genus database with same CATH homology
 1KQS Z;  2HF1 A;  1KQS Y;  1ZH1 A;  1VQM Z;  5FLX f;  1VQN 1;  4DK1 A;  5A2Q f;  4E32 A;  3CCE 1;  3CCM 1;  3I55 1;  1RNI A;  4NBH A;  5T6B A;  3NH5 A;  2GU2 A;  1YJ9 Z;  2OOY B;  1YJW Z;  1K9M 2;  5IT9 f;  3CCJ Z;  5D1O A;  3I07 A;  2JUB A;  3CCS Z;  3RZO I;  2QA4 1;  2PMZ A;  1N8R 1;  3H0G I;  4RVH A;  1Z03 A;  2NVT I;  4DQY B;  2W04 A;  3LUS A;  1X3W A;  1YJW 1;  5IP9 I;  4Y7N I;  3EER A;  1YHQ 1;  3EED A;  4NBF A;  3CME Z;  4Y52 I;  2K5R A;  3CCV Z;  1VQO Z;  3OW2 Z;  4EWC A;  1YJN 1;  3OW2 Y;  3CXC Z;  2V8J A;  1S7M A;  1RO0 A;  4E2Z A;  3J80 f;  2R6M A;  2KI7 B;  1TWG I;  3CMA 1;  4DGL A;  3CC7 1;  3CCQ 1;  2LFU A;  5AN9 F;  1WW9 A;  3RZD I;  1Q82 2;  1YUK A;  2E2J I;  3CCV 1;  5D1P A;  1SFO I;  2M48 A;  2OTJ Z;  3Q87 A;  2IZ3 A;  4BY7 I;  3CCR 1;  4NBE A;  2WAQ A;  2K3R A;  3I56 1;  2QEX Z;  3FQQ A;  3HOY I;  1TWH I;  3PO3 S;  1VQ9 Z;  2R7Z I;  1Q86 2;  1Q81 1;  4E2X A;  3CD6 Z;  3CPW Z;  1KD1 2;  3GTO I;  3GTQ I;  3IFU A;  2IZ4 A;  4TNU A;  4A3B I;  1VQL 1;  2JA5 I;  2RT9 A;  3FKI I;  3CC2 1;  1RQF A;  1QVG Z;  1VQ6 1;  1K73 2;  1QVG Y;  2RIQ A;  3CD6 1;  1VQN Z;  3U50 C;  1M1K 2;  2DE5 A;  3CCE Z;  3I55 Z;  2Q4Z A;  2QRC B;  1PFT A;  5C4J I;  2OTL 1;  3KIF A;  2YU9 I;  5FLX b;  3S15 I;  2OOX B;  4NOZ A;  4AYB A;  1K9M 1;  4A3D I;  3GTL I;  2H85 A;  4E31 A;  2PK7 A;  3VTN A;  4A3I I;  5C3E I;  1RO2 A;  2JMO A;  1S72 Z;  1TWA I;  4A3F I;  1M90 2;  2QA4 Z;  2VF1 A;  1VQ4 1;  2Q51 A;  2P28 A;  2NVQ I;  1L1O C;  5IT9 b;  3S14 I;  3J81 b;  1P9N A;  4QTU A;  1QYP A;  1VQ8 1;  2NVY I;  1USP B;  1X3Z A;  1YHQ Z;  4RV9 A;  2ZAE B;  4RVF A;  2V8K A;  2QKD A;  2W03 A;  5T67 A;  1S72 1;  1NUI A;  1TWC I;  1Y1V I;  3T4N B;  1YJN Z;  3G71 1;  4NB9 A;  3S2D I;  3MON A;  3K7A I;  2JR6 A;  1YUA A;  1Y1W I;  4HH4 A;  3G4S 1;  3VB9 A;  5CM2 M;  3CMA Z;  3CC7 Z;  3CCQ Z;  4S1T A;  1VQP 1;  1RO4 A;  3J80 b;  3CCL 1;  4A93 I;  1Z01 A;  3H3V J;  4QTT A;  1I6H I;  3S2H I;  2O53 A;  1I50 I;  3CXC Y;  3CCR Z;  2RBL A;  3I56 Z;  3NH4 A;  1TWF I;  2BJO A;  4A3G I;  3FQM A;  2YAD A;  2WB1 A;  1W2B Z;  1VQ7 1;  2JA7 I;  1NJI 1;  4MXU A;  1N8R 2;  3VMG A;  1TFI A;  1QF8 A;  3HOW I;  1YI2 1;  2R92 I;  2O4H A;  3S1Q I;  1VQL Z;  2RPR A;  2P3Y A;  2E9H A;  3MZL B;  3CC2 Z;  1VQ6 Z;  1K73 1;  1K8A 1;  4RVG A;  3BG0 B;  3M4O I;  1ML8 A;  1Q7Y 2;  3GTM I;  2KPI A;  3F3P C;  3CPW Y;  4A3C I;  1WCM I;  5C4X I;  4NB8 A;  4E2W A;  2OTL Z;  1QVF Z;  3S1N I;  4RVD A;  2PM9 A;  5IP7 I;  3CC4 1;  3NH8 A;  4NBC A;  4A3K I;  4NBG A;  2GTH A;  1ZB9 A;  1KRL A;  3GKQ A;  4BBR I;  5FLM I;  4NBA A;  4MRI A;  1M90 1;  1VQ4 Z;  1K83 I;  3CQZ I;  4A3J I;  3S17 I;  4X6A I;  2E2I I;  1VQ8 Z;  1DL6 A;  5A2Q b;  2F4M A;  2M6N A;  3GTG I;  2JNY A;  1NP6 A;  3IX0 A;  1Q81 2;  4MD9 A;  3G71 Z;  1Y1V S;  2OZK A;  3MZK B;  3G6E 1;  4MD7 A;  3TE5 B;  1VQ5 1;  1KC8 2;  1YIJ Z;  5D1O B;  3G4S Z;  2VUM I;  4BY1 I;  4BBS I;  1R9T I;  1VQP Z;  2EGT A;  3F3F C;  3CCL Z;  3PO2 I;  3TDH B;  4RS4 A;  1JWH C;  3JAM f;  3S16 I;  4NFR A;  3IF8 A;  3J7A 4;  3GTP I;  1YIJ 1;  1Z02 A;  3ESW A;  3GCF A;  1VQK 1;  3CCU Z;  2R93 I;  3HOU I;  3GTK I;  1X0T A;  2RHB A;  3J81 f;  3NDI A;  1Q82 1;  1VQM 1;  1VQ7 Z;  1USP A;  4NBB A;  5LL6 f;  2QRD B;  1I3Q I;  2F4O A;  2VUG A;  1YI2 Z;  4BXX I;  1YJ9 1;  1RLY A;  3CCU 1;  1JJ2 Z;  3CCJ 1;  3HOX I;  1JJ2 Y;  3VMH A;  1W2B Y;  3CCS 1;  2JS4 A;  1Q86 1;  3I4N I;  3S1M I;  2QR1 B;  1Q7Y 1;  1YIT Z;  1KD1 1;  4MH4 A;  4XX2 A;  4NBD A;  3QWU A;  3GTM S;  3GTJ I;  1WII A;  2B63 I;  2HU9 A;  4HGZ A;  2NVX I;  4A3E I;  1N2F A;  3HOZ I;  3NDJ A;  4E33 A;  3CC4 Z;  3CME 1;  1VQO 1;  2E2H I;  1YIT 1;  2QLV B;  2DE7 A;  1M1K 1;  3P5J B;  5T64 A;  3M3Y I;  4NH1 C;  2LIY A;  1QVF Y;  2V8I A;  3S1R I;  3D9X A;  1NJI 2;  2OTJ 1;  3BG1 B;  2QRE B;  4HGY A;  4A3L I;  1VLA A;  3VMI A;  2J6A A;  4CL1 A;  2Y0S A;  3G6E Z;  4A3M I;  3HOV I;  4E2Y A;  2JA8 I;  1VQ5 Z;  1KC8 1;  3PO3 I;  2QEX 1;  4E30 A;  3D6W A;  4MD8 A;  1ZB8 A;  5C44 I;  1VQ9 1;  1K8A 2;  3NFZ A;  3HKZ A;  3I4M I;  3KIH A;  2DE6 A;  2AKL A;  3CCM Z;  4MON A;  2JA6 I;  2GTI A;  1LQL A;  1VQK Z;  2G2K A;  2I3C A;  3JAM b; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...