3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
4NBFA 3ESWA 4QTUA 5C44I 3HOZI 3I4NI 4NOZA 3U50C 3S2HI 4A3FI 3EERA 4Y7NI 4A3LI 3GTQI 3HOXI 3PO2I 2R7ZI 2VUMI 4A3CI 4A93I 4NBAA 3GTOI 3HOVI 2DE7A 5C4XI 4BBRI 1X3ZA 1I50I 3GKQA 4NB8A 4NBDA 3VMHA 3RZDI 4QTTA 2PK7A 2NVQI 1NUIA 2JNYA 3D6WA 1Y1VS 2E2HI 5C4JI 1N2FA 4BXXI 5FLMI 3S16I 3Q87A 1WCMI 1TWFI 1I6HI 4NBHA 3S1MI 2AKLA 3H3VJ 3GTLI 3PO3I 1USPB 1QYPA 3GTGI 3S1RI 1ML8A 3I07A 1LQLA 2KPIA 2E2II 4NBCA 2R93I 3M4OI 4NBEA 4A3MI 1USPA 3S14I 3PO3S 4Y52I 4XX2A 1WW9A 4A3GI 3HOUI 3I4MI 3S1NI 1TWAI 4A3EI 3HOYI 3GTJI 2F4MA 5C3EI 2DE6A 4NBBA 1Y1VI 2HF1A 3CQZI 3RZOI 1Y1WI 3S2DI 2JA5I 1VLAA 1RO4A 4A3JI 2JA7I 3GTPI 4BBSI 4A3KI 1RLYA 1L1OC 3S1QI 2JA8I 3S15I 1I3QI 2BJOA 2E2JI 3GTMI 2JR6A 5IP9I 2JA6I 3M3YI 1PFTA 3VMGA 1TWHI 2J6AA 3K7AI 1X3WA 3S17I 2NVYI 5CM2M 4BY7I 2F4OA 1R9TI 1TWGI 3H0GI 4A3II 4BY1I 3GTKI 2NVXI 1ZB8A 2JS4A 3HOWI 3GTMS 4A3BI 1TFIA 4MH4A 2R92I 2B63I 3GCFA 3LUSA 2DE5A 2YU9I 3VB9A 3FKII 1TWCI 1ZB9A 1YUAA 4A3DI 3VMIA 5IP7I 2P3YA 4NB9A 4NBGA 2RBLA 1SFOI 1K83I 4X6AI 2K5RA 1DL6A 2NVTI
chains in the Genus database with same CATH superfamily
4NBFA 3ESWA 1Q7Y1 2P28A 5C44I 3F3FC 1QVFZ 2QA41 1NJI2 4RVDA 3HOXI 3PO2I 2R7ZI 2LEXA 1VQ41 3GTOI 1SIWA 3HOVI 1P9NA 2IZ4A 1Q812 3I561 1X3ZA 2O53A 3GKQA 4NBDA 3CCMZ 3CCQ1 4QTTA 3CMEZ 1YIT1 3EEDA 4MD7A 1W2BZ 1Q7Y2 3D2LA 2ZAEB 2JNYA 3D6WA 1NJI1 1Q811 1K9M2 5FLMI 3S16I 3KIFA 4TNUA 2JMOA 4E30A 1VQ61 3CCS1 3S1MI 5D1PA 1K732 2Q51A 5A2Qb 1VQNZ 1VQMZ 4NBEA 4EWCA 1KD12 4E32A 1USPA 1Z03A 4S1TA 4AYBA 2JIMA 1TWAI 2WB1A 4E31A 4E2ZA 3NH8A 2HU9A 2O4HA 2HF1A 3G4S1 2RIQA 2IZ3A 1YI2Z 1VQO1 3S2DI 2JA5I 2JIQA 3GTPI 1VQ9Z 2JA8I 3CCM1 3JAMb 2E2JI 1VQ6Z 1S72Z 2V3VA 5IT9f 1PFTA 2J6AA 3K7AI 1VQN1 5CM2M 1R9TI 1TWGI 3MZLB 1VQOZ 4BY1I 3GTKI 2E9HA 1VQLZ 2OTL1 3JAMf 2YU9I 2V8JA 2QEX1 3HKZA 1YUAA 2KI7B 2JIRA 1FDOA 1SFOI 1VQ4Z 1DL6A 3J80b 2NVTI 3U50C 2WAQA 1NP6A 5D1OA 4DQYB 4Y7NI 4A3LI 2V45A 2RT9A 1N8R2 4A3CI 4A93I 4NBAA 4DK1A 3G4SZ 2QKDA 3OW2Z 1I50I 2AYDA 1Q861 4NB8A 4RS4A 3CC7Z 2PK7A 5T67A 1K8A2 1Y1VS 5C4JI 1N2FA 4BXXI 2Y0SA 2OTJZ 2OOYB 3QWUA 1S7MA 1WCMI 2JUBA 1KD11 3P5JB 3CCQZ 1I6HI 3G71Z 2AKLA 3NFZA 1RQFA 3GTGI 1ML8A 2E7ZA 2KPIA 1Q821 1KC82 3I55Z 2LIYA 1YHQZ 3S14I 3PO3S 4Y52I 4MD9A 4E2WA 4MD8A 3CXCY 1WW9A 3HOUI 3I4MI 4A3EI 2F4MA 1QVGY 3CXCZ 4NBBA 1Y1VI 2V8KA 3NDJA 1YJN1 3MZKB 1RO4A 3NDIA 4E2YA 3MONA 5FLXf 4BBSI 4A3KI 1RLYA 3GTMI 2W03A 2PM9A 2JA6I 2EGTA 1TWHI 2M48A 1W2BY 3H0GI 1VQ91 1ZB8A 1TFIA 4MH4A 2G2KA 2VPZA 3GCFA 3VB9A 2QEXZ 3VMIA 4NBGA 3I551 3CCRZ 2K5RA 4DGLA 2GU2A 3S2HI 4A3FI 3EERA 2VPWA 3GTQI 4MXUA 1RO0A 5AN9F 4BBRI 2R6MA 2K3RA 1VQ71 1Z01A 3RZDI 1YJWZ 1ZH1A 2NVQI 3CD6Z 3J7A4 2QA4Z 3CCUZ 1Y8CA 1VQK1 2QRCB 1YHQ1 2IV2X 1Z02A 3Q87A 3TE5B 3CD61 2VPXA 4NBHA 3H3VJ 3GTLI 3IF8A 1QYPA 1RO2A 3S1RI 1LQLA 1M1K1 2R93I 3J81b 4A3MI 2VPYA 2RPRA 1S721 3CCR1 1YJ91 3CPWZ 2RHBA 3IFUA 3HOYI 1FDIA 1M901 3IX0A 1Y1WI 3CMAZ 1VLAA 4MRIA 1QXFA 1JWHC 3CCV1 2M6NA 3G6E1 3S1QI 1VQ7Z 1X0TA 3S15I 1K8A1 3KIHA 5IP9I 1K9M1 1JJ2Z 4HGZA 1YIJ1 3M3YI 1YJNZ 4RVFA 4RVHA 3VMGA 2GTHA 3CCE1 5D1OB 1VQ5Z 3S17I 2NVYI 2QRDB 3CC2Z 4A3II 2JIPA 3NH5A 2JS4A 3F3PC 3HOWI 4A3BI 1N8R1 2R92I 2DE5A 3FKII 1TWCI 3CC21 4A3DI 5IP7I 4NB9A 3T4NB 1QF8A 2RBLA 2JIOA 4X6AI 3CC41 2W04A 2LFUA 4QTUA 5T64A 3HOZI 1YUKA 3I4NI 4NOZA 3TDHB 1YJW1 3CCJZ 2Q4ZA 1VQ81 5IT9b 2NAPA 1Q16A 2QLVB 2VUMI 4HH4A 3J80f 3CCU1 2DE7A 1YIJZ 5C4XI 3VMHA 4E2XA 3FQQA 3OW2Y 2GTIA 4MONA 2VF1A 1NUIA 3D9XA 2E2HI 3NH4A 1VQ8Z 1VQKZ 3CCEZ 2QR1B 3CCLZ 1QVFY 1TWFI 1YJ9Z 2V8IA 2H85A 5A2Qf 3CCSZ 3PO3I 2PMZA 1USPB 3CME1 1M902 1KQSY 4NH1C 2VUGA 1K731 3I07A 2E2II 3J81f 4NBCA 1KQSZ 5LL6f 3M4OI 1KC81 3CPWY 1YI21 1WJ2A 3CC71 4XX2A 4A3GI 3BG1B 3G6EZ 3CCL1 5FLXb 3S1NI 2OTJ1 3GTJI 3VTNA 1WZNA 5C3EI 2DE6A 4E33A 1Q822 4RVGA 3CQZI 3RZOI 3G711 3CMA1 3I56Z 4RV9A 2OOXB 3CCVZ 1VQPZ 4A3JI 2JA7I 1YITZ 1L1OC 1Q862 1JJ2Y 4HGYA 1I3QI 2BJOA 3BG0B 2OTLZ 2JR6A 1KRLA 1RNIA 4CL1A 5T6BA 1WIIA 3IR7A 1VQ51 1X3WA 4BY7I 2OZKA 2F4OA 2YADA 1AA6A 2NVXI 1VQL1 3GTMS 3FQMA 1M1K2 2QREB 2B63I 2I3CA 3LUSA 3CCJ1 1VQP1 1VQM1 1ZB9A 4NFRA 2P3YA 1K83I 3CC4Z 1QVGZ
chains in the Genus database with same CATH topology
4NBFA 3ESWA 1Q7Y1 2P28A 5C44I 3F3FC 1QVFZ 2QA41 1NJI2 4RVDA 3HOXI 3PO2I 2R7ZI 1VQ41 3GTOI 3HOVI 1P9NA 2IZ4A 1Q812 3I561 1X3ZA 2O53A 3GKQA 4NBDA 3CCMZ 3CCQ1 4QTTA 3CMEZ 1YIT1 3EEDA 4MD7A 1W2BZ 1Q7Y2 2ZAEB 2JNYA 3D6WA 1NJI1 1Q811 1K9M2 5FLMI 3S16I 3KIFA 4TNUA 2JMOA 4E30A 1VQ61 3CCS1 3S1MI 5D1PA 1K732 2Q51A 5A2Qb 1VQNZ 1VQMZ 4NBEA 4EWCA 1KD12 4E32A 1USPA 1Z03A 4S1TA 4AYBA 1TWAI 2WB1A 4E31A 4E2ZA 3NH8A 2HU9A 2O4HA 2HF1A 3G4S1 2RIQA 2IZ3A 1YI2Z 1VQO1 3S2DI 2JA5I 3GTPI 1VQ9Z 2JA8I 3CCM1 3JAMb 2E2JI 1VQ6Z 1S72Z 5IT9f 1PFTA 2J6AA 3K7AI 1VQN1 5CM2M 1R9TI 1TWGI 3MZLB 1VQOZ 4BY1I 3GTKI 2E9HA 1VQLZ 2OTL1 3JAMf 2YU9I 2V8JA 2QEX1 3HKZA 1YUAA 2KI7B 1SFOI 1VQ4Z 1DL6A 3J80b 2NVTI 3U50C 2WAQA 1NP6A 5D1OA 4DQYB 4Y7NI 4A3LI 2RT9A 1N8R2 4A3CI 4A93I 4NBAA 4DK1A 3G4SZ 2QKDA 3OW2Z 1I50I 1Q861 4NB8A 4RS4A 3CC7Z 2PK7A 5T67A 1K8A2 1Y1VS 5C4JI 1N2FA 4BXXI 2Y0SA 2OTJZ 2OOYB 3QWUA 1S7MA 1WCMI 2JUBA 1KD11 3P5JB 3CCQZ 1I6HI 3G71Z 2AKLA 3NFZA 1RQFA 3GTGI 1ML8A 2KPIA 1Q821 1KC82 3I55Z 2LIYA 1YHQZ 3S14I 3PO3S 4Y52I 4MD9A 4E2WA 4MD8A 3CXCY 1WW9A 3HOUI 3I4MI 4A3EI 2F4MA 1QVGY 3CXCZ 4NBBA 1Y1VI 2V8KA 3NDJA 1YJN1 3MZKB 1RO4A 3NDIA 4E2YA 3MONA 5FLXf 4BBSI 4A3KI 1RLYA 3GTMI 2W03A 2PM9A 2JA6I 2EGTA 1TWHI 2M48A 1W2BY 3H0GI 1VQ91 1ZB8A 1TFIA 4MH4A 2G2KA 3GCFA 3VB9A 2QEXZ 3VMIA 4NBGA 3I551 3CCRZ 2K5RA 4DGLA 2GU2A 3S2HI 4A3FI 3EERA 3GTQI 4MXUA 1RO0A 5AN9F 4BBRI 2R6MA 2K3RA 1VQ71 1Z01A 3RZDI 1YJWZ 1ZH1A 2NVQI 3CD6Z 3J7A4 2QA4Z 3CCUZ 1VQK1 2QRCB 1YHQ1 1Z02A 3Q87A 3TE5B 3CD61 4NBHA 3H3VJ 3GTLI 3IF8A 1QYPA 1RO2A 3S1RI 1LQLA 1M1K1 2R93I 3J81b 4A3MI 2RPRA 1S721 3CCR1 1YJ91 3CPWZ 2RHBA 3IFUA 3HOYI 1M901 3IX0A 1Y1WI 3CMAZ 1VLAA 4MRIA 1JWHC 3CCV1 2M6NA 3G6E1 3S1QI 1VQ7Z 1X0TA 3S15I 1K8A1 3KIHA 5IP9I 1K9M1 1JJ2Z 4HGZA 1YIJ1 3M3YI 1YJNZ 4RVFA 4RVHA 3VMGA 2GTHA 3CCE1 5D1OB 1VQ5Z 3S17I 2NVYI 2QRDB 3CC2Z 4A3II 3NH5A 2JS4A 3F3PC 3HOWI 4A3BI 1N8R1 2R92I 2DE5A 3FKII 1TWCI 3CC21 4A3DI 5IP7I 4NB9A 3T4NB 1QF8A 2RBLA 4X6AI 3CC41 2W04A 2LFUA 4QTUA 5T64A 3HOZI 1YUKA 3I4NI 4NOZA 3TDHB 1YJW1 3CCJZ 2Q4ZA 1VQ81 5IT9b 2QLVB 2VUMI 4HH4A 3J80f 3CCU1 2DE7A 1YIJZ 5C4XI 3VMHA 4E2XA 3FQQA 3OW2Y 2GTIA 4MONA 2VF1A 1NUIA 3D9XA 2E2HI 3NH4A 1VQ8Z 1VQKZ 3CCEZ 2QR1B 3CCLZ 1QVFY 1TWFI 1YJ9Z 2V8IA 2H85A 5A2Qf 3CCSZ 3PO3I 2PMZA 1USPB 3CME1 1M902 1KQSY 4NH1C 2VUGA 1K731 3I07A 2E2II 3J81f 4NBCA 1KQSZ 5LL6f 3M4OI 1KC81 3CPWY 1YI21 3CC71 4XX2A 4A3GI 3BG1B 3G6EZ 3CCL1 5FLXb 3S1NI 2OTJ1 3GTJI 3VTNA 5C3EI 2DE6A 4E33A 1Q822 4RVGA 3CQZI 3RZOI 3G711 3CMA1 3I56Z 4RV9A 2OOXB 3CCVZ 1VQPZ 4A3JI 2JA7I 1YITZ 1L1OC 1Q862 1JJ2Y 4HGYA 1I3QI 2BJOA 3BG0B 2OTLZ 2JR6A 1KRLA 1RNIA 4CL1A 5T6BA 1WIIA 1VQ51 1X3WA 4BY7I 2OZKA 2F4OA 2YADA 2NVXI 1VQL1 3GTMS 3FQMA 1M1K2 2QREB 2B63I 2I3CA 3LUSA 3CCJ1 1VQP1 1VQM1 1ZB9A 4NFRA 2P3YA 1K83I 3CC4Z 1QVGZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBF A;  3ESW A;  4QTU A;  5C44 I;  3HOZ I;  3I4N I;  4NOZ A;  3U50 C;  3S2H I;  4A3F I;  3EER A;  4Y7N I;  4A3L I;  3GTQ I;  3HOX I;  3PO2 I;  2R7Z I;  2VUM I;  4A3C I;  4A93 I;  4NBA A;  3GTO I;  3HOV I;  2DE7 A;  5C4X I;  4BBR I;  1X3Z A;  1I50 I;  3GKQ A;  4NB8 A;  4NBD A;  3VMH A;  3RZD I;  4QTT A;  2PK7 A;  2NVQ I;  1NUI A;  2JNY A;  3D6W A;  1Y1V S;  2E2H I;  5C4J I;  1N2F A;  4BXX I;  5FLM I;  3S16 I;  3Q87 A;  1WCM I;  1TWF I;  1I6H I;  4NBH A;  3S1M I;  2AKL A;  3H3V J;  3GTL I;  3PO3 I;  1USP B;  1QYP A;  3GTG I;  3S1R I;  1ML8 A;  3I07 A;  1LQL A;  2KPI A;  2E2I I;  4NBC A;  2R93 I;  3M4O I;  4NBE A;  4A3M I;  1USP A;  3S14 I;  3PO3 S;  4Y52 I;  4XX2 A;  1WW9 A;  4A3G I;  3HOU I;  3I4M I;  3S1N I;  1TWA I;  4A3E I;  3HOY I;  3GTJ I;  2F4M A;  5C3E I;  2DE6 A;  4NBB A;  1Y1V I;  2HF1 A;  3CQZ I;  3RZO I;  1Y1W I;  3S2D I;  2JA5 I;  1VLA A;  1RO4 A;  4A3J I;  2JA7 I;  3GTP I;  4BBS I;  4A3K I;  1RLY A;  1L1O C;  3S1Q I;  2JA8 I;  3S15 I;  1I3Q I;  2BJO A;  2E2J I;  3GTM I;  2JR6 A;  5IP9 I;  2JA6 I;  3M3Y I;  1PFT A;  3VMG A;  1TWH I;  2J6A A;  3K7A I;  1X3W A;  3S17 I;  2NVY I;  5CM2 M;  4BY7 I;  2F4O A;  1R9T I;  1TWG I;  3H0G I;  4A3I I;  4BY1 I;  3GTK I;  2NVX I;  1ZB8 A;  2JS4 A;  3HOW I;  3GTM S;  4A3B I;  1TFI A;  4MH4 A;  2R92 I;  2B63 I;  3GCF A;  3LUS A;  2DE5 A;  2YU9 I;  3VB9 A;  3FKI I;  1TWC I;  1ZB9 A;  1YUA A;  4A3D I;  3VMI A;  5IP7 I;  2P3Y A;  4NB9 A;  4NBG A;  2RBL A;  1SFO I;  1K83 I;  4X6A I;  2K5R A;  1DL6 A;  2NVT I; 
#chains in the Genus database with same CATH topology
 4NBF A;  3ESW A;  1Q7Y 1;  2P28 A;  5C44 I;  3F3F C;  1QVF Z;  2QA4 1;  1NJI 2;  4RVD A;  3HOX I;  3PO2 I;  2R7Z I;  2LEX A;  1VQ4 1;  3GTO I;  1SIW A;  3HOV I;  1P9N A;  2IZ4 A;  1Q81 2;  3I56 1;  1X3Z A;  2O53 A;  3GKQ A;  4NBD A;  3CCM Z;  3CCQ 1;  4QTT A;  3CME Z;  1YIT 1;  3EED A;  4MD7 A;  1W2B Z;  1Q7Y 2;  3D2L A;  2ZAE B;  2JNY A;  3D6W A;  1NJI 1;  1Q81 1;  1K9M 2;  5FLM I;  3S16 I;  3KIF A;  4TNU A;  2JMO A;  4E30 A;  1VQ6 1;  3CCS 1;  3S1M I;  5D1P A;  1K73 2;  2Q51 A;  5A2Q b;  1VQN Z;  1VQM Z;  4NBE A;  4EWC A;  1KD1 2;  4E32 A;  1USP A;  1Z03 A;  4S1T A;  4AYB A;  2JIM A;  1TWA I;  2WB1 A;  4E31 A;  4E2Z A;  3NH8 A;  2HU9 A;  2O4H A;  2HF1 A;  3G4S 1;  2RIQ A;  2IZ3 A;  1YI2 Z;  1VQO 1;  3S2D I;  2JA5 I;  2JIQ A;  3GTP I;  1VQ9 Z;  2JA8 I;  3CCM 1;  3JAM b;  2E2J I;  1VQ6 Z;  1S72 Z;  2V3V A;  5IT9 f;  1PFT A;  2J6A A;  3K7A I;  1VQN 1;  5CM2 M;  1R9T I;  1TWG I;  3MZL B;  1VQO Z;  4BY1 I;  3GTK I;  2E9H A;  1VQL Z;  2OTL 1;  3JAM f;  2YU9 I;  2V8J A;  2QEX 1;  3HKZ A;  1YUA A;  2KI7 B;  2JIR A;  1FDO A;  1SFO I;  1VQ4 Z;  1DL6 A;  3J80 b;  2NVT I;  3U50 C;  2WAQ A;  1NP6 A;  5D1O A;  4DQY B;  4Y7N I;  4A3L I;  2V45 A;  2RT9 A;  1N8R 2;  4A3C I;  4A93 I;  4NBA A;  4DK1 A;  3G4S Z;  2QKD A;  3OW2 Z;  1I50 I;  2AYD A;  1Q86 1;  4NB8 A;  4RS4 A;  3CC7 Z;  2PK7 A;  5T67 A;  1K8A 2;  1Y1V S;  5C4J I;  1N2F A;  4BXX I;  2Y0S A;  2OTJ Z;  2OOY B;  3QWU A;  1S7M A;  1WCM I;  2JUB A;  1KD1 1;  3P5J B;  3CCQ Z;  1I6H I;  3G71 Z;  2AKL A;  3NFZ A;  1RQF A;  3GTG I;  1ML8 A;  2E7Z A;  2KPI A;  1Q82 1;  1KC8 2;  3I55 Z;  2LIY A;  1YHQ Z;  3S14 I;  3PO3 S;  4Y52 I;  4MD9 A;  4E2W A;  4MD8 A;  3CXC Y;  1WW9 A;  3HOU I;  3I4M I;  4A3E I;  2F4M A;  1QVG Y;  3CXC Z;  4NBB A;  1Y1V I;  2V8K A;  3NDJ A;  1YJN 1;  3MZK B;  1RO4 A;  3NDI A;  4E2Y A;  3MON A;  5FLX f;  4BBS I;  4A3K I;  1RLY A;  3GTM I;  2W03 A;  2PM9 A;  2JA6 I;  2EGT A;  1TWH I;  2M48 A;  1W2B Y;  3H0G I;  1VQ9 1;  1ZB8 A;  1TFI A;  4MH4 A;  2G2K A;  2VPZ A;  3GCF A;  3VB9 A;  2QEX Z;  3VMI A;  4NBG A;  3I55 1;  3CCR Z;  2K5R A;  4DGL A;  2GU2 A;  3S2H I;  4A3F I;  3EER A;  2VPW A;  3GTQ I;  4MXU A;  1RO0 A;  5AN9 F;  4BBR I;  2R6M A;  2K3R A;  1VQ7 1;  1Z01 A;  3RZD I;  1YJW Z;  1ZH1 A;  2NVQ I;  3CD6 Z;  3J7A 4;  2QA4 Z;  3CCU Z;  1Y8C A;  1VQK 1;  2QRC B;  1YHQ 1;  2IV2 X;  1Z02 A;  3Q87 A;  3TE5 B;  3CD6 1;  2VPX A;  4NBH A;  3H3V J;  3GTL I;  3IF8 A;  1QYP A;  1RO2 A;  3S1R I;  1LQL A;  1M1K 1;  2R93 I;  3J81 b;  4A3M I;  2VPY A;  2RPR A;  1S72 1;  3CCR 1;  1YJ9 1;  3CPW Z;  2RHB A;  3IFU A;  3HOY I;  1FDI A;  1M90 1;  3IX0 A;  1Y1W I;  3CMA Z;  1VLA A;  4MRI A;  1QXF A;  1JWH C;  3CCV 1;  2M6N A;  3G6E 1;  3S1Q I;  1VQ7 Z;  1X0T A;  3S15 I;  1K8A 1;  3KIH A;  5IP9 I;  1K9M 1;  1JJ2 Z;  4HGZ A;  1YIJ 1;  3M3Y I;  1YJN Z;  4RVF A;  4RVH A;  3VMG A;  2GTH A;  3CCE 1;  5D1O B;  1VQ5 Z;  3S17 I;  2NVY I;  2QRD B;  3CC2 Z;  4A3I I;  2JIP A;  3NH5 A;  2JS4 A;  3F3P C;  3HOW I;  4A3B I;  1N8R 1;  2R92 I;  2DE5 A;  3FKI I;  1TWC I;  3CC2 1;  4A3D I;  5IP7 I;  4NB9 A;  3T4N B;  1QF8 A;  2RBL A;  2JIO A;  4X6A I;  3CC4 1;  2W04 A;  2LFU A;  4QTU A;  5T64 A;  3HOZ I;  1YUK A;  3I4N I;  4NOZ A;  3TDH B;  1YJW 1;  3CCJ Z;  2Q4Z A;  1VQ8 1;  5IT9 b;  2NAP A;  1Q16 A;  2QLV B;  2VUM I;  4HH4 A;  3J80 f;  3CCU 1;  2DE7 A;  1YIJ Z;  5C4X I;  3VMH A;  4E2X A;  3FQQ A;  3OW2 Y;  2GTI A;  4MON A;  2VF1 A;  1NUI A;  3D9X A;  2E2H I;  3NH4 A;  1VQ8 Z;  1VQK Z;  3CCE Z;  2QR1 B;  3CCL Z;  1QVF Y;  1TWF I;  1YJ9 Z;  2V8I A;  2H85 A;  5A2Q f;  3CCS Z;  3PO3 I;  2PMZ A;  1USP B;  3CME 1;  1M90 2;  1KQS Y;  4NH1 C;  2VUG A;  1K73 1;  3I07 A;  2E2I I;  3J81 f;  4NBC A;  1KQS Z;  5LL6 f;  3M4O I;  1KC8 1;  3CPW Y;  1YI2 1;  1WJ2 A;  3CC7 1;  4XX2 A;  4A3G I;  3BG1 B;  3G6E Z;  3CCL 1;  5FLX b;  3S1N I;  2OTJ 1;  3GTJ I;  3VTN A;  1WZN A;  5C3E I;  2DE6 A;  4E33 A;  1Q82 2;  4RVG A;  3CQZ I;  3RZO I;  3G71 1;  3CMA 1;  3I56 Z;  4RV9 A;  2OOX B;  3CCV Z;  1VQP Z;  4A3J I;  2JA7 I;  1YIT Z;  1L1O C;  1Q86 2;  1JJ2 Y;  4HGY A;  1I3Q I;  2BJO A;  3BG0 B;  2OTL Z;  2JR6 A;  1KRL A;  1RNI A;  4CL1 A;  5T6B A;  1WII A;  3IR7 A;  1VQ5 1;  1X3W A;  4BY7 I;  2OZK A;  2F4O A;  2YAD A;  1AA6 A;  2NVX I;  1VQL 1;  3GTM S;  3FQM A;  1M1K 2;  2QRE B;  2B63 I;  2I3C A;  3LUS A;  3CCJ 1;  1VQP 1;  1VQM 1;  1ZB9 A;  4NFR A;  2P3Y A;  1K83 I;  3CC4 Z;  1QVG Z; 
#chains in the Genus database with same CATH homology
 4NBF A;  3ESW A;  1Q7Y 1;  2P28 A;  5C44 I;  3F3F C;  1QVF Z;  2QA4 1;  1NJI 2;  4RVD A;  3HOX I;  3PO2 I;  2R7Z I;  1VQ4 1;  3GTO I;  3HOV I;  1P9N A;  2IZ4 A;  1Q81 2;  3I56 1;  1X3Z A;  2O53 A;  3GKQ A;  4NBD A;  3CCM Z;  3CCQ 1;  4QTT A;  3CME Z;  1YIT 1;  3EED A;  4MD7 A;  1W2B Z;  1Q7Y 2;  2ZAE B;  2JNY A;  3D6W A;  1NJI 1;  1Q81 1;  1K9M 2;  5FLM I;  3S16 I;  3KIF A;  4TNU A;  2JMO A;  4E30 A;  1VQ6 1;  3CCS 1;  3S1M I;  5D1P A;  1K73 2;  2Q51 A;  5A2Q b;  1VQN Z;  1VQM Z;  4NBE A;  4EWC A;  1KD1 2;  4E32 A;  1USP A;  1Z03 A;  4S1T A;  4AYB A;  1TWA I;  2WB1 A;  4E31 A;  4E2Z A;  3NH8 A;  2HU9 A;  2O4H A;  2HF1 A;  3G4S 1;  2RIQ A;  2IZ3 A;  1YI2 Z;  1VQO 1;  3S2D I;  2JA5 I;  3GTP I;  1VQ9 Z;  2JA8 I;  3CCM 1;  3JAM b;  2E2J I;  1VQ6 Z;  1S72 Z;  5IT9 f;  1PFT A;  2J6A A;  3K7A I;  1VQN 1;  5CM2 M;  1R9T I;  1TWG I;  3MZL B;  1VQO Z;  4BY1 I;  3GTK I;  2E9H A;  1VQL Z;  2OTL 1;  3JAM f;  2YU9 I;  2V8J A;  2QEX 1;  3HKZ A;  1YUA A;  2KI7 B;  1SFO I;  1VQ4 Z;  1DL6 A;  3J80 b;  2NVT I;  3U50 C;  2WAQ A;  1NP6 A;  5D1O A;  4DQY B;  4Y7N I;  4A3L I;  2RT9 A;  1N8R 2;  4A3C I;  4A93 I;  4NBA A;  4DK1 A;  3G4S Z;  2QKD A;  3OW2 Z;  1I50 I;  1Q86 1;  4NB8 A;  4RS4 A;  3CC7 Z;  2PK7 A;  5T67 A;  1K8A 2;  1Y1V S;  5C4J I;  1N2F A;  4BXX I;  2Y0S A;  2OTJ Z;  2OOY B;  3QWU A;  1S7M A;  1WCM I;  2JUB A;  1KD1 1;  3P5J B;  3CCQ Z;  1I6H I;  3G71 Z;  2AKL A;  3NFZ A;  1RQF A;  3GTG I;  1ML8 A;  2KPI A;  1Q82 1;  1KC8 2;  3I55 Z;  2LIY A;  1YHQ Z;  3S14 I;  3PO3 S;  4Y52 I;  4MD9 A;  4E2W A;  4MD8 A;  3CXC Y;  1WW9 A;  3HOU I;  3I4M I;  4A3E I;  2F4M A;  1QVG Y;  3CXC Z;  4NBB A;  1Y1V I;  2V8K A;  3NDJ A;  1YJN 1;  3MZK B;  1RO4 A;  3NDI A;  4E2Y A;  3MON A;  5FLX f;  4BBS I;  4A3K I;  1RLY A;  3GTM I;  2W03 A;  2PM9 A;  2JA6 I;  2EGT A;  1TWH I;  2M48 A;  1W2B Y;  3H0G I;  1VQ9 1;  1ZB8 A;  1TFI A;  4MH4 A;  2G2K A;  3GCF A;  3VB9 A;  2QEX Z;  3VMI A;  4NBG A;  3I55 1;  3CCR Z;  2K5R A;  4DGL A;  2GU2 A;  3S2H I;  4A3F I;  3EER A;  3GTQ I;  4MXU A;  1RO0 A;  5AN9 F;  4BBR I;  2R6M A;  2K3R A;  1VQ7 1;  1Z01 A;  3RZD I;  1YJW Z;  1ZH1 A;  2NVQ I;  3CD6 Z;  3J7A 4;  2QA4 Z;  3CCU Z;  1VQK 1;  2QRC B;  1YHQ 1;  1Z02 A;  3Q87 A;  3TE5 B;  3CD6 1;  4NBH A;  3H3V J;  3GTL I;  3IF8 A;  1QYP A;  1RO2 A;  3S1R I;  1LQL A;  1M1K 1;  2R93 I;  3J81 b;  4A3M I;  2RPR A;  1S72 1;  3CCR 1;  1YJ9 1;  3CPW Z;  2RHB A;  3IFU A;  3HOY I;  1M90 1;  3IX0 A;  1Y1W I;  3CMA Z;  1VLA A;  4MRI A;  1JWH C;  3CCV 1;  2M6N A;  3G6E 1;  3S1Q I;  1VQ7 Z;  1X0T A;  3S15 I;  1K8A 1;  3KIH A;  5IP9 I;  1K9M 1;  1JJ2 Z;  4HGZ A;  1YIJ 1;  3M3Y I;  1YJN Z;  4RVF A;  4RVH A;  3VMG A;  2GTH A;  3CCE 1;  5D1O B;  1VQ5 Z;  3S17 I;  2NVY I;  2QRD B;  3CC2 Z;  4A3I I;  3NH5 A;  2JS4 A;  3F3P C;  3HOW I;  4A3B I;  1N8R 1;  2R92 I;  2DE5 A;  3FKI I;  1TWC I;  3CC2 1;  4A3D I;  5IP7 I;  4NB9 A;  3T4N B;  1QF8 A;  2RBL A;  4X6A I;  3CC4 1;  2W04 A;  2LFU A;  4QTU A;  5T64 A;  3HOZ I;  1YUK A;  3I4N I;  4NOZ A;  3TDH B;  1YJW 1;  3CCJ Z;  2Q4Z A;  1VQ8 1;  5IT9 b;  2QLV B;  2VUM I;  4HH4 A;  3J80 f;  3CCU 1;  2DE7 A;  1YIJ Z;  5C4X I;  3VMH A;  4E2X A;  3FQQ A;  3OW2 Y;  2GTI A;  4MON A;  2VF1 A;  1NUI A;  3D9X A;  2E2H I;  3NH4 A;  1VQ8 Z;  1VQK Z;  3CCE Z;  2QR1 B;  3CCL Z;  1QVF Y;  1TWF I;  1YJ9 Z;  2V8I A;  2H85 A;  5A2Q f;  3CCS Z;  3PO3 I;  2PMZ A;  1USP B;  3CME 1;  1M90 2;  1KQS Y;  4NH1 C;  2VUG A;  1K73 1;  3I07 A;  2E2I I;  3J81 f;  4NBC A;  1KQS Z;  5LL6 f;  3M4O I;  1KC8 1;  3CPW Y;  1YI2 1;  3CC7 1;  4XX2 A;  4A3G I;  3BG1 B;  3G6E Z;  3CCL 1;  5FLX b;  3S1N I;  2OTJ 1;  3GTJ I;  3VTN A;  5C3E I;  2DE6 A;  4E33 A;  1Q82 2;  4RVG A;  3CQZ I;  3RZO I;  3G71 1;  3CMA 1;  3I56 Z;  4RV9 A;  2OOX B;  3CCV Z;  1VQP Z;  4A3J I;  2JA7 I;  1YIT Z;  1L1O C;  1Q86 2;  1JJ2 Y;  4HGY A;  1I3Q I;  2BJO A;  3BG0 B;  2OTL Z;  2JR6 A;  1KRL A;  1RNI A;  4CL1 A;  5T6B A;  1WII A;  1VQ5 1;  1X3W A;  4BY7 I;  2OZK A;  2F4O A;  2YAD A;  2NVX I;  1VQL 1;  3GTM S;  3FQM A;  1M1K 2;  2QRE B;  2B63 I;  2I3C A;  3LUS A;  3CCJ 1;  1VQP 1;  1VQM 1;  1ZB9 A;  4NFR A;  2P3Y A;  1K83 I;  3CC4 Z;  1QVG Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...