3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
3VB9A 2R7ZI 1TWAI 2DE5A 5FLMI 3CQZI 3GTKI 1TWFI 4A3FI 2K5RA 1WCMI 2B63I 2E2JI 3S14I 4NBFA 1ZB8A 3GKQA 2AKLA 3FKII 4BY7I 4A3DI 3U50C 3HOXI 1I6HI 4NBDA 5C3EI 4A3MI 2NVXI 4NBAA 3K7AI 1R9TI 3M3YI 2NVQI 2P3YA 4NBEA 3GTQI 3HOUI 3Q87A 2DE7A 4NOZA 4A3BI 2JA5I 3PO2I 3LUSA 1X3WA 3S17I 1YUAA 3VMHA 3VMIA 5C44I 2KPIA 1TWHI 1TFIA 4X6AI 4Y52I 1USPA 2BJOA 3GTMS 2R92I 5C4JI 3GTGI 4NBCA 1LQLA 1K83I 4QTTA 2JNYA 3S2DI 1RO4A 4XX2A 3GTMI 1I50I 3RZDI 2E2II 2JA7I 2RBLA 3I07A 4A3JI 3GTPI 1NUIA 2VUMI 3HOYI 2HF1A 4NB9A 2JA6I 4NBBA 3PO3I 4A3GI 1USPB 2NVTI 5IP7I 4Y7NI 4BY1I 4QTUA 4A3EI 3GTOI 3RZOI 3GTLI 3H3VJ 4A3LI 2E2HI 3S1QI 1TWCI 1Y1WI 3I4MI 1DL6A 3GCFA 2J6AA 2JR6A 1Y1VS 3S16I 1ML8A 1X3ZA 4NB8A 2R93I 1WW9A 1I3QI 4BBRI 4BXXI 3HOWI 3D6WA 1VLAA 3GTJI 2PK7A 3S1NI 5C4XI 2NVYI 3H0GI 1PFTA 1QYPA 1ZB9A 3S2HI 3M4OI 2DE6A 2YU9I 3HOVI 3S1RI 4A3CI 3VMGA 4A93I 4A3II 4MH4A 3ESWA 3S1MI 3S15I 3PO3S 2F4MA 2F4OA 2JA8I 1RLYA 4A3KI 1L1OC 1TWGI 4BBSI 3I4NI 3HOZI 4NBGA 3EERA 1Y1VI 4NBHA 1N2FA 2JS4A 1SFOI 5IP9I 5CM2M
chains in the Genus database with same CATH superfamily
2PM9A 4RVGA 3NDIA 1Q862 2P28A 2V3VA 3FQMA 1S721 2E2JI 3S14I 3GKQA 4BY7I 3FKII 1YHQZ 3HOXI 1I6HI 1NP6A 4E31A 1SIWA 3QWUA 3M3YI 3MZKB 2NVQI 2P3YA 2JIQA 3I55Z 2JA5I 3LUSA 1X3WA 5LL6f 4TNUA 3S17I 3CCJ1 1TWHI 1VQPZ 1TFIA 2IZ4A 3GTMS 1QVGY 5IT9f 3CD61 2R92I 2V45A 4NBCA 1K83I 3CCSZ 1VQ8Z 1K8A2 3S2DI 4E30A 2JIOA 1I50I 3RZDI 4AYBA 2RBLA 4A3JI 1WZNA 2VUMI 1RO2A 1Q7Y1 5FLXf 3HKZA 1Q16A 3CCLZ 2YADA 1Z02A 3GTOI 3I4MI 2E7ZA 2JR6A 2OOXB 3CCU1 1K8A1 4EWCA 2VF1A 1YIJ1 3HOWI 2OTL1 1VQM1 2PK7A 2QEX1 5C4XI 2NVYI 2VPWA 3CXCZ 4DGLA 2QRCB 1VQ41 3I551 3VMGA 1RNIA 3ESWA 2ZAEB 5D1OB 3PO3S 5A2Qf 2OOYB 4A3KI 1L1OC 3CC21 1M1K1 1K9M2 4HGYA 4E2ZA 3EERA 1Y1VI 2JS4A 3D9XA 5CM2M 3VB9A 2QA41 1Q7Y2 5FLMI 2Y0SA 3CC41 1VQNZ 1X0TA 1YJ91 1VQKZ 1KD12 2H85A 1TWFI 1NJI2 3G6E1 3OW2Z 2B63I 4NFRA 1Q822 1ZB8A 3NDJA 3KIHA 1M902 3U50C 1N8R1 1VQ7Z 4DK1A 4A3MI 3K7AI 1Z01A 4MD8A 4NBEA 3CCMZ 3CCVZ 1M1K2 4NOZA 3NFZA 2JIPA 4S1TA 1YUAA 3VMHA 3VMIA 1W2BZ 2KPIA 2RIQA 4Y52I 1USPA 2BJOA 4RS4A 1QXFA 3GTGI 3P5JB 2OZKA 2AYDA 1VQ5Z 2HU9A 3NH8A 3G6EZ 5IT9b 1RO4A 2LEXA 2E2II 2JA7I 1WIIA 3CCJZ 2WAQA 3IX0A 2JA6I 4NBBA 1VQ9Z 3CCQZ 4NH1C 2NVTI 5IP7I 1JJ2Y 1FDOA 2JIRA 1DL6A 2V8IA 1Y1VS 1YJ9Z 1VQK1 1ML8A 1X3ZA 3J7A4 1WW9A 3NH5A 4BBRI 3GTJI 3TDHB 3H0GI 2O4HA 4E2WA 1PFTA 1ZB9A 2K3RA 2YU9I 3CCV1 3F3PC 1M901 4A3CI 3F3FC 3IF8A 3VTNA 4A93I 3CME1 4MH4A 1RQFA 2F4MA 1KRLA 3TE5B 1TWGI 1YITZ 3HOZI 1K9M1 3J81f 5A2Qb 1K731 3CCS1 2QEXZ 1VQ81 1N2FA 4DQYB 1SFOI 1JWHC 4HGZA 2R7ZI 2DE5A 3MONA 4MONA 5D1OA 1KQSZ 1YJW1 1Q812 4A3FI 3GTKI 1VQ71 1AA6A 4A3DI 3CCRZ 5AN9F 1VQP1 1ZH1A 2IZ3A 1YI2Z 3CCEZ 3CC4Z 2RT9A 1YHQ1 1QVFZ 1Q821 2QA4Z 3HOUI 1YIT1 3G4SZ 3CCUZ 2DE7A 1Q861 3PO2I 5C44I 2VPXA 3T4NB 4X6AI 3CCL1 1YJN1 1P9NA 3FQQA 4QTTA 2QRDB 4RVHA 4XX2A 3GTMI 1KC81 4MXUA 1VQ61 3NH4A 4RV9A 3GTPI 1W2BY 3PO3I 5T67A 2QR1B 2EGTA 4Y7NI 4A3EI 4A3LI 2E2HI 1TWCI 1Y1WI 4CL1A 2I3CA 2J6AA 3JAMf 3I561 1VQLZ 3G711 3MZLB 3S16I 2RHBA 4E32A 4BXXI 2Q51A 3D6WA 1VLAA 2LIYA 3S1NI 4MD9A 3CC7Z 1VQO1 3S2HI 1RO0A 3EEDA 3JAMb 3M4OI 1S72Z 1S7MA 3G4S1 3HOVI 4E2XA 4A3II 1KC82 3BG1B 3IFUA 3S15I 2JA8I 3BG0B 2G2KA 1VQMZ 2JMOA 3J80b 3CMA1 4BBSI 3KIFA 2W04A 4NBGA 3CPWZ 1N8R2 5D1PA 2V8KA 3I56Z 1VQL1 3J81b 1YJWZ 1NJI1 1TWAI 1WJ2A 3CQZI 1QVGZ 3CMEZ 1Y8CA 2JUBA 3J80f 1YI21 1FDIA 2K5RA 1WCMI 4RVFA 4NBFA 1VQ6Z 2OTJZ 2OTLZ 2AKLA 2VPYA 2W03A 3OW2Y 1VQ91 4NBDA 4RVDA 5C3EI 5T6BA 5T64A 2VUGA 2NVXI 4MD7A 4MRIA 4NBAA 1R9TI 3GTQI 3Q87A 2NAPA 1YJNZ 1KD11 2Q4ZA 4A3BI 2O53A 2QKDA 2GTIA 3G71Z 3CCQ1 2M6NA 1KQSY 2R6MA 1Z03A 5C4JI 1QVFY 1VQOZ 1Q811 1LQLA 2JNYA 3CC71 3CD6Z 3CCE1 2OTJ1 2E9HA 4HH4A 5FLXb 1JJ2Z 3CCM1 3CPWY 1VQN1 2WB1A 3I07A 1NUIA 2RPRA 3HOYI 2HF1A 4NB9A 1VQ4Z 4A3GI 1USPB 4BY1I 4QTUA 3RZOI 3GTLI 3H3VJ 2KI7B 3S1QI 3CXCY 4E2YA 3GCFA 2GU2A 3CC2Z 2PMZA 4NB8A 2R93I 3CCR1 1I3QI 2IV2X 3IR7A 2QREB 2QLVB 4E33A 1QYPA 1QF8A 2LFUA 2DE6A 1YIJZ 3CMAZ 3S1RI 1VQ51 3S1MI 2F4OA 3D2LA 1RLYA 2GTHA 3I4NI 2V8JA 4NBHA 2M48A 5IP9I 1YUKA 2VPZA 1K732 2JIMA
chains in the Genus database with same CATH topology
2PM9A 4RVGA 3NDIA 1Q862 2P28A 3FQMA 1S721 2E2JI 3S14I 3GKQA 4BY7I 3FKII 1YHQZ 3HOXI 1I6HI 1NP6A 4E31A 3QWUA 3M3YI 3MZKB 2NVQI 2P3YA 3I55Z 2JA5I 3LUSA 1X3WA 5LL6f 4TNUA 3S17I 3CCJ1 1TWHI 1VQPZ 1TFIA 2IZ4A 3GTMS 1QVGY 5IT9f 3CD61 2R92I 4NBCA 1K83I 3CCSZ 1VQ8Z 1K8A2 3S2DI 4E30A 1I50I 3RZDI 4AYBA 2RBLA 4A3JI 2VUMI 1RO2A 1Q7Y1 5FLXf 3HKZA 3CCLZ 2YADA 1Z02A 3GTOI 3I4MI 2JR6A 2OOXB 3CCU1 1K8A1 4EWCA 2VF1A 1YIJ1 3HOWI 2OTL1 1VQM1 2PK7A 2QEX1 5C4XI 2NVYI 3CXCZ 4DGLA 2QRCB 1VQ41 3I551 3VMGA 1RNIA 3ESWA 2ZAEB 5D1OB 3PO3S 5A2Qf 2OOYB 4A3KI 1L1OC 3CC21 1M1K1 1K9M2 4HGYA 4E2ZA 3EERA 1Y1VI 2JS4A 3D9XA 5CM2M 3VB9A 2QA41 1Q7Y2 5FLMI 2Y0SA 3CC41 1VQNZ 1X0TA 1YJ91 1VQKZ 1KD12 2H85A 1TWFI 1NJI2 3G6E1 3OW2Z 2B63I 4NFRA 1Q822 1ZB8A 3NDJA 3KIHA 1M902 3U50C 1N8R1 1VQ7Z 4DK1A 4A3MI 3K7AI 1Z01A 4MD8A 4NBEA 3CCMZ 3CCVZ 1M1K2 4NOZA 3NFZA 4S1TA 1YUAA 3VMHA 3VMIA 1W2BZ 2KPIA 2RIQA 4Y52I 1USPA 2BJOA 4RS4A 3GTGI 3P5JB 2OZKA 1VQ5Z 2HU9A 3NH8A 3G6EZ 5IT9b 1RO4A 2E2II 2JA7I 1WIIA 3CCJZ 2WAQA 3IX0A 2JA6I 4NBBA 1VQ9Z 3CCQZ 4NH1C 2NVTI 5IP7I 1JJ2Y 1DL6A 2V8IA 1Y1VS 1YJ9Z 1VQK1 1ML8A 1X3ZA 3J7A4 1WW9A 3NH5A 4BBRI 3GTJI 3TDHB 3H0GI 2O4HA 4E2WA 1PFTA 1ZB9A 2K3RA 2YU9I 3CCV1 3F3PC 1M901 4A3CI 3F3FC 3IF8A 3VTNA 4A93I 3CME1 4MH4A 1RQFA 2F4MA 1KRLA 3TE5B 1TWGI 1YITZ 3HOZI 1K9M1 3J81f 5A2Qb 1K731 3CCS1 2QEXZ 1VQ81 1N2FA 4DQYB 1SFOI 1JWHC 4HGZA 2R7ZI 2DE5A 3MONA 4MONA 5D1OA 1KQSZ 1YJW1 1Q812 4A3FI 3GTKI 1VQ71 4A3DI 3CCRZ 5AN9F 1VQP1 1ZH1A 2IZ3A 1YI2Z 3CCEZ 3CC4Z 2RT9A 1YHQ1 1QVFZ 1Q821 2QA4Z 3HOUI 1YIT1 3G4SZ 3CCUZ 2DE7A 1Q861 3PO2I 5C44I 3T4NB 4X6AI 3CCL1 1YJN1 1P9NA 3FQQA 4QTTA 2QRDB 4RVHA 4XX2A 3GTMI 1KC81 4MXUA 1VQ61 3NH4A 4RV9A 3GTPI 1W2BY 3PO3I 5T67A 2QR1B 2EGTA 4Y7NI 4A3EI 4A3LI 2E2HI 1TWCI 1Y1WI 4CL1A 2I3CA 2J6AA 3JAMf 3I561 1VQLZ 3G711 3MZLB 3S16I 2RHBA 4E32A 4BXXI 2Q51A 3D6WA 1VLAA 2LIYA 3S1NI 4MD9A 3CC7Z 1VQO1 3S2HI 1RO0A 3EEDA 3JAMb 3M4OI 1S72Z 1S7MA 3G4S1 3HOVI 4E2XA 4A3II 1KC82 3BG1B 3IFUA 3S15I 2JA8I 3BG0B 2G2KA 1VQMZ 2JMOA 3J80b 3CMA1 4BBSI 3KIFA 2W04A 4NBGA 3CPWZ 1N8R2 5D1PA 2V8KA 3I56Z 1VQL1 3J81b 1YJWZ 1NJI1 1TWAI 3CQZI 1QVGZ 3CMEZ 3J80f 2JUBA 1YI21 2K5RA 1WCMI 4RVFA 4NBFA 1VQ6Z 2OTJZ 2OTLZ 2AKLA 2W03A 3OW2Y 1VQ91 4NBDA 4RVDA 5C3EI 5T6BA 5T64A 2VUGA 2NVXI 4MD7A 4NBAA 1R9TI 3GTQI 3Q87A 1YJNZ 1KD11 2Q4ZA 4A3BI 2O53A 2QKDA 2GTIA 3G71Z 3CCQ1 2M6NA 1KQSY 2R6MA 1Z03A 5C4JI 1QVFY 1VQOZ 1Q811 1LQLA 2JNYA 3CC71 3CD6Z 3CCE1 2OTJ1 2E9HA 4HH4A 5FLXb 1JJ2Z 3CCM1 3CPWY 1VQN1 2WB1A 3I07A 1NUIA 2RPRA 3HOYI 2HF1A 4NB9A 1VQ4Z 4A3GI 1USPB 4BY1I 4QTUA 3RZOI 3GTLI 3H3VJ 2KI7B 3S1QI 3CXCY 4E2YA 3GCFA 2GU2A 3CC2Z 2PMZA 4NB8A 2R93I 3CCR1 1I3QI 2QREB 2QLVB 4E33A 1QYPA 1QF8A 2LFUA 2DE6A 1YIJZ 3CMAZ 3S1RI 1VQ51 3S1MI 2F4OA 1RLYA 2GTHA 3I4NI 2V8JA 4NBHA 2M48A 5IP9I 1YUKA 4MRIA 1K732
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VB9 A;  2R7Z I;  1TWA I;  2DE5 A;  5FLM I;  3CQZ I;  3GTK I;  1TWF I;  4A3F I;  2K5R A;  1WCM I;  2B63 I;  2E2J I;  3S14 I;  4NBF A;  1ZB8 A;  3GKQ A;  2AKL A;  3FKI I;  4BY7 I;  4A3D I;  3U50 C;  3HOX I;  1I6H I;  4NBD A;  5C3E I;  4A3M I;  2NVX I;  4NBA A;  3K7A I;  1R9T I;  3M3Y I;  2NVQ I;  2P3Y A;  4NBE A;  3GTQ I;  3HOU I;  3Q87 A;  2DE7 A;  4NOZ A;  4A3B I;  2JA5 I;  3PO2 I;  3LUS A;  1X3W A;  3S17 I;  1YUA A;  3VMH A;  3VMI A;  5C44 I;  2KPI A;  1TWH I;  1TFI A;  4X6A I;  4Y52 I;  1USP A;  2BJO A;  3GTM S;  2R92 I;  5C4J I;  3GTG I;  4NBC A;  1LQL A;  1K83 I;  4QTT A;  2JNY A;  3S2D I;  1RO4 A;  4XX2 A;  3GTM I;  1I50 I;  3RZD I;  2E2I I;  2JA7 I;  2RBL A;  3I07 A;  4A3J I;  3GTP I;  1NUI A;  2VUM I;  3HOY I;  2HF1 A;  4NB9 A;  2JA6 I;  4NBB A;  3PO3 I;  4A3G I;  1USP B;  2NVT I;  5IP7 I;  4Y7N I;  4BY1 I;  4QTU A;  4A3E I;  3GTO I;  3RZO I;  3GTL I;  3H3V J;  4A3L I;  2E2H I;  3S1Q I;  1TWC I;  1Y1W I;  3I4M I;  1DL6 A;  3GCF A;  2J6A A;  2JR6 A;  1Y1V S;  3S16 I;  1ML8 A;  1X3Z A;  4NB8 A;  2R93 I;  1WW9 A;  1I3Q I;  4BBR I;  4BXX I;  3HOW I;  3D6W A;  1VLA A;  3GTJ I;  2PK7 A;  3S1N I;  5C4X I;  2NVY I;  3H0G I;  1PFT A;  1QYP A;  1ZB9 A;  3S2H I;  3M4O I;  2DE6 A;  2YU9 I;  3HOV I;  3S1R I;  4A3C I;  3VMG A;  4A93 I;  4A3I I;  4MH4 A;  3ESW A;  3S1M I;  3S15 I;  3PO3 S;  2F4M A;  2F4O A;  2JA8 I;  1RLY A;  4A3K I;  1L1O C;  1TWG I;  4BBS I;  3I4N I;  3HOZ I;  4NBG A;  3EER A;  1Y1V I;  4NBH A;  1N2F A;  2JS4 A;  1SFO I;  5IP9 I;  5CM2 M; 
#chains in the Genus database with same CATH topology
 2PM9 A;  4RVG A;  3NDI A;  1Q86 2;  2P28 A;  2V3V A;  3FQM A;  1S72 1;  2E2J I;  3S14 I;  3GKQ A;  4BY7 I;  3FKI I;  1YHQ Z;  3HOX I;  1I6H I;  1NP6 A;  4E31 A;  1SIW A;  3QWU A;  3M3Y I;  3MZK B;  2NVQ I;  2P3Y A;  2JIQ A;  3I55 Z;  2JA5 I;  3LUS A;  1X3W A;  5LL6 f;  4TNU A;  3S17 I;  3CCJ 1;  1TWH I;  1VQP Z;  1TFI A;  2IZ4 A;  3GTM S;  1QVG Y;  5IT9 f;  3CD6 1;  2R92 I;  2V45 A;  4NBC A;  1K83 I;  3CCS Z;  1VQ8 Z;  1K8A 2;  3S2D I;  4E30 A;  2JIO A;  1I50 I;  3RZD I;  4AYB A;  2RBL A;  4A3J I;  1WZN A;  2VUM I;  1RO2 A;  1Q7Y 1;  5FLX f;  3HKZ A;  1Q16 A;  3CCL Z;  2YAD A;  1Z02 A;  3GTO I;  3I4M I;  2E7Z A;  2JR6 A;  2OOX B;  3CCU 1;  1K8A 1;  4EWC A;  2VF1 A;  1YIJ 1;  3HOW I;  2OTL 1;  1VQM 1;  2PK7 A;  2QEX 1;  5C4X I;  2NVY I;  2VPW A;  3CXC Z;  4DGL A;  2QRC B;  1VQ4 1;  3I55 1;  3VMG A;  1RNI A;  3ESW A;  2ZAE B;  5D1O B;  3PO3 S;  5A2Q f;  2OOY B;  4A3K I;  1L1O C;  3CC2 1;  1M1K 1;  1K9M 2;  4HGY A;  4E2Z A;  3EER A;  1Y1V I;  2JS4 A;  3D9X A;  5CM2 M;  3VB9 A;  2QA4 1;  1Q7Y 2;  5FLM I;  2Y0S A;  3CC4 1;  1VQN Z;  1X0T A;  1YJ9 1;  1VQK Z;  1KD1 2;  2H85 A;  1TWF I;  1NJI 2;  3G6E 1;  3OW2 Z;  2B63 I;  4NFR A;  1Q82 2;  1ZB8 A;  3NDJ A;  3KIH A;  1M90 2;  3U50 C;  1N8R 1;  1VQ7 Z;  4DK1 A;  4A3M I;  3K7A I;  1Z01 A;  4MD8 A;  4NBE A;  3CCM Z;  3CCV Z;  1M1K 2;  4NOZ A;  3NFZ A;  2JIP A;  4S1T A;  1YUA A;  3VMH A;  3VMI A;  1W2B Z;  2KPI A;  2RIQ A;  4Y52 I;  1USP A;  2BJO A;  4RS4 A;  1QXF A;  3GTG I;  3P5J B;  2OZK A;  2AYD A;  1VQ5 Z;  2HU9 A;  3NH8 A;  3G6E Z;  5IT9 b;  1RO4 A;  2LEX A;  2E2I I;  2JA7 I;  1WII A;  3CCJ Z;  2WAQ A;  3IX0 A;  2JA6 I;  4NBB A;  1VQ9 Z;  3CCQ Z;  4NH1 C;  2NVT I;  5IP7 I;  1JJ2 Y;  1FDO A;  2JIR A;  1DL6 A;  2V8I A;  1Y1V S;  1YJ9 Z;  1VQK 1;  1ML8 A;  1X3Z A;  3J7A 4;  1WW9 A;  3NH5 A;  4BBR I;  3GTJ I;  3TDH B;  3H0G I;  2O4H A;  4E2W A;  1PFT A;  1ZB9 A;  2K3R A;  2YU9 I;  3CCV 1;  3F3P C;  1M90 1;  4A3C I;  3F3F C;  3IF8 A;  3VTN A;  4A93 I;  3CME 1;  4MH4 A;  1RQF A;  2F4M A;  1KRL A;  3TE5 B;  1TWG I;  1YIT Z;  3HOZ I;  1K9M 1;  3J81 f;  5A2Q b;  1K73 1;  3CCS 1;  2QEX Z;  1VQ8 1;  1N2F A;  4DQY B;  1SFO I;  1JWH C;  4HGZ A;  2R7Z I;  2DE5 A;  3MON A;  4MON A;  5D1O A;  1KQS Z;  1YJW 1;  1Q81 2;  4A3F I;  3GTK I;  1VQ7 1;  1AA6 A;  4A3D I;  3CCR Z;  5AN9 F;  1VQP 1;  1ZH1 A;  2IZ3 A;  1YI2 Z;  3CCE Z;  3CC4 Z;  2RT9 A;  1YHQ 1;  1QVF Z;  1Q82 1;  2QA4 Z;  3HOU I;  1YIT 1;  3G4S Z;  3CCU Z;  2DE7 A;  1Q86 1;  3PO2 I;  5C44 I;  2VPX A;  3T4N B;  4X6A I;  3CCL 1;  1YJN 1;  1P9N A;  3FQQ A;  4QTT A;  2QRD B;  4RVH A;  4XX2 A;  3GTM I;  1KC8 1;  4MXU A;  1VQ6 1;  3NH4 A;  4RV9 A;  3GTP I;  1W2B Y;  3PO3 I;  5T67 A;  2QR1 B;  2EGT A;  4Y7N I;  4A3E I;  4A3L I;  2E2H I;  1TWC I;  1Y1W I;  4CL1 A;  2I3C A;  2J6A A;  3JAM f;  3I56 1;  1VQL Z;  3G71 1;  3MZL B;  3S16 I;  2RHB A;  4E32 A;  4BXX I;  2Q51 A;  3D6W A;  1VLA A;  2LIY A;  3S1N I;  4MD9 A;  3CC7 Z;  1VQO 1;  3S2H I;  1RO0 A;  3EED A;  3JAM b;  3M4O I;  1S72 Z;  1S7M A;  3G4S 1;  3HOV I;  4E2X A;  4A3I I;  1KC8 2;  3BG1 B;  3IFU A;  3S15 I;  2JA8 I;  3BG0 B;  2G2K A;  1VQM Z;  2JMO A;  3J80 b;  3CMA 1;  4BBS I;  3KIF A;  2W04 A;  4NBG A;  3CPW Z;  1N8R 2;  5D1P A;  2V8K A;  3I56 Z;  1VQL 1;  3J81 b;  1YJW Z;  1NJI 1;  1TWA I;  1WJ2 A;  3CQZ I;  1QVG Z;  3CME Z;  1Y8C A;  2JUB A;  3J80 f;  1YI2 1;  1FDI A;  2K5R A;  1WCM I;  4RVF A;  4NBF A;  1VQ6 Z;  2OTJ Z;  2OTL Z;  2AKL A;  2VPY A;  2W03 A;  3OW2 Y;  1VQ9 1;  4NBD A;  4RVD A;  5C3E I;  5T6B A;  5T64 A;  2VUG A;  2NVX I;  4MD7 A;  4MRI A;  4NBA A;  1R9T I;  3GTQ I;  3Q87 A;  2NAP A;  1YJN Z;  1KD1 1;  2Q4Z A;  4A3B I;  2O53 A;  2QKD A;  2GTI A;  3G71 Z;  3CCQ 1;  2M6N A;  1KQS Y;  2R6M A;  1Z03 A;  5C4J I;  1QVF Y;  1VQO Z;  1Q81 1;  1LQL A;  2JNY A;  3CC7 1;  3CD6 Z;  3CCE 1;  2OTJ 1;  2E9H A;  4HH4 A;  5FLX b;  1JJ2 Z;  3CCM 1;  3CPW Y;  1VQN 1;  2WB1 A;  3I07 A;  1NUI A;  2RPR A;  3HOY I;  2HF1 A;  4NB9 A;  1VQ4 Z;  4A3G I;  1USP B;  4BY1 I;  4QTU A;  3RZO I;  3GTL I;  3H3V J;  2KI7 B;  3S1Q I;  3CXC Y;  4E2Y A;  3GCF A;  2GU2 A;  3CC2 Z;  2PMZ A;  4NB8 A;  2R93 I;  3CCR 1;  1I3Q I;  2IV2 X;  3IR7 A;  2QRE B;  2QLV B;  4E33 A;  1QYP A;  1QF8 A;  2LFU A;  2DE6 A;  1YIJ Z;  3CMA Z;  3S1R I;  1VQ5 1;  3S1M I;  2F4O A;  3D2L A;  1RLY A;  2GTH A;  3I4N I;  2V8J A;  4NBH A;  2M48 A;  5IP9 I;  1YUK A;  2VPZ A;  1K73 2;  2JIM A; 
#chains in the Genus database with same CATH homology
 2PM9 A;  4RVG A;  3NDI A;  1Q86 2;  2P28 A;  3FQM A;  1S72 1;  2E2J I;  3S14 I;  3GKQ A;  4BY7 I;  3FKI I;  1YHQ Z;  3HOX I;  1I6H I;  1NP6 A;  4E31 A;  3QWU A;  3M3Y I;  3MZK B;  2NVQ I;  2P3Y A;  3I55 Z;  2JA5 I;  3LUS A;  1X3W A;  5LL6 f;  4TNU A;  3S17 I;  3CCJ 1;  1TWH I;  1VQP Z;  1TFI A;  2IZ4 A;  3GTM S;  1QVG Y;  5IT9 f;  3CD6 1;  2R92 I;  4NBC A;  1K83 I;  3CCS Z;  1VQ8 Z;  1K8A 2;  3S2D I;  4E30 A;  1I50 I;  3RZD I;  4AYB A;  2RBL A;  4A3J I;  2VUM I;  1RO2 A;  1Q7Y 1;  5FLX f;  3HKZ A;  3CCL Z;  2YAD A;  1Z02 A;  3GTO I;  3I4M I;  2JR6 A;  2OOX B;  3CCU 1;  1K8A 1;  4EWC A;  2VF1 A;  1YIJ 1;  3HOW I;  2OTL 1;  1VQM 1;  2PK7 A;  2QEX 1;  5C4X I;  2NVY I;  3CXC Z;  4DGL A;  2QRC B;  1VQ4 1;  3I55 1;  3VMG A;  1RNI A;  3ESW A;  2ZAE B;  5D1O B;  3PO3 S;  5A2Q f;  2OOY B;  4A3K I;  1L1O C;  3CC2 1;  1M1K 1;  1K9M 2;  4HGY A;  4E2Z A;  3EER A;  1Y1V I;  2JS4 A;  3D9X A;  5CM2 M;  3VB9 A;  2QA4 1;  1Q7Y 2;  5FLM I;  2Y0S A;  3CC4 1;  1VQN Z;  1X0T A;  1YJ9 1;  1VQK Z;  1KD1 2;  2H85 A;  1TWF I;  1NJI 2;  3G6E 1;  3OW2 Z;  2B63 I;  4NFR A;  1Q82 2;  1ZB8 A;  3NDJ A;  3KIH A;  1M90 2;  3U50 C;  1N8R 1;  1VQ7 Z;  4DK1 A;  4A3M I;  3K7A I;  1Z01 A;  4MD8 A;  4NBE A;  3CCM Z;  3CCV Z;  1M1K 2;  4NOZ A;  3NFZ A;  4S1T A;  1YUA A;  3VMH A;  3VMI A;  1W2B Z;  2KPI A;  2RIQ A;  4Y52 I;  1USP A;  2BJO A;  4RS4 A;  3GTG I;  3P5J B;  2OZK A;  1VQ5 Z;  2HU9 A;  3NH8 A;  3G6E Z;  5IT9 b;  1RO4 A;  2E2I I;  2JA7 I;  1WII A;  3CCJ Z;  2WAQ A;  3IX0 A;  2JA6 I;  4NBB A;  1VQ9 Z;  3CCQ Z;  4NH1 C;  2NVT I;  5IP7 I;  1JJ2 Y;  1DL6 A;  2V8I A;  1Y1V S;  1YJ9 Z;  1VQK 1;  1ML8 A;  1X3Z A;  3J7A 4;  1WW9 A;  3NH5 A;  4BBR I;  3GTJ I;  3TDH B;  3H0G I;  2O4H A;  4E2W A;  1PFT A;  1ZB9 A;  2K3R A;  2YU9 I;  3CCV 1;  3F3P C;  1M90 1;  4A3C I;  3F3F C;  3IF8 A;  3VTN A;  4A93 I;  3CME 1;  4MH4 A;  1RQF A;  2F4M A;  1KRL A;  3TE5 B;  1TWG I;  1YIT Z;  3HOZ I;  1K9M 1;  3J81 f;  5A2Q b;  1K73 1;  3CCS 1;  2QEX Z;  1VQ8 1;  1N2F A;  4DQY B;  1SFO I;  1JWH C;  4HGZ A;  2R7Z I;  2DE5 A;  3MON A;  4MON A;  5D1O A;  1KQS Z;  1YJW 1;  1Q81 2;  4A3F I;  3GTK I;  1VQ7 1;  4A3D I;  3CCR Z;  5AN9 F;  1VQP 1;  1ZH1 A;  2IZ3 A;  1YI2 Z;  3CCE Z;  3CC4 Z;  2RT9 A;  1YHQ 1;  1QVF Z;  1Q82 1;  2QA4 Z;  3HOU I;  1YIT 1;  3G4S Z;  3CCU Z;  2DE7 A;  1Q86 1;  3PO2 I;  5C44 I;  3T4N B;  4X6A I;  3CCL 1;  1YJN 1;  1P9N A;  3FQQ A;  4QTT A;  2QRD B;  4RVH A;  4XX2 A;  3GTM I;  1KC8 1;  4MXU A;  1VQ6 1;  3NH4 A;  4RV9 A;  3GTP I;  1W2B Y;  3PO3 I;  5T67 A;  2QR1 B;  2EGT A;  4Y7N I;  4A3E I;  4A3L I;  2E2H I;  1TWC I;  1Y1W I;  4CL1 A;  2I3C A;  2J6A A;  3JAM f;  3I56 1;  1VQL Z;  3G71 1;  3MZL B;  3S16 I;  2RHB A;  4E32 A;  4BXX I;  2Q51 A;  3D6W A;  1VLA A;  2LIY A;  3S1N I;  4MD9 A;  3CC7 Z;  1VQO 1;  3S2H I;  1RO0 A;  3EED A;  3JAM b;  3M4O I;  1S72 Z;  1S7M A;  3G4S 1;  3HOV I;  4E2X A;  4A3I I;  1KC8 2;  3BG1 B;  3IFU A;  3S15 I;  2JA8 I;  3BG0 B;  2G2K A;  1VQM Z;  2JMO A;  3J80 b;  3CMA 1;  4BBS I;  3KIF A;  2W04 A;  4NBG A;  3CPW Z;  1N8R 2;  5D1P A;  2V8K A;  3I56 Z;  1VQL 1;  3J81 b;  1YJW Z;  1NJI 1;  1TWA I;  3CQZ I;  1QVG Z;  3CME Z;  3J80 f;  2JUB A;  1YI2 1;  2K5R A;  1WCM I;  4RVF A;  4NBF A;  1VQ6 Z;  2OTJ Z;  2OTL Z;  2AKL A;  2W03 A;  3OW2 Y;  1VQ9 1;  4NBD A;  4RVD A;  5C3E I;  5T6B A;  5T64 A;  2VUG A;  2NVX I;  4MD7 A;  4NBA A;  1R9T I;  3GTQ I;  3Q87 A;  1YJN Z;  1KD1 1;  2Q4Z A;  4A3B I;  2O53 A;  2QKD A;  2GTI A;  3G71 Z;  3CCQ 1;  2M6N A;  1KQS Y;  2R6M A;  1Z03 A;  5C4J I;  1QVF Y;  1VQO Z;  1Q81 1;  1LQL A;  2JNY A;  3CC7 1;  3CD6 Z;  3CCE 1;  2OTJ 1;  2E9H A;  4HH4 A;  5FLX b;  1JJ2 Z;  3CCM 1;  3CPW Y;  1VQN 1;  2WB1 A;  3I07 A;  1NUI A;  2RPR A;  3HOY I;  2HF1 A;  4NB9 A;  1VQ4 Z;  4A3G I;  1USP B;  4BY1 I;  4QTU A;  3RZO I;  3GTL I;  3H3V J;  2KI7 B;  3S1Q I;  3CXC Y;  4E2Y A;  3GCF A;  2GU2 A;  3CC2 Z;  2PMZ A;  4NB8 A;  2R93 I;  3CCR 1;  1I3Q I;  2QRE B;  2QLV B;  4E33 A;  1QYP A;  1QF8 A;  2LFU A;  2DE6 A;  1YIJ Z;  3CMA Z;  3S1R I;  1VQ5 1;  3S1M I;  2F4O A;  1RLY A;  2GTH A;  3I4N I;  2V8J A;  4NBH A;  2M48 A;  5IP9 I;  1YUK A;  4MRI A;  1K73 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...