3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
3GTPI 5IP9I 3VMHA 1WW9A 5IP7I 3RZOI 1DL6A 2J6AA 3EERA 2NVXI 4A93I 3I4NI 3HOUI 1ZB9A 5CM2M 3HOYI 3S2HI 5FLMI 1Y1WI 3S1RI 2B63I 4NBDA 1Y1VS 4A3GI 1USPB 3D6WA 4BY7I 3ESWA 3PO3I 1ZB8A 2P3YA 3S2DI 1TWFI 3GTMS 1TWAI 1NUIA 2R93I 2BJOA 2RBLA 2E2JI 4X6AI 5C4XI 1K83I 2F4OA 3HOXI 4NBBA 2E2II 2NVTI 4A3BI 3H0GI 3PO2I 3VB9A 3GTGI 2K5RA 1QYPA 3FKII 3S16I 3S15I 4NBGA 3S1QI 3I07A 2JA7I 3HOZI 4A3DI 3S1MI 2AKLA 3VMIA 2JNYA 4NB9A 3M3YI 3U50C 1TWHI 1N2FA 2YU9I 4NOZA 4NBHA 3PO3S 4QTTA 1LQLA 3M4OI 3LUSA 2JA8I 1SFOI 1I3QI 4A3MI 1WCMI 3S1NI 4QTUA 2E2HI 3GTLI 2F4MA 2JA6I 3S14I 1PFTA 1ML8A 3HOWI 1I6HI 2R7ZI 1L1OC 1YUAA 1X3ZA 5C44I 3GTQI 3GTJI 3GCFA 3I4MI 4Y7NI 4A3KI 3GTOI 2NVYI 2JR6A 4NBAA 3GTKI 4A3LI 4NBFA 4A3FI 1X3WA 3Q87A 1TFIA 5C3EI 4BY1I 3S17I 1VLAA 4A3CI 3RZDI 2JA5I 4A3II 3VMGA 5C4JI 1USPA 4BBRI 1TWCI 1R9TI 1Y1VI 2DE7A 1TWGI 2R92I 2JS4A 3CQZI 4BXXI 4NBEA 2PK7A 3HOVI 4NBCA 4NB8A 3H3VJ 4XX2A 3GKQA 4A3JI 3GTMI 2KPIA 1RO4A 2NVQI 4MH4A 2HF1A 4Y52I 1I50I 2DE5A 2VUMI 4BBSI 4A3EI 1RLYA 2DE6A 3K7AI
chains in the Genus database with same CATH superfamily
3VMHA 3RZOI 3F3PC 2H85A 3JAMb 1QVGZ 2RHBA 3F3FC 4RVFA 2RT9A 1Q861 3OW2Z 1ZB9A 2VF1A 2QRDB 3NH8A 5FLMI 4NBDA 1JWHC 4HH4A 2R6MA 1VQOZ 1K732 1YJN1 1KD11 1KC82 1TWFI 3GTMS 1Q822 1YJWZ 4DQYB 2BJOA 4E2XA 1YUKA 2F4OA 1FDOA 1VQ81 3HOXI 1S721 3VB9A 1VQ91 1QYPA 3NH5A 3CCUZ 1YIJZ 2LFUA 2JIRA 3KIFA 2G2KA 2VUGA 2AKLA 3CCLZ 1Y8CA 4NB9A 3M3YI 4RVDA 1W2BZ 1N2FA 4NOZA 3PO3S 2E7ZA 3KIHA 3NDIA 3I55Z 1QXFA 3TDHB 1KQSZ 4QTUA 5D1PA 3I56Z 1VQMZ 1VQ51 5T6BA 1YHQ1 1K8A1 2IZ4A 3S14I 3CCM1 1ML8A 1VQ61 3HOWI 1VQL1 3CC41 1I6HI 3G711 1K9M1 3GTQI 3GTJI 1VQ41 4A3KI 3GTOI 4TNUA 4NBAA 3G4SZ 5AN9F 1QVFZ 4BY1I 5FLXb 2LIYA 3CC71 3JAMf 3RZDI 2JA5I 3VMGA 3CCVZ 4BBRI 2JIOA 2IV2X 2QA41 2QREB 2JS4A 2V45A 3T4NB 3G6EZ 1YITZ 4MXUA 1YI2Z 2VPWA 3GKQA 3GTMI 4MH4A 1VQK1 2LEXA 2QKDA 4BBSI 3CCRZ 1K8A2 3CME1 1RLYA 1NJI1 5IP9I 1DL6A 1WW9A 1K9M2 2OZKA 3TE5B 3I4NI 1NP6A 3HOUI 1S7MA 3HOYI 1Y1WI 4RS4A 2YADA 3S1RI 2B63I 3J81b 3CPWZ 3D6WA 4BY7I 3ESWA 3PO3I 2GTIA 1TWAI 3HKZA 2QEX1 2R93I 2RBLA 4AYBA 2E2JI 5T67A 3CCSZ 2E2II 4A3BI 1Z01A 4MD7A 1RNIA 2JIMA 3S1QI 1Q812 2JA7I 2AYDA 3CCQ1 4MD9A 3CXCY 3CD6Z 2V3VA 5FLXf 2OTJZ 2VPYA 1M1K2 3LUSA 2Q51A 5A2Qb 1SFOI 1YHQZ 2I3CA 1VQP1 3S1NI 3GTLI 1P9NA 2JA6I 1PFTA 2QLVB 1VQLZ 2K3RA 3CC2Z 4DGLA 4MONA 1YUAA 3CCEZ 3GCFA 2W04A 1VQ71 3MZKB 3CMA1 1X3WA 1Q862 1TFIA 1KRLA 2NAPA 4NH1C 4A3II 1ZH1A 1TWCI 1KD12 1R9TI 1TWGI 3MONA 2PK7A 2V8JA 4NBCA 3J81f 3CCJZ 2WB1A 3NFZA 1FDIA 2OTLZ 1VQO1 2VUMI 1RO2A 3BG0B 4A3EI 3IFUA 2DE6A 3GTPI 1YJW1 5IP7I 2J6AA 3EERA 2JUBA 1YJ9Z 2NVXI 4RVHA 4A93I 3IR7A 1JJ2Y 3P5JB 4MD8A 1VQNZ 5LL6f 4NFRA 3CCU1 1YIJ1 3J7A4 5IT9b 3CCL1 2P3YA 4E33A 3S2DI 4EWCA 1Q7Y1 5A2Qf 2JIQA 4X6AI 1RO0A 5C4XI 3I551 4NBBA 2NVTI 5D1OB 3H0GI 4DK1A 3PO2I 3GTGI 2K5RA 3I561 1VQM1 4E2WA 3S16I 2WAQA 3HOZI 4A3DI 3S1MI 2V8IA 1YJNZ 3VMIA 3D9XA 2M6NA 3G4S1 2YU9I 4NBHA 4QTTA 1LQLA 1VQ8Z 4E2ZA 4CL1A 1K731 1QVGY 2ZAEB 3FQMA 1S72Z 2E2HI 1VQ9Z 2F4MA 2KI7B 3CCV1 3OW2Y 2QR1B 1Q7Y2 1VQ7Z 3G6E1 1L1OC 1NJI2 5C44I 1YIT1 1YI21 3I4MI 4Y7NI 2JR6A 3GTKI 2JIPA 4A3FI 3CCR1 2IZ3A 5C3EI 3IX0A 4A3CI 4E32A 1VQ5Z 5C4JI 3CCMZ 3IF8A 1VQ6Z 2DE7A 2PMZA 4BXXI 3CC4Z 1N8R1 2GTHA 3G71Z 3FQQA 4XX2A 1VQ4Z 5IT9f 2KPIA 2HF1A 4Y52I 1I50I 1W2BY 5D1OA 4E2YA 3CXCZ 3NH4A 3VTNA 3D2LA 3BG1B 2O4HA 3CC7Z 2RPRA 2Q4ZA 2W03A 1KQSY 3MZLB 2V8KA 3CCS1 2QA4Z 3J80b 1X0TA 5CM2M 3S2HI 4MRIA 2VPZA 4A3GI 1Y1VS 1USPB 2VPXA 1VQKZ 1ZB8A 3CMEZ 1QVFY 3CD61 1NUIA 1N8R2 2OTJ1 1Z03A 1K83I 1AA6A 2P28A 1WJ2A 3FKII 2QRCB 3S15I 4NBGA 1SIWA 3CC21 3I07A 2JNYA 3CCE1 1M901 3U50C 4HGYA 1TWHI 4E30A 2QEXZ 2Y0SA 3EEDA 2E9HA 3M4OI 4RV9A 2JA8I 1I3QI 5T64A 2M48A 4A3MI 1WCMI 4S1TA 2GU2A 1JJ2Z 3CPWY 2R7ZI 3CCJ1 1X3ZA 3CCQZ 2RIQA 2NVYI 2OTL1 1Q16A 2HU9A 1QF8A 4A3LI 4NBFA 1Z02A 3Q87A 1WIIA 1Q811 2O53A 3S17I 1VLAA 1VQPZ 2PM9A 1KC81 1M902 3J80f 1YJ91 1RQFA 1USPA 1Y1VI 2JMOA 2OOXB 2R92I 3CQZI 1Q821 3NDJA 1M1K1 4NBEA 3HOVI 4NB8A 1VQN1 3QWUA 4E31A 3H3VJ 4A3JI 2EGTA 3CMAZ 1RO4A 2NVQI 1WZNA 4HGZA 2DE5A 2OOYB 4RVGA 3K7AI
chains in the Genus database with same CATH topology
3VMHA 3RZOI 3F3PC 2H85A 3JAMb 1QVGZ 2RHBA 3F3FC 4RVFA 2RT9A 1Q861 3OW2Z 1ZB9A 2VF1A 2QRDB 3NH8A 5FLMI 4NBDA 1JWHC 4HH4A 2R6MA 1VQOZ 1K732 1YJN1 1KD11 1KC82 1TWFI 3GTMS 1Q822 1YJWZ 4DQYB 2BJOA 4E2XA 1YUKA 2F4OA 1VQ81 3HOXI 1S721 3VB9A 1VQ91 1QYPA 3NH5A 3CCUZ 1YIJZ 2LFUA 3KIFA 2G2KA 2VUGA 2AKLA 3CCLZ 4NB9A 3M3YI 4RVDA 1W2BZ 1N2FA 4NOZA 3PO3S 3KIHA 3NDIA 3I55Z 3TDHB 1KQSZ 4QTUA 5D1PA 3I56Z 1VQMZ 1VQ51 5T6BA 1YHQ1 1K8A1 2IZ4A 3S14I 3CCM1 1ML8A 1VQ61 3HOWI 1VQL1 3CC41 1I6HI 3G711 1K9M1 3GTQI 3GTJI 1VQ41 4A3KI 3GTOI 4TNUA 4NBAA 3G4SZ 5AN9F 1QVFZ 4BY1I 5FLXb 2LIYA 3CC71 3JAMf 3RZDI 2JA5I 3VMGA 3CCVZ 4BBRI 2QA41 2QREB 2JS4A 3T4NB 3G6EZ 1YITZ 4MXUA 1YI2Z 3GKQA 3GTMI 4MH4A 1VQK1 2QKDA 4BBSI 3CCRZ 1K8A2 3CME1 1RLYA 1NJI1 5IP9I 1DL6A 1WW9A 1K9M2 2OZKA 3TE5B 3I4NI 1NP6A 3HOUI 1S7MA 3HOYI 1Y1WI 4RS4A 2YADA 3S1RI 2B63I 3J81b 3CPWZ 3D6WA 4BY7I 3ESWA 3PO3I 2GTIA 1TWAI 3HKZA 2QEX1 2R93I 2RBLA 4AYBA 2E2JI 5T67A 3CCSZ 2E2II 4A3BI 1Z01A 4MD7A 1RNIA 3S1QI 1Q812 2JA7I 3CCQ1 4MD9A 3CXCY 3CD6Z 5FLXf 2OTJZ 1M1K2 3LUSA 2Q51A 5A2Qb 1SFOI 1YHQZ 2I3CA 1VQP1 3S1NI 3GTLI 1P9NA 2JA6I 1PFTA 2QLVB 1VQLZ 2K3RA 3CC2Z 4DGLA 4MONA 1YUAA 3CCEZ 3GCFA 2W04A 1VQ71 3MZKB 3CMA1 1X3WA 1Q862 1TFIA 1KRLA 4NH1C 4A3II 1ZH1A 1TWCI 1KD12 1R9TI 1TWGI 3MONA 2PK7A 2V8JA 4NBCA 3J81f 2WB1A 3NFZA 3CCJZ 2OTLZ 1VQO1 2VUMI 1RO2A 4A3EI 3BG0B 3IFUA 2DE6A 3GTPI 1YJW1 5IP7I 2J6AA 3EERA 2JUBA 1YJ9Z 2NVXI 4RVHA 4A93I 1JJ2Y 3P5JB 4MD8A 1VQNZ 5LL6f 4NFRA 3CCU1 1YIJ1 3J7A4 5IT9b 3CCL1 2P3YA 4E33A 3S2DI 4EWCA 1Q7Y1 5A2Qf 4X6AI 1RO0A 5C4XI 3I551 4NBBA 2NVTI 5D1OB 3H0GI 4DK1A 3PO2I 3GTGI 2K5RA 3I561 1VQM1 4E2WA 3S16I 2WAQA 3HOZI 4A3DI 3S1MI 2V8IA 1YJNZ 3VMIA 3D9XA 2M6NA 3G4S1 2YU9I 4NBHA 4QTTA 1LQLA 1VQ8Z 4E2ZA 4CL1A 1K731 1QVGY 2ZAEB 3FQMA 1S72Z 2E2HI 1VQ9Z 2F4MA 2KI7B 3CCV1 3OW2Y 2QR1B 1Q7Y2 1VQ7Z 3G6E1 1L1OC 1NJI2 5C44I 1YIT1 1YI21 3I4MI 4Y7NI 2JR6A 3GTKI 4A3FI 3CCR1 2IZ3A 5C3EI 3IX0A 4A3CI 4E32A 1VQ5Z 5C4JI 3CCMZ 3IF8A 1VQ6Z 2DE7A 2PMZA 4BXXI 3CC4Z 1N8R1 2GTHA 3G71Z 3FQQA 4XX2A 1VQ4Z 5IT9f 2KPIA 2HF1A 4Y52I 1I50I 1W2BY 5D1OA 4E2YA 3CXCZ 3NH4A 3VTNA 3BG1B 2O4HA 3CC7Z 2RPRA 2Q4ZA 2W03A 1KQSY 3MZLB 2V8KA 3CCS1 2QA4Z 3J80b 1X0TA 5CM2M 3S2HI 4MRIA 4A3GI 1Y1VS 1USPB 1VQKZ 1ZB8A 3CMEZ 1QVFY 3CD61 1NUIA 1N8R2 2OTJ1 1Z03A 1K83I 2P28A 3FKII 2QRCB 3S15I 4NBGA 3CC21 3I07A 2JNYA 3CCE1 1M901 3U50C 4HGYA 1TWHI 4E30A 2QEXZ 2Y0SA 3EEDA 2E9HA 3M4OI 4RV9A 2JA8I 1I3QI 5T64A 2M48A 4A3MI 1WCMI 4S1TA 2GU2A 1JJ2Z 3CPWY 2R7ZI 3CCJ1 1X3ZA 3CCQZ 2RIQA 2NVYI 2OTL1 2HU9A 1QF8A 4A3LI 4NBFA 1Z02A 3Q87A 1WIIA 1Q811 2O53A 3S17I 1VLAA 1VQPZ 2PM9A 1KC81 1M902 3J80f 1YJ91 1RQFA 1USPA 1Y1VI 2JMOA 2OOXB 2R92I 3CQZI 1Q821 3NDJA 1M1K1 4NBEA 3HOVI 4NB8A 1VQN1 3QWUA 4E31A 3H3VJ 4A3JI 2EGTA 3CMAZ 1RO4A 2NVQI 4HGZA 2DE5A 2OOYB 4RVGA 3K7AI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP I;  5IP9 I;  3VMH A;  1WW9 A;  5IP7 I;  3RZO I;  1DL6 A;  2J6A A;  3EER A;  2NVX I;  4A93 I;  3I4N I;  3HOU I;  1ZB9 A;  5CM2 M;  3HOY I;  3S2H I;  5FLM I;  1Y1W I;  3S1R I;  2B63 I;  4NBD A;  1Y1V S;  4A3G I;  1USP B;  3D6W A;  4BY7 I;  3ESW A;  3PO3 I;  1ZB8 A;  2P3Y A;  3S2D I;  1TWF I;  3GTM S;  1TWA I;  1NUI A;  2R93 I;  2BJO A;  2RBL A;  2E2J I;  4X6A I;  5C4X I;  1K83 I;  2F4O A;  3HOX I;  4NBB A;  2E2I I;  2NVT I;  4A3B I;  3H0G I;  3PO2 I;  3VB9 A;  3GTG I;  2K5R A;  1QYP A;  3FKI I;  3S16 I;  3S15 I;  4NBG A;  3S1Q I;  3I07 A;  2JA7 I;  3HOZ I;  4A3D I;  3S1M I;  2AKL A;  3VMI A;  2JNY A;  4NB9 A;  3M3Y I;  3U50 C;  1TWH I;  1N2F A;  2YU9 I;  4NOZ A;  4NBH A;  3PO3 S;  4QTT A;  1LQL A;  3M4O I;  3LUS A;  2JA8 I;  1SFO I;  1I3Q I;  4A3M I;  1WCM I;  3S1N I;  4QTU A;  2E2H I;  3GTL I;  2F4M A;  2JA6 I;  3S14 I;  1PFT A;  1ML8 A;  3HOW I;  1I6H I;  2R7Z I;  1L1O C;  1YUA A;  1X3Z A;  5C44 I;  3GTQ I;  3GTJ I;  3GCF A;  3I4M I;  4Y7N I;  4A3K I;  3GTO I;  2NVY I;  2JR6 A;  4NBA A;  3GTK I;  4A3L I;  4NBF A;  4A3F I;  1X3W A;  3Q87 A;  1TFI A;  5C3E I;  4BY1 I;  3S17 I;  1VLA A;  4A3C I;  3RZD I;  2JA5 I;  4A3I I;  3VMG A;  5C4J I;  1USP A;  4BBR I;  1TWC I;  1R9T I;  1Y1V I;  2DE7 A;  1TWG I;  2R92 I;  2JS4 A;  3CQZ I;  4BXX I;  4NBE A;  2PK7 A;  3HOV I;  4NBC A;  4NB8 A;  3H3V J;  4XX2 A;  3GKQ A;  4A3J I;  3GTM I;  2KPI A;  1RO4 A;  2NVQ I;  4MH4 A;  2HF1 A;  4Y52 I;  1I50 I;  2DE5 A;  2VUM I;  4BBS I;  4A3E I;  1RLY A;  2DE6 A;  3K7A I; 
#chains in the Genus database with same CATH topology
 3VMH A;  3RZO I;  3F3P C;  2H85 A;  3JAM b;  1QVG Z;  2RHB A;  3F3F C;  4RVF A;  2RT9 A;  1Q86 1;  3OW2 Z;  1ZB9 A;  2VF1 A;  2QRD B;  3NH8 A;  5FLM I;  4NBD A;  1JWH C;  4HH4 A;  2R6M A;  1VQO Z;  1K73 2;  1YJN 1;  1KD1 1;  1KC8 2;  1TWF I;  3GTM S;  1Q82 2;  1YJW Z;  4DQY B;  2BJO A;  4E2X A;  1YUK A;  2F4O A;  1FDO A;  1VQ8 1;  3HOX I;  1S72 1;  3VB9 A;  1VQ9 1;  1QYP A;  3NH5 A;  3CCU Z;  1YIJ Z;  2LFU A;  2JIR A;  3KIF A;  2G2K A;  2VUG A;  2AKL A;  3CCL Z;  1Y8C A;  4NB9 A;  3M3Y I;  4RVD A;  1W2B Z;  1N2F A;  4NOZ A;  3PO3 S;  2E7Z A;  3KIH A;  3NDI A;  3I55 Z;  1QXF A;  3TDH B;  1KQS Z;  4QTU A;  5D1P A;  3I56 Z;  1VQM Z;  1VQ5 1;  5T6B A;  1YHQ 1;  1K8A 1;  2IZ4 A;  3S14 I;  3CCM 1;  1ML8 A;  1VQ6 1;  3HOW I;  1VQL 1;  3CC4 1;  1I6H I;  3G71 1;  1K9M 1;  3GTQ I;  3GTJ I;  1VQ4 1;  4A3K I;  3GTO I;  4TNU A;  4NBA A;  3G4S Z;  5AN9 F;  1QVF Z;  4BY1 I;  5FLX b;  2LIY A;  3CC7 1;  3JAM f;  3RZD I;  2JA5 I;  3VMG A;  3CCV Z;  4BBR I;  2JIO A;  2IV2 X;  2QA4 1;  2QRE B;  2JS4 A;  2V45 A;  3T4N B;  3G6E Z;  1YIT Z;  4MXU A;  1YI2 Z;  2VPW A;  3GKQ A;  3GTM I;  4MH4 A;  1VQK 1;  2LEX A;  2QKD A;  4BBS I;  3CCR Z;  1K8A 2;  3CME 1;  1RLY A;  1NJI 1;  5IP9 I;  1DL6 A;  1WW9 A;  1K9M 2;  2OZK A;  3TE5 B;  3I4N I;  1NP6 A;  3HOU I;  1S7M A;  3HOY I;  1Y1W I;  4RS4 A;  2YAD A;  3S1R I;  2B63 I;  3J81 b;  3CPW Z;  3D6W A;  4BY7 I;  3ESW A;  3PO3 I;  2GTI A;  1TWA I;  3HKZ A;  2QEX 1;  2R93 I;  2RBL A;  4AYB A;  2E2J I;  5T67 A;  3CCS Z;  2E2I I;  4A3B I;  1Z01 A;  4MD7 A;  1RNI A;  2JIM A;  3S1Q I;  1Q81 2;  2JA7 I;  2AYD A;  3CCQ 1;  4MD9 A;  3CXC Y;  3CD6 Z;  2V3V A;  5FLX f;  2OTJ Z;  2VPY A;  1M1K 2;  3LUS A;  2Q51 A;  5A2Q b;  1SFO I;  1YHQ Z;  2I3C A;  1VQP 1;  3S1N I;  3GTL I;  1P9N A;  2JA6 I;  1PFT A;  2QLV B;  1VQL Z;  2K3R A;  3CC2 Z;  4DGL A;  4MON A;  1YUA A;  3CCE Z;  3GCF A;  2W04 A;  1VQ7 1;  3MZK B;  3CMA 1;  1X3W A;  1Q86 2;  1TFI A;  1KRL A;  2NAP A;  4NH1 C;  4A3I I;  1ZH1 A;  1TWC I;  1KD1 2;  1R9T I;  1TWG I;  3MON A;  2PK7 A;  2V8J A;  4NBC A;  3J81 f;  3CCJ Z;  2WB1 A;  3NFZ A;  1FDI A;  2OTL Z;  1VQO 1;  2VUM I;  1RO2 A;  3BG0 B;  4A3E I;  3IFU A;  2DE6 A;  3GTP I;  1YJW 1;  5IP7 I;  2J6A A;  3EER A;  2JUB A;  1YJ9 Z;  2NVX I;  4RVH A;  4A93 I;  3IR7 A;  1JJ2 Y;  3P5J B;  4MD8 A;  1VQN Z;  5LL6 f;  4NFR A;  3CCU 1;  1YIJ 1;  3J7A 4;  5IT9 b;  3CCL 1;  2P3Y A;  4E33 A;  3S2D I;  4EWC A;  1Q7Y 1;  5A2Q f;  2JIQ A;  4X6A I;  1RO0 A;  5C4X I;  3I55 1;  4NBB A;  2NVT I;  5D1O B;  3H0G I;  4DK1 A;  3PO2 I;  3GTG I;  2K5R A;  3I56 1;  1VQM 1;  4E2W A;  3S16 I;  2WAQ A;  3HOZ I;  4A3D I;  3S1M I;  2V8I A;  1YJN Z;  3VMI A;  3D9X A;  2M6N A;  3G4S 1;  2YU9 I;  4NBH A;  4QTT A;  1LQL A;  1VQ8 Z;  4E2Z A;  4CL1 A;  1K73 1;  1QVG Y;  2ZAE B;  3FQM A;  1S72 Z;  2E2H I;  1VQ9 Z;  2F4M A;  2KI7 B;  3CCV 1;  3OW2 Y;  2QR1 B;  1Q7Y 2;  1VQ7 Z;  3G6E 1;  1L1O C;  1NJI 2;  5C44 I;  1YIT 1;  1YI2 1;  3I4M I;  4Y7N I;  2JR6 A;  3GTK I;  2JIP A;  4A3F I;  3CCR 1;  2IZ3 A;  5C3E I;  3IX0 A;  4A3C I;  4E32 A;  1VQ5 Z;  5C4J I;  3CCM Z;  3IF8 A;  1VQ6 Z;  2DE7 A;  2PMZ A;  4BXX I;  3CC4 Z;  1N8R 1;  2GTH A;  3G71 Z;  3FQQ A;  4XX2 A;  1VQ4 Z;  5IT9 f;  2KPI A;  2HF1 A;  4Y52 I;  1I50 I;  1W2B Y;  5D1O A;  4E2Y A;  3CXC Z;  3NH4 A;  3VTN A;  3D2L A;  3BG1 B;  2O4H A;  3CC7 Z;  2RPR A;  2Q4Z A;  2W03 A;  1KQS Y;  3MZL B;  2V8K A;  3CCS 1;  2QA4 Z;  3J80 b;  1X0T A;  5CM2 M;  3S2H I;  4MRI A;  2VPZ A;  4A3G I;  1Y1V S;  1USP B;  2VPX A;  1VQK Z;  1ZB8 A;  3CME Z;  1QVF Y;  3CD6 1;  1NUI A;  1N8R 2;  2OTJ 1;  1Z03 A;  1K83 I;  1AA6 A;  2P28 A;  1WJ2 A;  3FKI I;  2QRC B;  3S15 I;  4NBG A;  1SIW A;  3CC2 1;  3I07 A;  2JNY A;  3CCE 1;  1M90 1;  3U50 C;  4HGY A;  1TWH I;  4E30 A;  2QEX Z;  2Y0S A;  3EED A;  2E9H A;  3M4O I;  4RV9 A;  2JA8 I;  1I3Q I;  5T64 A;  2M48 A;  4A3M I;  1WCM I;  4S1T A;  2GU2 A;  1JJ2 Z;  3CPW Y;  2R7Z I;  3CCJ 1;  1X3Z A;  3CCQ Z;  2RIQ A;  2NVY I;  2OTL 1;  1Q16 A;  2HU9 A;  1QF8 A;  4A3L I;  4NBF A;  1Z02 A;  3Q87 A;  1WII A;  1Q81 1;  2O53 A;  3S17 I;  1VLA A;  1VQP Z;  2PM9 A;  1KC8 1;  1M90 2;  3J80 f;  1YJ9 1;  1RQF A;  1USP A;  1Y1V I;  2JMO A;  2OOX B;  2R92 I;  3CQZ I;  1Q82 1;  3NDJ A;  1M1K 1;  4NBE A;  3HOV I;  4NB8 A;  1VQN 1;  3QWU A;  4E31 A;  3H3V J;  4A3J I;  2EGT A;  3CMA Z;  1RO4 A;  2NVQ I;  1WZN A;  4HGZ A;  2DE5 A;  2OOY B;  4RVG A;  3K7A I; 
#chains in the Genus database with same CATH homology
 3VMH A;  3RZO I;  3F3P C;  2H85 A;  3JAM b;  1QVG Z;  2RHB A;  3F3F C;  4RVF A;  2RT9 A;  1Q86 1;  3OW2 Z;  1ZB9 A;  2VF1 A;  2QRD B;  3NH8 A;  5FLM I;  4NBD A;  1JWH C;  4HH4 A;  2R6M A;  1VQO Z;  1K73 2;  1YJN 1;  1KD1 1;  1KC8 2;  1TWF I;  3GTM S;  1Q82 2;  1YJW Z;  4DQY B;  2BJO A;  4E2X A;  1YUK A;  2F4O A;  1VQ8 1;  3HOX I;  1S72 1;  3VB9 A;  1VQ9 1;  1QYP A;  3NH5 A;  3CCU Z;  1YIJ Z;  2LFU A;  3KIF A;  2G2K A;  2VUG A;  2AKL A;  3CCL Z;  4NB9 A;  3M3Y I;  4RVD A;  1W2B Z;  1N2F A;  4NOZ A;  3PO3 S;  3KIH A;  3NDI A;  3I55 Z;  3TDH B;  1KQS Z;  4QTU A;  5D1P A;  3I56 Z;  1VQM Z;  1VQ5 1;  5T6B A;  1YHQ 1;  1K8A 1;  2IZ4 A;  3S14 I;  3CCM 1;  1ML8 A;  1VQ6 1;  3HOW I;  1VQL 1;  3CC4 1;  1I6H I;  3G71 1;  1K9M 1;  3GTQ I;  3GTJ I;  1VQ4 1;  4A3K I;  3GTO I;  4TNU A;  4NBA A;  3G4S Z;  5AN9 F;  1QVF Z;  4BY1 I;  5FLX b;  2LIY A;  3CC7 1;  3JAM f;  3RZD I;  2JA5 I;  3VMG A;  3CCV Z;  4BBR I;  2QA4 1;  2QRE B;  2JS4 A;  3T4N B;  3G6E Z;  1YIT Z;  4MXU A;  1YI2 Z;  3GKQ A;  3GTM I;  4MH4 A;  1VQK 1;  2QKD A;  4BBS I;  3CCR Z;  1K8A 2;  3CME 1;  1RLY A;  1NJI 1;  5IP9 I;  1DL6 A;  1WW9 A;  1K9M 2;  2OZK A;  3TE5 B;  3I4N I;  1NP6 A;  3HOU I;  1S7M A;  3HOY I;  1Y1W I;  4RS4 A;  2YAD A;  3S1R I;  2B63 I;  3J81 b;  3CPW Z;  3D6W A;  4BY7 I;  3ESW A;  3PO3 I;  2GTI A;  1TWA I;  3HKZ A;  2QEX 1;  2R93 I;  2RBL A;  4AYB A;  2E2J I;  5T67 A;  3CCS Z;  2E2I I;  4A3B I;  1Z01 A;  4MD7 A;  1RNI A;  3S1Q I;  1Q81 2;  2JA7 I;  3CCQ 1;  4MD9 A;  3CXC Y;  3CD6 Z;  5FLX f;  2OTJ Z;  1M1K 2;  3LUS A;  2Q51 A;  5A2Q b;  1SFO I;  1YHQ Z;  2I3C A;  1VQP 1;  3S1N I;  3GTL I;  1P9N A;  2JA6 I;  1PFT A;  2QLV B;  1VQL Z;  2K3R A;  3CC2 Z;  4DGL A;  4MON A;  1YUA A;  3CCE Z;  3GCF A;  2W04 A;  1VQ7 1;  3MZK B;  3CMA 1;  1X3W A;  1Q86 2;  1TFI A;  1KRL A;  4NH1 C;  4A3I I;  1ZH1 A;  1TWC I;  1KD1 2;  1R9T I;  1TWG I;  3MON A;  2PK7 A;  2V8J A;  4NBC A;  3J81 f;  2WB1 A;  3NFZ A;  3CCJ Z;  2OTL Z;  1VQO 1;  2VUM I;  1RO2 A;  4A3E I;  3BG0 B;  3IFU A;  2DE6 A;  3GTP I;  1YJW 1;  5IP7 I;  2J6A A;  3EER A;  2JUB A;  1YJ9 Z;  2NVX I;  4RVH A;  4A93 I;  1JJ2 Y;  3P5J B;  4MD8 A;  1VQN Z;  5LL6 f;  4NFR A;  3CCU 1;  1YIJ 1;  3J7A 4;  5IT9 b;  3CCL 1;  2P3Y A;  4E33 A;  3S2D I;  4EWC A;  1Q7Y 1;  5A2Q f;  4X6A I;  1RO0 A;  5C4X I;  3I55 1;  4NBB A;  2NVT I;  5D1O B;  3H0G I;  4DK1 A;  3PO2 I;  3GTG I;  2K5R A;  3I56 1;  1VQM 1;  4E2W A;  3S16 I;  2WAQ A;  3HOZ I;  4A3D I;  3S1M I;  2V8I A;  1YJN Z;  3VMI A;  3D9X A;  2M6N A;  3G4S 1;  2YU9 I;  4NBH A;  4QTT A;  1LQL A;  1VQ8 Z;  4E2Z A;  4CL1 A;  1K73 1;  1QVG Y;  2ZAE B;  3FQM A;  1S72 Z;  2E2H I;  1VQ9 Z;  2F4M A;  2KI7 B;  3CCV 1;  3OW2 Y;  2QR1 B;  1Q7Y 2;  1VQ7 Z;  3G6E 1;  1L1O C;  1NJI 2;  5C44 I;  1YIT 1;  1YI2 1;  3I4M I;  4Y7N I;  2JR6 A;  3GTK I;  4A3F I;  3CCR 1;  2IZ3 A;  5C3E I;  3IX0 A;  4A3C I;  4E32 A;  1VQ5 Z;  5C4J I;  3CCM Z;  3IF8 A;  1VQ6 Z;  2DE7 A;  2PMZ A;  4BXX I;  3CC4 Z;  1N8R 1;  2GTH A;  3G71 Z;  3FQQ A;  4XX2 A;  1VQ4 Z;  5IT9 f;  2KPI A;  2HF1 A;  4Y52 I;  1I50 I;  1W2B Y;  5D1O A;  4E2Y A;  3CXC Z;  3NH4 A;  3VTN A;  3BG1 B;  2O4H A;  3CC7 Z;  2RPR A;  2Q4Z A;  2W03 A;  1KQS Y;  3MZL B;  2V8K A;  3CCS 1;  2QA4 Z;  3J80 b;  1X0T A;  5CM2 M;  3S2H I;  4MRI A;  4A3G I;  1Y1V S;  1USP B;  1VQK Z;  1ZB8 A;  3CME Z;  1QVF Y;  3CD6 1;  1NUI A;  1N8R 2;  2OTJ 1;  1Z03 A;  1K83 I;  2P28 A;  3FKI I;  2QRC B;  3S15 I;  4NBG A;  3CC2 1;  3I07 A;  2JNY A;  3CCE 1;  1M90 1;  3U50 C;  4HGY A;  1TWH I;  4E30 A;  2QEX Z;  2Y0S A;  3EED A;  2E9H A;  3M4O I;  4RV9 A;  2JA8 I;  1I3Q I;  5T64 A;  2M48 A;  4A3M I;  1WCM I;  4S1T A;  2GU2 A;  1JJ2 Z;  3CPW Y;  2R7Z I;  3CCJ 1;  1X3Z A;  3CCQ Z;  2RIQ A;  2NVY I;  2OTL 1;  2HU9 A;  1QF8 A;  4A3L I;  4NBF A;  1Z02 A;  3Q87 A;  1WII A;  1Q81 1;  2O53 A;  3S17 I;  1VLA A;  1VQP Z;  2PM9 A;  1KC8 1;  1M90 2;  3J80 f;  1YJ9 1;  1RQF A;  1USP A;  1Y1V I;  2JMO A;  2OOX B;  2R92 I;  3CQZ I;  1Q82 1;  3NDJ A;  1M1K 1;  4NBE A;  3HOV I;  4NB8 A;  1VQN 1;  3QWU A;  4E31 A;  3H3V J;  4A3J I;  2EGT A;  3CMA Z;  1RO4 A;  2NVQ I;  4HGZ A;  2DE5 A;  2OOY B;  4RVG A;  3K7A I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...