3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
b'TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
3ESWA 4A3EI 3GTQI 3S1NI 3I07A 4NBCA 2E2HI 3HOUI 2B63I 1TFIA 2JR6A 4NBHA 1TWAI 3Q87A 4Y7NI 1R9TI 3S17I 2JNYA 1SFOI 5IP9I 1USPA 1Y1VS 3GTMS 1L1OC 3HOWI 1TWCI 4A3II 1TWGI 4A3KI 2NVYI 5C44I 2R7ZI 3S14I 2JA5I 1VLAA 4NB8A 2AKLA 3GCFA 3K7AI 4NOZA 4NBDA 2E2JI 2JA6I 4NBAA 4BY1I 2R92I 2KPIA 3H3VJ 3M4OI 1ZB8A 3VMIA 4NBEA 5C4JI 3CQZI 3GTOI 1Y1VI 1NUIA 3PO3S 3S1RI 3S2HI 3S15I 1ML8A 3HOZI 2DE7A 5C4XI 3H0GI 3FKII 1N2FA 2JA7I 1TWHI 1X3ZA 2NVTI 1QYPA 2YU9I 2DE6A 1I6HI 5C3EI 3I4MI 4NBGA 3S1QI 4BXXI 2BJOA 1X3WA 3RZOI 5IP7I 4A93I 3PO2I 1I50I 3GTMI 2HF1A 4MH4A 4QTUA 4A3BI 4XX2A 5FLMI 3GTGI 2VUMI 2RBLA 4A3CI 2R93I 2DE5A 3S16I 1Y1WI 4BBRI 1LQLA 2JA8I 2NVQI 1USPB 4NB9A 3S2DI 2F4OA 1ZB9A 1YUAA 3GTLI 1DL6A 3D6WA 4A3FI 4A3GI 3M3YI 3I4NI 3GKQA 3VMHA 3VB9A 4A3DI 3HOXI 1TWFI 3RZDI 1I3QI 1PFTA 1RO4A 4A3MI 3S1MI 1K83I 2F4MA 4NBBA 4A3LI 2NVXI 3U50C 5CM2M 4X6AI 3GTKI 4Y52I 1RLYA 2K5RA 2PK7A 3EERA 4A3JI 3LUSA 2J6AA 4BBSI 3PO3I 1WW9A 3GTJI 4BY7I 2JS4A 2P3YA 3GTPI 3HOYI 3HOVI 4NBFA 2E2II 1WCMI 3VMGA 4QTTA
chains in the Genus database with same CATH superfamily
4RS4A 3CCQZ 2K3RA 3IFUA 2LFUA 4E32A 4NBCA 2JMOA 4MD9A 2B63I 3CC41 3BG1B 2V8KA 3Q87A 1VQ7Z 3KIFA 4DGLA 1SFOI 1USPA 2IZ4A 2IV2X 4RVDA 1NJI2 3S14I 1VQ6Z 1WIIA 3GCFA 4NOZA 4NBAA 1VQNZ 1VQ8Z 2E9HA 5D1OB 1NP6A 5T67A 5C4JI 5FLXb 3S2HI 3S15I 1RO2A 2JIMA 1K8A1 1QXFA 2JA7I 1VQKZ 1X3ZA 2NVTI 1QYPA 1KC81 2YU9I 2DE6A 2Y0SA 3I4MI 3D9XA 3RZOI 3D2LA 4EWCA 3GTMI 2HF1A 2WAQA 4A3BI 4A3CI 3OW2Y 2R93I 2OOXB 3S16I 2HU9A 1LQLA 1Q16A 3CXCZ 2M6NA 4NB9A 2IZ3A 1YUAA 1VQ51 3IR7A 2JUBA 3I4NI 1N8R2 1Q7Y2 1Q811 1W2BZ 4RVGA 3FQMA 1VQ9Z 1YI21 3MZLB 1PFTA 5LL6f 3S1MI 1X0TA 1YJW1 4MD7A 5IT9f 2QRCB 3J81f 3CME1 1VQ91 1JJ2Z 5T64A 1YITZ 3EERA 2J6AA 1VQO1 1W2BY 3GTJI 1RQFA 2P3YA 3GTPI 3HOVI 2E2II 4E31A 4QTTA 3ESWA 2OTJZ 2AYDA 3GTQI 5A2Qb 4E2ZA 2E2HI 3CCV1 3HOUI 2RPRA 1VQ5Z 4DK1A 1TWAI 3NH8A 3CCQ1 1YUKA 2V3VA 4Y7NI 1R9TI 3S17I 2JNYA 3GTMS 1L1OC 3CMA1 1TWCI 1K732 1S72Z 1AA6A 4A3KI 1S7MA 3J7A4 2V45A 3CCSZ 2R92I 3K7AI 2QLVB 2ZAEB 4CL1A 4RV9A 3VMIA 2NAPA 3TE5B 3CXCY 2JIQA 2VUGA 3G71Z 3F3FC 3NFZA 3HOZI 2DE7A 2GTHA 3FKII 1QF8A 1KC82 5C3EI 1VQLZ 3S1QI 2BJOA 5IP7I 3G4SZ 1YJ91 4RVHA 4XX2A 2VUMI 4BBRI 3CCR1 2NVQI 1USPB 1YJ9Z 1FDIA 1DL6A 3GTLI 5A2Qf 1M901 1M1K1 3IF8A 3CD6Z 3GKQA 3VMHA 2LIYA 1Y8CA 3HOXI 2V8JA 4A3MI 2M48A 4RVFA 4A3LI 2OZKA 4MXUA 2JIOA 1JWHC 2VPYA 2PK7A 3T4NB 4E2XA 5FLXf 4TNUA 3I561 2QRDB 2GTIA 2JS4A 2RIQA 1VQOZ 3VMGA 1KD12 2JIRA 4A3EI 3I551 3S1NI 3I07A 2O53A 1TFIA 2JR6A 1Z03A 5IT9b 1QVGZ 1VQ41 1VQM1 2QKDA 5D1OA 3HOWI 2PMZA 1Z01A 3F3PC 2QEXZ 4A3II 3JAMb 3I55Z 2V8IA 2JA5I 2EGTA 1VLAA 2AKLA 3BG0B 3HKZA 4NB8A 3CCMZ 1YHQ1 2E2JI 4NBDA 4BY1I 3H3VJ 1ZB8A 1WZNA 1FDOA 2R6MA 4MRIA 4E33A 3G4S1 5AN9F 2QA4Z 1NUIA 3S1RI 3CCVZ 3IX0A 2VPWA 4NH1C 5D1PA 1ML8A 3CCJZ 2W03A 5C4XI 3H0GI 1N2FA 1TWHI 2VPXA 3MONA 4MONA 3CMAZ 1QVFY 3JAMf 4NBGA 1X3WA 4E30A 1WJ2A 2QA41 2E7ZA 4QTUA 2RBLA 3CCS1 2JA8I 1VQN1 1VQ81 4NFRA 3S2DI 1KD11 3P5JB 1QVFZ 3J80f 3J80b 3M3YI 5T6BA 3G711 2H85A 2OTLZ 2WB1A 1Q7Y1 3VTNA 2YADA 1TWFI 3RZDI 2I3CA 1I3QI 1RO4A 1KQSY 1Q821 3U50C 5CM2M 1ZH1A 4A3JI 3LUSA 3G6EZ 3NDIA 1WW9A 3OW2Z 1VQ61 2QREB 1KRLA 3CCLZ 2Q4ZA 4NBFA 1WCMI 4HGYA 2VF1A 1JJ2Y 1M902 1YJN1 4AYBA 1P9NA 1K8A2 2JIPA 4NBHA 1YHQZ 3NH5A 1YJWZ 3NDJA 2OTL1 3CC2Z 3CCL1 5IP9I 1Y1VS 2LEXA 1YIT1 1K731 2VPZA 1TWGI 3TDHB 2NVYI 5C44I 2R7ZI 1RNIA 2JA6I 3M4OI 3CPWZ 2KPIA 3CCRZ 1M1K2 1VQP1 4HGZA 4NBEA 3CQZI 1Q812 3GTOI 1KQSZ 1Y1VI 2QR1B 2OOYB 3KIHA 3PO3S 2GU2A 2P28A 3MZKB 1VQPZ 1Q822 1VQ4Z 2W04A 1Q861 1I6HI 1Z02A 3EEDA 2QEX1 4BXXI 3CMEZ 1S721 4E2YA 2PM9A 4A93I 3PO2I 1I50I 3CC7Z 1K9M2 4MH4A 2G2KA 5FLMI 3GTGI 4DQYB 2DE5A 3CCM1 1Y1WI 3I56Z 1SIWA 4MD8A 3CC71 1VQK1 2Q51A 1RO0A 2RHBA 2F4OA 1ZB9A 3D6WA 3CCE1 4A3FI 4A3GI 3CC4Z 3CCUZ 1YIJ1 1N8R1 3J81b 1Q862 3VB9A 4A3DI 3CCJ1 4E2WA 3CCU1 1YIJZ 1K83I 2F4MA 2KI7B 1VQL1 1VQMZ 2NVXI 3CPWY 2O4HA 2RT9A 3CCEZ 1NJI1 3GTKI 4X6AI 1RLYA 2K5RA 1YJNZ 4Y52I 4BBSI 3PO3I 4BY7I 1QVGY 1K9M1 3QWUA 4HH4A 2OTJ1 1VQ71 1YI2Z 3CC21 3HOYI 3FQQA 3NH4A 4S1TA 3G6E1 4NBBA 3CD61
chains in the Genus database with same CATH topology
4RS4A 3CCQZ 2K3RA 3IFUA 2LFUA 4E32A 4NBCA 2JMOA 4MD9A 2B63I 3CC41 3BG1B 2V8KA 3Q87A 1VQ7Z 3KIFA 4DGLA 1SFOI 1USPA 2IZ4A 4RVDA 1NJI2 3S14I 1VQ6Z 1WIIA 3GCFA 4NOZA 4NBAA 1VQNZ 1VQ8Z 2E9HA 5D1OB 1NP6A 5T67A 5C4JI 5FLXb 3S2HI 3S15I 1RO2A 1K8A1 2JA7I 1VQKZ 1X3ZA 2NVTI 1QYPA 1KC81 2YU9I 2DE6A 2Y0SA 3I4MI 3D9XA 3RZOI 4EWCA 3GTMI 2HF1A 2WAQA 4A3BI 4A3CI 3OW2Y 2R93I 2OOXB 3S16I 2HU9A 1LQLA 3CXCZ 2M6NA 4NB9A 2IZ3A 1YUAA 1VQ51 2JUBA 3I4NI 1N8R2 1Q7Y2 1Q811 1W2BZ 4RVGA 3FQMA 1VQ9Z 1YI21 3MZLB 1PFTA 5LL6f 3S1MI 1X0TA 1YJW1 4MD7A 5IT9f 2QRCB 3J81f 3CME1 1VQ91 1JJ2Z 5T64A 1YITZ 3EERA 2J6AA 1VQO1 1W2BY 3GTJI 1RQFA 2P3YA 3GTPI 3HOVI 2E2II 4E31A 4QTTA 3ESWA 2OTJZ 3GTQI 5A2Qb 4E2ZA 2E2HI 3CCV1 3HOUI 2RPRA 1VQ5Z 4DK1A 1TWAI 3NH8A 3CCQ1 1YUKA 4Y7NI 1R9TI 3S17I 2JNYA 3GTMS 1L1OC 3CMA1 1TWCI 1K732 1S72Z 4A3KI 1S7MA 3J7A4 3CCSZ 2R92I 3K7AI 2QLVB 2ZAEB 4CL1A 4RV9A 3VMIA 3TE5B 3CXCY 2VUGA 3G71Z 3F3FC 3NFZA 3HOZI 2DE7A 2GTHA 3FKII 1QF8A 1KC82 5C3EI 1VQLZ 3S1QI 2BJOA 5IP7I 3G4SZ 1YJ91 4RVHA 4XX2A 2VUMI 4BBRI 3CCR1 2NVQI 1USPB 1YJ9Z 1DL6A 3GTLI 5A2Qf 1M901 1M1K1 3IF8A 3CD6Z 3GKQA 3VMHA 2LIYA 3HOXI 2V8JA 4A3MI 2M48A 4RVFA 4A3LI 2OZKA 4MXUA 1JWHC 2PK7A 3T4NB 4E2XA 5FLXf 4TNUA 3I561 2QRDB 2GTIA 2JS4A 2RIQA 1VQOZ 3VMGA 1KD12 4A3EI 3I551 3S1NI 3I07A 2O53A 1TFIA 2JR6A 1Z03A 5IT9b 1QVGZ 1VQ41 1VQM1 2QKDA 5D1OA 3HOWI 2PMZA 1Z01A 3F3PC 2QEXZ 4A3II 3JAMb 3I55Z 2V8IA 2JA5I 2EGTA 1VLAA 2AKLA 3BG0B 3HKZA 4NB8A 3CCMZ 1YHQ1 2E2JI 4NBDA 4BY1I 3H3VJ 1ZB8A 2R6MA 4MRIA 4E33A 3G4S1 5AN9F 2QA4Z 1NUIA 3S1RI 3CCVZ 3IX0A 4NH1C 5D1PA 1ML8A 3CCJZ 2W03A 5C4XI 3H0GI 1N2FA 1TWHI 3MONA 4MONA 3CMAZ 1QVFY 3JAMf 4NBGA 1X3WA 4E30A 2QA41 4QTUA 2RBLA 3CCS1 2JA8I 1VQN1 1VQ81 4NFRA 3S2DI 1KD11 3P5JB 1QVFZ 3J80f 3J80b 3M3YI 5T6BA 3G711 2H85A 2OTLZ 2WB1A 1Q7Y1 3VTNA 2YADA 1TWFI 3RZDI 2I3CA 1I3QI 1RO4A 1KQSY 1Q821 3U50C 5CM2M 1ZH1A 4A3JI 3LUSA 3G6EZ 3NDIA 1WW9A 3OW2Z 1VQ61 2QREB 1KRLA 3CCLZ 2Q4ZA 4NBFA 1WCMI 4HGYA 2VF1A 1JJ2Y 1M902 1YJN1 4AYBA 1P9NA 1K8A2 4NBHA 1YHQZ 3NH5A 1YJWZ 3NDJA 2OTL1 3CC2Z 3CCL1 5IP9I 1Y1VS 1YIT1 1K731 1TWGI 3TDHB 2NVYI 5C44I 2R7ZI 1RNIA 2JA6I 3M4OI 3CPWZ 2KPIA 3CCRZ 1M1K2 1VQP1 4HGZA 4NBEA 3CQZI 1Q812 3GTOI 1KQSZ 1Y1VI 2QR1B 2OOYB 3KIHA 3PO3S 2GU2A 2P28A 3MZKB 1VQPZ 1Q822 1VQ4Z 2W04A 1Q861 1I6HI 1Z02A 3EEDA 2QEX1 4BXXI 3CMEZ 1S721 4E2YA 2PM9A 4A93I 3PO2I 1I50I 3CC7Z 1K9M2 4MH4A 2G2KA 5FLMI 3GTGI 4DQYB 2DE5A 3CCM1 1Y1WI 3I56Z 4MD8A 3CC71 1VQK1 2Q51A 1RO0A 2RHBA 2F4OA 1ZB9A 3D6WA 3CCE1 4A3FI 4A3GI 3CC4Z 3CCUZ 1YIJ1 1N8R1 3J81b 1Q862 3VB9A 4A3DI 3CCJ1 4E2WA 3CCU1 1YIJZ 1K83I 2F4MA 2KI7B 1VQL1 1VQMZ 2NVXI 3CPWY 2O4HA 2RT9A 3CCEZ 1NJI1 3GTKI 4X6AI 1RLYA 2K5RA 1YJNZ 4Y52I 4BBSI 3PO3I 4BY7I 1QVGY 1K9M1 3QWUA 4HH4A 2OTJ1 1VQ71 1YI2Z 3CC21 3HOYI 3FQQA 3NH4A 4S1TA 3G6E1 4NBBA 3CD61
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ESW A;  4A3E I;  3GTQ I;  3S1N I;  3I07 A;  4NBC A;  2E2H I;  3HOU I;  2B63 I;  1TFI A;  2JR6 A;  4NBH A;  1TWA I;  3Q87 A;  4Y7N I;  1R9T I;  3S17 I;  2JNY A;  1SFO I;  5IP9 I;  1USP A;  1Y1V S;  3GTM S;  1L1O C;  3HOW I;  1TWC I;  4A3I I;  1TWG I;  4A3K I;  2NVY I;  5C44 I;  2R7Z I;  3S14 I;  2JA5 I;  1VLA A;  4NB8 A;  2AKL A;  3GCF A;  3K7A I;  4NOZ A;  4NBD A;  2E2J I;  2JA6 I;  4NBA A;  4BY1 I;  2R92 I;  2KPI A;  3H3V J;  3M4O I;  1ZB8 A;  3VMI A;  4NBE A;  5C4J I;  3CQZ I;  3GTO I;  1Y1V I;  1NUI A;  3PO3 S;  3S1R I;  3S2H I;  3S15 I;  1ML8 A;  3HOZ I;  2DE7 A;  5C4X I;  3H0G I;  3FKI I;  1N2F A;  2JA7 I;  1TWH I;  1X3Z A;  2NVT I;  1QYP A;  2YU9 I;  2DE6 A;  1I6H I;  5C3E I;  3I4M I;  4NBG A;  3S1Q I;  4BXX I;  2BJO A;  1X3W A;  3RZO I;  5IP7 I;  4A93 I;  3PO2 I;  1I50 I;  3GTM I;  2HF1 A;  4MH4 A;  4QTU A;  4A3B I;  4XX2 A;  5FLM I;  3GTG I;  2VUM I;  2RBL A;  4A3C I;  2R93 I;  2DE5 A;  3S16 I;  1Y1W I;  4BBR I;  1LQL A;  2JA8 I;  2NVQ I;  1USP B;  4NB9 A;  3S2D I;  2F4O A;  1ZB9 A;  1YUA A;  3GTL I;  1DL6 A;  3D6W A;  4A3F I;  4A3G I;  3M3Y I;  3I4N I;  3GKQ A;  3VMH A;  3VB9 A;  4A3D I;  3HOX I;  1TWF I;  3RZD I;  1I3Q I;  1PFT A;  1RO4 A;  4A3M I;  3S1M I;  1K83 I;  2F4M A;  4NBB A;  4A3L I;  2NVX I;  3U50 C;  5CM2 M;  4X6A I;  3GTK I;  4Y52 I;  1RLY A;  2K5R A;  2PK7 A;  3EER A;  4A3J I;  3LUS A;  2J6A A;  4BBS I;  3PO3 I;  1WW9 A;  3GTJ I;  4BY7 I;  2JS4 A;  2P3Y A;  3GTP I;  3HOY I;  3HOV I;  4NBF A;  2E2I I;  1WCM I;  3VMG A;  4QTT A; 
#chains in the Genus database with same CATH topology
 4RS4 A;  3CCQ Z;  2K3R A;  3IFU A;  2LFU A;  4E32 A;  4NBC A;  2JMO A;  4MD9 A;  2B63 I;  3CC4 1;  3BG1 B;  2V8K A;  3Q87 A;  1VQ7 Z;  3KIF A;  4DGL A;  1SFO I;  1USP A;  2IZ4 A;  2IV2 X;  4RVD A;  1NJI 2;  3S14 I;  1VQ6 Z;  1WII A;  3GCF A;  4NOZ A;  4NBA A;  1VQN Z;  1VQ8 Z;  2E9H A;  5D1O B;  1NP6 A;  5T67 A;  5C4J I;  5FLX b;  3S2H I;  3S15 I;  1RO2 A;  2JIM A;  1K8A 1;  1QXF A;  2JA7 I;  1VQK Z;  1X3Z A;  2NVT I;  1QYP A;  1KC8 1;  2YU9 I;  2DE6 A;  2Y0S A;  3I4M I;  3D9X A;  3RZO I;  3D2L A;  4EWC A;  3GTM I;  2HF1 A;  2WAQ A;  4A3B I;  4A3C I;  3OW2 Y;  2R93 I;  2OOX B;  3S16 I;  2HU9 A;  1LQL A;  1Q16 A;  3CXC Z;  2M6N A;  4NB9 A;  2IZ3 A;  1YUA A;  1VQ5 1;  3IR7 A;  2JUB A;  3I4N I;  1N8R 2;  1Q7Y 2;  1Q81 1;  1W2B Z;  4RVG A;  3FQM A;  1VQ9 Z;  1YI2 1;  3MZL B;  1PFT A;  5LL6 f;  3S1M I;  1X0T A;  1YJW 1;  4MD7 A;  5IT9 f;  2QRC B;  3J81 f;  3CME 1;  1VQ9 1;  1JJ2 Z;  5T64 A;  1YIT Z;  3EER A;  2J6A A;  1VQO 1;  1W2B Y;  3GTJ I;  1RQF A;  2P3Y A;  3GTP I;  3HOV I;  2E2I I;  4E31 A;  4QTT A;  3ESW A;  2OTJ Z;  2AYD A;  3GTQ I;  5A2Q b;  4E2Z A;  2E2H I;  3CCV 1;  3HOU I;  2RPR A;  1VQ5 Z;  4DK1 A;  1TWA I;  3NH8 A;  3CCQ 1;  1YUK A;  2V3V A;  4Y7N I;  1R9T I;  3S17 I;  2JNY A;  3GTM S;  1L1O C;  3CMA 1;  1TWC I;  1K73 2;  1S72 Z;  1AA6 A;  4A3K I;  1S7M A;  3J7A 4;  2V45 A;  3CCS Z;  2R92 I;  3K7A I;  2QLV B;  2ZAE B;  4CL1 A;  4RV9 A;  3VMI A;  2NAP A;  3TE5 B;  3CXC Y;  2JIQ A;  2VUG A;  3G71 Z;  3F3F C;  3NFZ A;  3HOZ I;  2DE7 A;  2GTH A;  3FKI I;  1QF8 A;  1KC8 2;  5C3E I;  1VQL Z;  3S1Q I;  2BJO A;  5IP7 I;  3G4S Z;  1YJ9 1;  4RVH A;  4XX2 A;  2VUM I;  4BBR I;  3CCR 1;  2NVQ I;  1USP B;  1YJ9 Z;  1FDI A;  1DL6 A;  3GTL I;  5A2Q f;  1M90 1;  1M1K 1;  3IF8 A;  3CD6 Z;  3GKQ A;  3VMH A;  2LIY A;  1Y8C A;  3HOX I;  2V8J A;  4A3M I;  2M48 A;  4RVF A;  4A3L I;  2OZK A;  4MXU A;  2JIO A;  1JWH C;  2VPY A;  2PK7 A;  3T4N B;  4E2X A;  5FLX f;  4TNU A;  3I56 1;  2QRD B;  2GTI A;  2JS4 A;  2RIQ A;  1VQO Z;  3VMG A;  1KD1 2;  2JIR A;  4A3E I;  3I55 1;  3S1N I;  3I07 A;  2O53 A;  1TFI A;  2JR6 A;  1Z03 A;  5IT9 b;  1QVG Z;  1VQ4 1;  1VQM 1;  2QKD A;  5D1O A;  3HOW I;  2PMZ A;  1Z01 A;  3F3P C;  2QEX Z;  4A3I I;  3JAM b;  3I55 Z;  2V8I A;  2JA5 I;  2EGT A;  1VLA A;  2AKL A;  3BG0 B;  3HKZ A;  4NB8 A;  3CCM Z;  1YHQ 1;  2E2J I;  4NBD A;  4BY1 I;  3H3V J;  1ZB8 A;  1WZN A;  1FDO A;  2R6M A;  4MRI A;  4E33 A;  3G4S 1;  5AN9 F;  2QA4 Z;  1NUI A;  3S1R I;  3CCV Z;  3IX0 A;  2VPW A;  4NH1 C;  5D1P A;  1ML8 A;  3CCJ Z;  2W03 A;  5C4X I;  3H0G I;  1N2F A;  1TWH I;  2VPX A;  3MON A;  4MON A;  3CMA Z;  1QVF Y;  3JAM f;  4NBG A;  1X3W A;  4E30 A;  1WJ2 A;  2QA4 1;  2E7Z A;  4QTU A;  2RBL A;  3CCS 1;  2JA8 I;  1VQN 1;  1VQ8 1;  4NFR A;  3S2D I;  1KD1 1;  3P5J B;  1QVF Z;  3J80 f;  3J80 b;  3M3Y I;  5T6B A;  3G71 1;  2H85 A;  2OTL Z;  2WB1 A;  1Q7Y 1;  3VTN A;  2YAD A;  1TWF I;  3RZD I;  2I3C A;  1I3Q I;  1RO4 A;  1KQS Y;  1Q82 1;  3U50 C;  5CM2 M;  1ZH1 A;  4A3J I;  3LUS A;  3G6E Z;  3NDI A;  1WW9 A;  3OW2 Z;  1VQ6 1;  2QRE B;  1KRL A;  3CCL Z;  2Q4Z A;  4NBF A;  1WCM I;  4HGY A;  2VF1 A;  1JJ2 Y;  1M90 2;  1YJN 1;  4AYB A;  1P9N A;  1K8A 2;  2JIP A;  4NBH A;  1YHQ Z;  3NH5 A;  1YJW Z;  3NDJ A;  2OTL 1;  3CC2 Z;  3CCL 1;  5IP9 I;  1Y1V S;  2LEX A;  1YIT 1;  1K73 1;  2VPZ A;  1TWG I;  3TDH B;  2NVY I;  5C44 I;  2R7Z I;  1RNI A;  2JA6 I;  3M4O I;  3CPW Z;  2KPI A;  3CCR Z;  1M1K 2;  1VQP 1;  4HGZ A;  4NBE A;  3CQZ I;  1Q81 2;  3GTO I;  1KQS Z;  1Y1V I;  2QR1 B;  2OOY B;  3KIH A;  3PO3 S;  2GU2 A;  2P28 A;  3MZK B;  1VQP Z;  1Q82 2;  1VQ4 Z;  2W04 A;  1Q86 1;  1I6H I;  1Z02 A;  3EED A;  2QEX 1;  4BXX I;  3CME Z;  1S72 1;  4E2Y A;  2PM9 A;  4A93 I;  3PO2 I;  1I50 I;  3CC7 Z;  1K9M 2;  4MH4 A;  2G2K A;  5FLM I;  3GTG I;  4DQY B;  2DE5 A;  3CCM 1;  1Y1W I;  3I56 Z;  1SIW A;  4MD8 A;  3CC7 1;  1VQK 1;  2Q51 A;  1RO0 A;  2RHB A;  2F4O A;  1ZB9 A;  3D6W A;  3CCE 1;  4A3F I;  4A3G I;  3CC4 Z;  3CCU Z;  1YIJ 1;  1N8R 1;  3J81 b;  1Q86 2;  3VB9 A;  4A3D I;  3CCJ 1;  4E2W A;  3CCU 1;  1YIJ Z;  1K83 I;  2F4M A;  2KI7 B;  1VQL 1;  1VQM Z;  2NVX I;  3CPW Y;  2O4H A;  2RT9 A;  3CCE Z;  1NJI 1;  3GTK I;  4X6A I;  1RLY A;  2K5R A;  1YJN Z;  4Y52 I;  4BBS I;  3PO3 I;  4BY7 I;  1QVG Y;  1K9M 1;  3QWU A;  4HH4 A;  2OTJ 1;  1VQ7 1;  1YI2 Z;  3CC2 1;  3HOY I;  3FQQ A;  3NH4 A;  4S1T A;  3G6E 1;  4NBB A;  3CD6 1; 
#chains in the Genus database with same CATH homology
 4RS4 A;  3CCQ Z;  2K3R A;  3IFU A;  2LFU A;  4E32 A;  4NBC A;  2JMO A;  4MD9 A;  2B63 I;  3CC4 1;  3BG1 B;  2V8K A;  3Q87 A;  1VQ7 Z;  3KIF A;  4DGL A;  1SFO I;  1USP A;  2IZ4 A;  4RVD A;  1NJI 2;  3S14 I;  1VQ6 Z;  1WII A;  3GCF A;  4NOZ A;  4NBA A;  1VQN Z;  1VQ8 Z;  2E9H A;  5D1O B;  1NP6 A;  5T67 A;  5C4J I;  5FLX b;  3S2H I;  3S15 I;  1RO2 A;  1K8A 1;  2JA7 I;  1VQK Z;  1X3Z A;  2NVT I;  1QYP A;  1KC8 1;  2YU9 I;  2DE6 A;  2Y0S A;  3I4M I;  3D9X A;  3RZO I;  4EWC A;  3GTM I;  2HF1 A;  2WAQ A;  4A3B I;  4A3C I;  3OW2 Y;  2R93 I;  2OOX B;  3S16 I;  2HU9 A;  1LQL A;  3CXC Z;  2M6N A;  4NB9 A;  2IZ3 A;  1YUA A;  1VQ5 1;  2JUB A;  3I4N I;  1N8R 2;  1Q7Y 2;  1Q81 1;  1W2B Z;  4RVG A;  3FQM A;  1VQ9 Z;  1YI2 1;  3MZL B;  1PFT A;  5LL6 f;  3S1M I;  1X0T A;  1YJW 1;  4MD7 A;  5IT9 f;  2QRC B;  3J81 f;  3CME 1;  1VQ9 1;  1JJ2 Z;  5T64 A;  1YIT Z;  3EER A;  2J6A A;  1VQO 1;  1W2B Y;  3GTJ I;  1RQF A;  2P3Y A;  3GTP I;  3HOV I;  2E2I I;  4E31 A;  4QTT A;  3ESW A;  2OTJ Z;  3GTQ I;  5A2Q b;  4E2Z A;  2E2H I;  3CCV 1;  3HOU I;  2RPR A;  1VQ5 Z;  4DK1 A;  1TWA I;  3NH8 A;  3CCQ 1;  1YUK A;  4Y7N I;  1R9T I;  3S17 I;  2JNY A;  3GTM S;  1L1O C;  3CMA 1;  1TWC I;  1K73 2;  1S72 Z;  4A3K I;  1S7M A;  3J7A 4;  3CCS Z;  2R92 I;  3K7A I;  2QLV B;  2ZAE B;  4CL1 A;  4RV9 A;  3VMI A;  3TE5 B;  3CXC Y;  2VUG A;  3G71 Z;  3F3F C;  3NFZ A;  3HOZ I;  2DE7 A;  2GTH A;  3FKI I;  1QF8 A;  1KC8 2;  5C3E I;  1VQL Z;  3S1Q I;  2BJO A;  5IP7 I;  3G4S Z;  1YJ9 1;  4RVH A;  4XX2 A;  2VUM I;  4BBR I;  3CCR 1;  2NVQ I;  1USP B;  1YJ9 Z;  1DL6 A;  3GTL I;  5A2Q f;  1M90 1;  1M1K 1;  3IF8 A;  3CD6 Z;  3GKQ A;  3VMH A;  2LIY A;  3HOX I;  2V8J A;  4A3M I;  2M48 A;  4RVF A;  4A3L I;  2OZK A;  4MXU A;  1JWH C;  2PK7 A;  3T4N B;  4E2X A;  5FLX f;  4TNU A;  3I56 1;  2QRD B;  2GTI A;  2JS4 A;  2RIQ A;  1VQO Z;  3VMG A;  1KD1 2;  4A3E I;  3I55 1;  3S1N I;  3I07 A;  2O53 A;  1TFI A;  2JR6 A;  1Z03 A;  5IT9 b;  1QVG Z;  1VQ4 1;  1VQM 1;  2QKD A;  5D1O A;  3HOW I;  2PMZ A;  1Z01 A;  3F3P C;  2QEX Z;  4A3I I;  3JAM b;  3I55 Z;  2V8I A;  2JA5 I;  2EGT A;  1VLA A;  2AKL A;  3BG0 B;  3HKZ A;  4NB8 A;  3CCM Z;  1YHQ 1;  2E2J I;  4NBD A;  4BY1 I;  3H3V J;  1ZB8 A;  2R6M A;  4MRI A;  4E33 A;  3G4S 1;  5AN9 F;  2QA4 Z;  1NUI A;  3S1R I;  3CCV Z;  3IX0 A;  4NH1 C;  5D1P A;  1ML8 A;  3CCJ Z;  2W03 A;  5C4X I;  3H0G I;  1N2F A;  1TWH I;  3MON A;  4MON A;  3CMA Z;  1QVF Y;  3JAM f;  4NBG A;  1X3W A;  4E30 A;  2QA4 1;  4QTU A;  2RBL A;  3CCS 1;  2JA8 I;  1VQN 1;  1VQ8 1;  4NFR A;  3S2D I;  1KD1 1;  3P5J B;  1QVF Z;  3J80 f;  3J80 b;  3M3Y I;  5T6B A;  3G71 1;  2H85 A;  2OTL Z;  2WB1 A;  1Q7Y 1;  3VTN A;  2YAD A;  1TWF I;  3RZD I;  2I3C A;  1I3Q I;  1RO4 A;  1KQS Y;  1Q82 1;  3U50 C;  5CM2 M;  1ZH1 A;  4A3J I;  3LUS A;  3G6E Z;  3NDI A;  1WW9 A;  3OW2 Z;  1VQ6 1;  2QRE B;  1KRL A;  3CCL Z;  2Q4Z A;  4NBF A;  1WCM I;  4HGY A;  2VF1 A;  1JJ2 Y;  1M90 2;  1YJN 1;  4AYB A;  1P9N A;  1K8A 2;  4NBH A;  1YHQ Z;  3NH5 A;  1YJW Z;  3NDJ A;  2OTL 1;  3CC2 Z;  3CCL 1;  5IP9 I;  1Y1V S;  1YIT 1;  1K73 1;  1TWG I;  3TDH B;  2NVY I;  5C44 I;  2R7Z I;  1RNI A;  2JA6 I;  3M4O I;  3CPW Z;  2KPI A;  3CCR Z;  1M1K 2;  1VQP 1;  4HGZ A;  4NBE A;  3CQZ I;  1Q81 2;  3GTO I;  1KQS Z;  1Y1V I;  2QR1 B;  2OOY B;  3KIH A;  3PO3 S;  2GU2 A;  2P28 A;  3MZK B;  1VQP Z;  1Q82 2;  1VQ4 Z;  2W04 A;  1Q86 1;  1I6H I;  1Z02 A;  3EED A;  2QEX 1;  4BXX I;  3CME Z;  1S72 1;  4E2Y A;  2PM9 A;  4A93 I;  3PO2 I;  1I50 I;  3CC7 Z;  1K9M 2;  4MH4 A;  2G2K A;  5FLM I;  3GTG I;  4DQY B;  2DE5 A;  3CCM 1;  1Y1W I;  3I56 Z;  4MD8 A;  3CC7 1;  1VQK 1;  2Q51 A;  1RO0 A;  2RHB A;  2F4O A;  1ZB9 A;  3D6W A;  3CCE 1;  4A3F I;  4A3G I;  3CC4 Z;  3CCU Z;  1YIJ 1;  1N8R 1;  3J81 b;  1Q86 2;  3VB9 A;  4A3D I;  3CCJ 1;  4E2W A;  3CCU 1;  1YIJ Z;  1K83 I;  2F4M A;  2KI7 B;  1VQL 1;  1VQM Z;  2NVX I;  3CPW Y;  2O4H A;  2RT9 A;  3CCE Z;  1NJI 1;  3GTK I;  4X6A I;  1RLY A;  2K5R A;  1YJN Z;  4Y52 I;  4BBS I;  3PO3 I;  4BY7 I;  1QVG Y;  1K9M 1;  3QWU A;  4HH4 A;  2OTJ 1;  1VQ7 1;  1YI2 Z;  3CC2 1;  3HOY I;  3FQQ A;  3NH4 A;  4S1T A;  3G6E 1;  4NBB A;  3CD6 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...