3H3VJ

Yeast rnap ii containing poly(a)-signal sequence in the active site
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
119
structure length
119
Chain Sequence
TTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Torpedo Nuclease Rat1 Is Insufficient to Terminate RNA Polymerase II in Vitro
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 7
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01096 TFIIS_C Transcription factor S-II (TFIIS)
J PF02150 RNA_POL_M_15KD RNA polymerases M/15 Kd subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3h3vJ02
2HF1A 4NB9A 1Y1VI 4X6AI 2JA7I 1DL6A 4QTUA 3GCFA 1I50I 3S14I 4A3LI 1RLYA 3K7AI 2E2JI 2E2II 1Y1WI 4A3EI 2JA6I 4NBFA 1PFTA 2F4OA 5C44I 3HOVI 2F4MA 1NUIA 4A3KI 2NVYI 5FLMI 3GKQA 1ML8A 3GTKI 3PO3S 3I4MI 2R7ZI 3S1MI 3RZDI 3GTGI 3GTOI 1Y1VS 2E2HI 4A3BI 1USPA 4A93I 3I4NI 4NBDA 2JA5I 5C3EI 2DE5A 4NBEA 2YU9I 4QTTA 3VMIA 2PK7A 2RBLA 2NVXI 3EERA 1TWCI 4BY7I 4NOZA 1TWAI 3M4OI 1TWGI 4BXXI 4A3JI 4XX2A 2JA8I 4Y7NI 3PO2I 1L1OC 5C4JI 3D6WA 2JS4A 2B63I 4A3II 5C4XI 3Q87A 3FKII 1YUAA 2R92I 1TFIA 1I3QI 1VLAA 2DE7A 3CQZI 4BBRI 4Y52I 5IP9I 3HOUI 2NVQI 4NBBA 4BY1I 1N2FA 1QYPA 1X3WA 1K83I 4NB8A 2BJOA 2JR6A 3GTQI 3VMGA 4A3CI 3S1RI 3HOWI 3GTMI 3H3VJ 2JNYA 3S2HI 3I07A 4A3DI 2K5RA 1LQLA 2AKLA 2KPIA 4NBAA 1TWFI 3VB9A 1SFOI 3HOYI 3RZOI 2VUMI 2P3YA 1I6HI 3S17I 3U50C 1USPB 3HOZI 3LUSA 2J6AA 5CM2M 1TWHI 3GTMS 1ZB9A 4A3GI 3S15I 3S1QI 4MH4A 2DE6A 1WCMI 4NBHA 5IP7I 2NVTI 3ESWA 4NBCA 1X3ZA 1R9TI 4NBGA 2R93I 3VMHA 3S2DI 1WW9A 1ZB8A 4BBSI 3H0GI 3S1NI 4A3FI 3HOXI 4A3MI 3S16I 3GTPI 3GTLI 3PO3I 3M3YI 1RO4A 3GTJI
chains in the Genus database with same CATH superfamily
1M1K2 4NB9A 3CD6Z 1Q811 1Y1VI 4X6AI 1S72Z 1X0TA 1M1K1 1RLYA 3CCRZ 2E2II 3G6EZ 1PFTA 3G4S1 3NDIA 4E2XA 1VQP1 3TDHB 1NUIA 3CPWY 3CXCY 3I4MI 2W03A 3RZDI 3GTGI 2NAPA 1AA6A 2E2HI 1YJWZ 4A3BI 4NBDA 3CC7Z 1RO0A 2Q4ZA 1QXFA 3J80f 2O53A 2YU9I 3VMIA 4E2ZA 1FDIA 1TWGI 3CCMZ 4A3JI 1VQ6Z 2GTHA 3MZKB 3BG0B 3QWUA 4A3II 3FKII 3CMA1 4HGZA 1Q821 2RHBA 1I3QI 2WB1A 2K3RA 3CQZI 2RT9A 4Y52I 3I56Z 5AN9F 2NVQI 4DK1A 2QEX1 4BY1I 3IR7A 1VQ4Z 1WZNA 2IV2X 2OTJZ 1Z02A 1QYPA 4NB8A 4E31A 1VQLZ 1W2BZ 2JIRA 2JIOA 2JNYA 2YADA 2OOXB 4MD8A 3VB9A 3RZOI 3OW2Y 2P3YA 2V8JA 3CCJ1 1VQNZ 3J7A4 4RV9A 3NH8A 3GTMS 2ZAEB 5D1OA 4MH4A 2DE6A 1WCMI 1QVGZ 1YJ91 1X3ZA 3VTNA 4E2WA 3S2DI 2GTIA 4MRIA 3IF8A 2RIQA 3KIHA 1YITZ 3I55Z 3CMEZ 3TE5B 5FLXb 1RO4A 3CCEZ 1YHQ1 4RS4A 3GCFA 3J80b 3S14I 4A3LI 1YIJZ 3K7AI 1Y1WI 2IZ3A 3HOVI 1ZH1A 2AYDA 2QRDB 1M901 3CCQ1 3S1MI 5IT9b 4A93I 1VQ81 3NH5A 5T67A 1Q862 1JWHC 3JAMf 3EERA 4BY7I 4NOZA 2W04A 3G4SZ 1Q861 3CCVZ 4DQYB 3PO2I 4Y7NI 5D1OB 5C4JI 1VQM1 3F3PC 5A2Qb 2JUBA 1YI2Z 2IZ4A 2JIQA 3MONA 2VPZA 2R92I 3G711 1TFIA 1VQKZ 1SIWA 5FLXf 3NFZA 1P9NA 3HOUI 1N2FA 1X3WA 1K83I 1S721 2JR6A 3CCR1 4A3CI 1KQSZ 3G6E1 1K732 3CC4Z 3GTMI 3H3VJ 3S2HI 5IT9f 2HU9A 1K731 1FDOA 1YJW1 1K9M2 2M6NA 2WAQA 3CPWZ 3CC2Z 3CXCZ 1KRLA 1QF8A 4MD7A 1K9M1 2J6AA 3P5JB 1TWHI 2OTLZ 1ZB9A 4A3GI 4MD9A 4NBHA 5A2Qf 2NVTI 3CCM1 3NH4A 3VMHA 1VQ61 2R6MA 2QA4Z 1ZB8A 3H0GI 3S1NI 1VQO1 1YJN1 2LIYA 4DGLA 1Z03A 3GTPI 3GTJI 4NFRA 3I561 2OZKA 1VQ41 4QTUA 2OTJ1 4HGYA 1NP6A 4NBFA 3JAMb 1Q16A 1RQFA 2QKDA 1VQL1 4E30A 1N8R2 2NVYI 2VPYA 1ML8A 3GTKI 3PO3S 2R7ZI 3CCLZ 1N8R1 1KD12 1QVFY 1USPA 1VQ51 5C3EI 3IX0A 1KD11 1JJ2Y 1VQN1 2I3CA 1TWCI 3CCS1 1TWAI 1VQ9Z 3OW2Z 4BXXI 4XX2A 2JA8I 1L1OC 1K8A2 3D6WA 2JS4A 3CCQZ 2QRCB 2QREB 3Q87A 1YUAA 1K8A1 2E7ZA 1VQ7Z 3EEDA 2O4HA 1VQ8Z 1VLAA 2DE7A 3I551 1YIT1 4BBRI 4MONA 3CME1 5IP9I 4NBBA 2V3VA 2LFUA 2BJOA 1YIJ1 3GTQI 3VMGA 1VQPZ 3IFUA 3HOWI 2M48A 4A3DI 3NDJA 2K5RA 1LQLA 2KPIA 4NBAA 1TWFI 2JIMA 1SFOI 1NJI2 3HOYI 2Q51A 3HKZA 3U50C 1USPB 3CCU1 1NJI1 4MXUA 3D2LA 2PM9A 2PMZA 5CM2M 4E33A 3CD61 2EGTA 3S15I 3MZLB 3ESWA 3CCV1 5D1PA 3CMAZ 1Z01A 1YI21 2P28A 4BBSI 4HH4A 4A3FI 1VQK1 1W2BY 3J81b 3GTLI 5T64A 1YUKA 3M3YI 3PO3I 2QLVB 2QEXZ 2HF1A 3CC71 2JA7I 2LEXA 1DL6A 1I50I 2E2JI 4A3EI 2JA6I 3T4NB 1WIIA 2F4OA 1Q822 5C44I 2F4MA 1Q7Y2 3BG1B 5T6BA 5FLMI 3GKQA 4A3KI 1RO2A 3CC41 1S7MA 1VQOZ 2OOYB 1YJNZ 1Q7Y1 3GTOI 1Y1VS 3FQMA 2V8IA 3I4NI 4S1TA 3CCJZ 1QVGY 2JA5I 2RPRA 2V8KA 1Y8CA 2DE5A 3CC21 4NBEA 4E32A 4QTTA 2NVXI 2PK7A 2RBLA 2V45A 5LL6f 2OTL1 1YJ9Z 3M4OI 2VF1A 3F3FC 2H85A 2VUGA 2Y0SA 1WJ2A 3D9XA 2B63I 5C4XI 2QA41 4CL1A 1VQ5Z 3J81f 1KC82 4NH1C 4TNUA 1KC81 1YHQZ 3CCSZ 2QR1B 4AYBA 3FQQA 3S1RI 2JMOA 4RVGA 3I07A 4RVDA 1RNIA 3CCL1 2AKLA 2VUMI 1I6HI 3S17I 2JIPA 3HOZI 2E9HA 3LUSA 3CCE1 1QVFZ 2G2KA 1M902 3S1QI 4RVHA 5IP7I 1VQMZ 2VPWA 3KIFA 1VQ91 4NBCA 1R9TI 2R93I 4NBGA 4EWCA 2GU2A 1JJ2Z 1WW9A 4RVFA 3G71Z 4E2YA 3HOXI 4A3MI 3S16I 1VQ71 2VPXA 1Q812 3CCUZ 1KQSY 2KI7B
chains in the Genus database with same CATH topology
1M1K2 4NB9A 3CD6Z 1Q811 1Y1VI 4X6AI 1S72Z 1X0TA 1M1K1 1RLYA 3CCRZ 2E2II 3G6EZ 1PFTA 3G4S1 3NDIA 4E2XA 1VQP1 3TDHB 1NUIA 3CPWY 3CXCY 3I4MI 2W03A 3RZDI 3GTGI 2E2HI 1YJWZ 4A3BI 4NBDA 3CC7Z 1RO0A 2Q4ZA 3J80f 2O53A 2YU9I 3VMIA 4E2ZA 1TWGI 3CCMZ 4A3JI 1VQ6Z 2GTHA 3MZKB 3BG0B 3QWUA 4A3II 3FKII 3CMA1 4HGZA 1Q821 2RHBA 1I3QI 2WB1A 2K3RA 3CQZI 2RT9A 4Y52I 3I56Z 5AN9F 2NVQI 4DK1A 2QEX1 4BY1I 1VQ4Z 2OTJZ 1Z02A 1QYPA 4NB8A 4E31A 1VQLZ 1W2BZ 2JNYA 2YADA 2OOXB 4MD8A 3VB9A 3RZOI 3OW2Y 2P3YA 2V8JA 3CCJ1 1VQNZ 3J7A4 4RV9A 3NH8A 3GTMS 2ZAEB 5D1OA 4MH4A 2DE6A 1WCMI 1QVGZ 1YJ91 1X3ZA 3VTNA 4E2WA 3S2DI 2GTIA 4MRIA 3IF8A 2RIQA 3KIHA 1YITZ 3I55Z 3CMEZ 3TE5B 5FLXb 1RO4A 3CCEZ 1YHQ1 4RS4A 3GCFA 3J80b 3S14I 4A3LI 1YIJZ 3K7AI 1Y1WI 2IZ3A 3HOVI 1ZH1A 2QRDB 1M901 3CCQ1 3S1MI 5IT9b 4A93I 1VQ81 3NH5A 5T67A 1Q862 1JWHC 3JAMf 3EERA 4BY7I 4NOZA 2W04A 3G4SZ 1Q861 3CCVZ 4DQYB 3PO2I 4Y7NI 5D1OB 5C4JI 1VQM1 3F3PC 5A2Qb 2JUBA 1YI2Z 2IZ4A 3MONA 2R92I 3G711 1TFIA 1VQKZ 5FLXf 3NFZA 1P9NA 3HOUI 1N2FA 1X3WA 1K83I 1S721 2JR6A 3CCR1 4A3CI 1KQSZ 3G6E1 1K732 3CC4Z 3GTMI 3H3VJ 3S2HI 5IT9f 2HU9A 1K731 1YJW1 1K9M2 2M6NA 2WAQA 3CPWZ 3CC2Z 4MD7A 1KRLA 1QF8A 3CXCZ 1K9M1 2J6AA 3P5JB 1TWHI 2OTLZ 1ZB9A 4A3GI 4MD9A 4NBHA 5A2Qf 2NVTI 3CCM1 3NH4A 3VMHA 1VQ61 2R6MA 2QA4Z 1ZB8A 3H0GI 3S1NI 1VQO1 1YJN1 2LIYA 4DGLA 1Z03A 3GTPI 3GTJI 4NFRA 3I561 2OZKA 1VQ41 4QTUA 2OTJ1 4HGYA 1NP6A 4NBFA 3JAMb 1RQFA 2QKDA 1VQL1 4E30A 1N8R2 2NVYI 1ML8A 3GTKI 3PO3S 2R7ZI 3CCLZ 1N8R1 1KD12 1QVFY 1USPA 1VQ51 5C3EI 3IX0A 1KD11 1JJ2Y 1VQN1 2I3CA 1TWCI 3CCS1 1TWAI 1VQ9Z 3OW2Z 4BXXI 4XX2A 2JA8I 1L1OC 1K8A2 3D6WA 2JS4A 3CCQZ 2QRCB 2QREB 3Q87A 1YUAA 1K8A1 1VQ7Z 3EEDA 2O4HA 1VQ8Z 1VLAA 2DE7A 3I551 1YIT1 4BBRI 4MONA 3CME1 5IP9I 4NBBA 2LFUA 2BJOA 1YIJ1 3GTQI 3VMGA 1VQPZ 3IFUA 3HOWI 2M48A 4A3DI 3NDJA 2K5RA 1LQLA 2KPIA 4NBAA 1TWFI 1SFOI 1NJI2 3HOYI 2Q51A 3HKZA 3U50C 1USPB 3CCU1 1NJI1 4MXUA 2PM9A 2PMZA 5CM2M 4E33A 3CD61 2EGTA 3S15I 3MZLB 3ESWA 3CCV1 5D1PA 3CMAZ 1Z01A 1YI21 2P28A 4BBSI 4HH4A 4A3FI 1VQK1 1W2BY 3J81b 3GTLI 5T64A 1YUKA 3M3YI 3PO3I 2QLVB 2QEXZ 2HF1A 3CC71 2JA7I 1DL6A 1I50I 2E2JI 4A3EI 2JA6I 3T4NB 1WIIA 2F4OA 1Q822 5C44I 2F4MA 1Q7Y2 3BG1B 5T6BA 5FLMI 3GKQA 4A3KI 1RO2A 3CC41 1S7MA 1VQOZ 2OOYB 1YJNZ 1Q7Y1 3GTOI 1Y1VS 3FQMA 2V8IA 3I4NI 4S1TA 3CCJZ 1QVGY 2JA5I 2RPRA 2V8KA 2DE5A 3CC21 4NBEA 4E32A 4QTTA 2NVXI 2PK7A 2RBLA 5LL6f 2OTL1 1YJ9Z 3M4OI 2VF1A 3F3FC 2H85A 2VUGA 2Y0SA 3D9XA 2B63I 5C4XI 2QA41 4CL1A 1VQ5Z 3J81f 1KC82 4NH1C 4TNUA 1KC81 1YHQZ 3CCSZ 2QR1B 4AYBA 3FQQA 3S1RI 2JMOA 4RVGA 3I07A 4RVDA 1RNIA 3CCL1 2AKLA 2VUMI 1I6HI 3S17I 3HOZI 2E9HA 3LUSA 3CCE1 1QVFZ 2G2KA 1M902 3S1QI 4RVHA 5IP7I 1VQMZ 1VQ91 3KIFA 4NBCA 1R9TI 2R93I 4NBGA 4EWCA 2GU2A 1JJ2Z 1WW9A 4RVFA 3G71Z 4E2YA 3HOXI 4A3MI 3S16I 1VQ71 1Q812 3CCUZ 1KQSY 2KI7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HF1 A;  4NB9 A;  1Y1V I;  4X6A I;  2JA7 I;  1DL6 A;  4QTU A;  3GCF A;  1I50 I;  3S14 I;  4A3L I;  1RLY A;  3K7A I;  2E2J I;  2E2I I;  1Y1W I;  4A3E I;  2JA6 I;  4NBF A;  1PFT A;  2F4O A;  5C44 I;  3HOV I;  2F4M A;  1NUI A;  4A3K I;  2NVY I;  5FLM I;  3GKQ A;  1ML8 A;  3GTK I;  3PO3 S;  3I4M I;  2R7Z I;  3S1M I;  3RZD I;  3GTG I;  3GTO I;  1Y1V S;  2E2H I;  4A3B I;  1USP A;  4A93 I;  3I4N I;  4NBD A;  2JA5 I;  5C3E I;  2DE5 A;  4NBE A;  2YU9 I;  4QTT A;  3VMI A;  2PK7 A;  2RBL A;  2NVX I;  3EER A;  1TWC I;  4BY7 I;  4NOZ A;  1TWA I;  3M4O I;  1TWG I;  4BXX I;  4A3J I;  4XX2 A;  2JA8 I;  4Y7N I;  3PO2 I;  1L1O C;  5C4J I;  3D6W A;  2JS4 A;  2B63 I;  4A3I I;  5C4X I;  3Q87 A;  3FKI I;  1YUA A;  2R92 I;  1TFI A;  1I3Q I;  1VLA A;  2DE7 A;  3CQZ I;  4BBR I;  4Y52 I;  5IP9 I;  3HOU I;  2NVQ I;  4NBB A;  4BY1 I;  1N2F A;  1QYP A;  1X3W A;  1K83 I;  4NB8 A;  2BJO A;  2JR6 A;  3GTQ I;  3VMG A;  4A3C I;  3S1R I;  3HOW I;  3GTM I;  3H3V J;  2JNY A;  3S2H I;  3I07 A;  4A3D I;  2K5R A;  1LQL A;  2AKL A;  2KPI A;  4NBA A;  1TWF I;  3VB9 A;  1SFO I;  3HOY I;  3RZO I;  2VUM I;  2P3Y A;  1I6H I;  3S17 I;  3U50 C;  1USP B;  3HOZ I;  3LUS A;  2J6A A;  5CM2 M;  1TWH I;  3GTM S;  1ZB9 A;  4A3G I;  3S15 I;  3S1Q I;  4MH4 A;  2DE6 A;  1WCM I;  4NBH A;  5IP7 I;  2NVT I;  3ESW A;  4NBC A;  1X3Z A;  1R9T I;  4NBG A;  2R93 I;  3VMH A;  3S2D I;  1WW9 A;  1ZB8 A;  4BBS I;  3H0G I;  3S1N I;  4A3F I;  3HOX I;  4A3M I;  3S16 I;  3GTP I;  3GTL I;  3PO3 I;  3M3Y I;  1RO4 A;  3GTJ I; 
#chains in the Genus database with same CATH topology
 1M1K 2;  4NB9 A;  3CD6 Z;  1Q81 1;  1Y1V I;  4X6A I;  1S72 Z;  1X0T A;  1M1K 1;  1RLY A;  3CCR Z;  2E2I I;  3G6E Z;  1PFT A;  3G4S 1;  3NDI A;  4E2X A;  1VQP 1;  3TDH B;  1NUI A;  3CPW Y;  3CXC Y;  3I4M I;  2W03 A;  3RZD I;  3GTG I;  2NAP A;  1AA6 A;  2E2H I;  1YJW Z;  4A3B I;  4NBD A;  3CC7 Z;  1RO0 A;  2Q4Z A;  1QXF A;  3J80 f;  2O53 A;  2YU9 I;  3VMI A;  4E2Z A;  1FDI A;  1TWG I;  3CCM Z;  4A3J I;  1VQ6 Z;  2GTH A;  3MZK B;  3BG0 B;  3QWU A;  4A3I I;  3FKI I;  3CMA 1;  4HGZ A;  1Q82 1;  2RHB A;  1I3Q I;  2WB1 A;  2K3R A;  3CQZ I;  2RT9 A;  4Y52 I;  3I56 Z;  5AN9 F;  2NVQ I;  4DK1 A;  2QEX 1;  4BY1 I;  3IR7 A;  1VQ4 Z;  1WZN A;  2IV2 X;  2OTJ Z;  1Z02 A;  1QYP A;  4NB8 A;  4E31 A;  1VQL Z;  1W2B Z;  2JIR A;  2JIO A;  2JNY A;  2YAD A;  2OOX B;  4MD8 A;  3VB9 A;  3RZO I;  3OW2 Y;  2P3Y A;  2V8J A;  3CCJ 1;  1VQN Z;  3J7A 4;  4RV9 A;  3NH8 A;  3GTM S;  2ZAE B;  5D1O A;  4MH4 A;  2DE6 A;  1WCM I;  1QVG Z;  1YJ9 1;  1X3Z A;  3VTN A;  4E2W A;  3S2D I;  2GTI A;  4MRI A;  3IF8 A;  2RIQ A;  3KIH A;  1YIT Z;  3I55 Z;  3CME Z;  3TE5 B;  5FLX b;  1RO4 A;  3CCE Z;  1YHQ 1;  4RS4 A;  3GCF A;  3J80 b;  3S14 I;  4A3L I;  1YIJ Z;  3K7A I;  1Y1W I;  2IZ3 A;  3HOV I;  1ZH1 A;  2AYD A;  2QRD B;  1M90 1;  3CCQ 1;  3S1M I;  5IT9 b;  4A93 I;  1VQ8 1;  3NH5 A;  5T67 A;  1Q86 2;  1JWH C;  3JAM f;  3EER A;  4BY7 I;  4NOZ A;  2W04 A;  3G4S Z;  1Q86 1;  3CCV Z;  4DQY B;  3PO2 I;  4Y7N I;  5D1O B;  5C4J I;  1VQM 1;  3F3P C;  5A2Q b;  2JUB A;  1YI2 Z;  2IZ4 A;  2JIQ A;  3MON A;  2VPZ A;  2R92 I;  3G71 1;  1TFI A;  1VQK Z;  1SIW A;  5FLX f;  3NFZ A;  1P9N A;  3HOU I;  1N2F A;  1X3W A;  1K83 I;  1S72 1;  2JR6 A;  3CCR 1;  4A3C I;  1KQS Z;  3G6E 1;  1K73 2;  3CC4 Z;  3GTM I;  3H3V J;  3S2H I;  5IT9 f;  2HU9 A;  1K73 1;  1FDO A;  1YJW 1;  1K9M 2;  2M6N A;  2WAQ A;  3CPW Z;  3CC2 Z;  3CXC Z;  1KRL A;  1QF8 A;  4MD7 A;  1K9M 1;  2J6A A;  3P5J B;  1TWH I;  2OTL Z;  1ZB9 A;  4A3G I;  4MD9 A;  4NBH A;  5A2Q f;  2NVT I;  3CCM 1;  3NH4 A;  3VMH A;  1VQ6 1;  2R6M A;  2QA4 Z;  1ZB8 A;  3H0G I;  3S1N I;  1VQO 1;  1YJN 1;  2LIY A;  4DGL A;  1Z03 A;  3GTP I;  3GTJ I;  4NFR A;  3I56 1;  2OZK A;  1VQ4 1;  4QTU A;  2OTJ 1;  4HGY A;  1NP6 A;  4NBF A;  3JAM b;  1Q16 A;  1RQF A;  2QKD A;  1VQL 1;  4E30 A;  1N8R 2;  2NVY I;  2VPY A;  1ML8 A;  3GTK I;  3PO3 S;  2R7Z I;  3CCL Z;  1N8R 1;  1KD1 2;  1QVF Y;  1USP A;  1VQ5 1;  5C3E I;  3IX0 A;  1KD1 1;  1JJ2 Y;  1VQN 1;  2I3C A;  1TWC I;  3CCS 1;  1TWA I;  1VQ9 Z;  3OW2 Z;  4BXX I;  4XX2 A;  2JA8 I;  1L1O C;  1K8A 2;  3D6W A;  2JS4 A;  3CCQ Z;  2QRC B;  2QRE B;  3Q87 A;  1YUA A;  1K8A 1;  2E7Z A;  1VQ7 Z;  3EED A;  2O4H A;  1VQ8 Z;  1VLA A;  2DE7 A;  3I55 1;  1YIT 1;  4BBR I;  4MON A;  3CME 1;  5IP9 I;  4NBB A;  2V3V A;  2LFU A;  2BJO A;  1YIJ 1;  3GTQ I;  3VMG A;  1VQP Z;  3IFU A;  3HOW I;  2M48 A;  4A3D I;  3NDJ A;  2K5R A;  1LQL A;  2KPI A;  4NBA A;  1TWF I;  2JIM A;  1SFO I;  1NJI 2;  3HOY I;  2Q51 A;  3HKZ A;  3U50 C;  1USP B;  3CCU 1;  1NJI 1;  4MXU A;  3D2L A;  2PM9 A;  2PMZ A;  5CM2 M;  4E33 A;  3CD6 1;  2EGT A;  3S15 I;  3MZL B;  3ESW A;  3CCV 1;  5D1P A;  3CMA Z;  1Z01 A;  1YI2 1;  2P28 A;  4BBS I;  4HH4 A;  4A3F I;  1VQK 1;  1W2B Y;  3J81 b;  3GTL I;  5T64 A;  1YUK A;  3M3Y I;  3PO3 I;  2QLV B;  2QEX Z;  2HF1 A;  3CC7 1;  2JA7 I;  2LEX A;  1DL6 A;  1I50 I;  2E2J I;  4A3E I;  2JA6 I;  3T4N B;  1WII A;  2F4O A;  1Q82 2;  5C44 I;  2F4M A;  1Q7Y 2;  3BG1 B;  5T6B A;  5FLM I;  3GKQ A;  4A3K I;  1RO2 A;  3CC4 1;  1S7M A;  1VQO Z;  2OOY B;  1YJN Z;  1Q7Y 1;  3GTO I;  1Y1V S;  3FQM A;  2V8I A;  3I4N I;  4S1T A;  3CCJ Z;  1QVG Y;  2JA5 I;  2RPR A;  2V8K A;  1Y8C A;  2DE5 A;  3CC2 1;  4NBE A;  4E32 A;  4QTT A;  2NVX I;  2PK7 A;  2RBL A;  2V45 A;  5LL6 f;  2OTL 1;  1YJ9 Z;  3M4O I;  2VF1 A;  3F3F C;  2H85 A;  2VUG A;  2Y0S A;  1WJ2 A;  3D9X A;  2B63 I;  5C4X I;  2QA4 1;  4CL1 A;  1VQ5 Z;  3J81 f;  1KC8 2;  4NH1 C;  4TNU A;  1KC8 1;  1YHQ Z;  3CCS Z;  2QR1 B;  4AYB A;  3FQQ A;  3S1R I;  2JMO A;  4RVG A;  3I07 A;  4RVD A;  1RNI A;  3CCL 1;  2AKL A;  2VUM I;  1I6H I;  3S17 I;  2JIP A;  3HOZ I;  2E9H A;  3LUS A;  3CCE 1;  1QVF Z;  2G2K A;  1M90 2;  3S1Q I;  4RVH A;  5IP7 I;  1VQM Z;  2VPW A;  3KIF A;  1VQ9 1;  4NBC A;  1R9T I;  2R93 I;  4NBG A;  4EWC A;  2GU2 A;  1JJ2 Z;  1WW9 A;  4RVF A;  3G71 Z;  4E2Y A;  3HOX I;  4A3M I;  3S16 I;  1VQ7 1;  2VPX A;  1Q81 2;  3CCU Z;  1KQS Y;  2KI7 B; 
#chains in the Genus database with same CATH homology
 1M1K 2;  4NB9 A;  3CD6 Z;  1Q81 1;  1Y1V I;  4X6A I;  1S72 Z;  1X0T A;  1M1K 1;  1RLY A;  3CCR Z;  2E2I I;  3G6E Z;  1PFT A;  3G4S 1;  3NDI A;  4E2X A;  1VQP 1;  3TDH B;  1NUI A;  3CPW Y;  3CXC Y;  3I4M I;  2W03 A;  3RZD I;  3GTG I;  2E2H I;  1YJW Z;  4A3B I;  4NBD A;  3CC7 Z;  1RO0 A;  2Q4Z A;  3J80 f;  2O53 A;  2YU9 I;  3VMI A;  4E2Z A;  1TWG I;  3CCM Z;  4A3J I;  1VQ6 Z;  2GTH A;  3MZK B;  3BG0 B;  3QWU A;  4A3I I;  3FKI I;  3CMA 1;  4HGZ A;  1Q82 1;  2RHB A;  1I3Q I;  2WB1 A;  2K3R A;  3CQZ I;  2RT9 A;  4Y52 I;  3I56 Z;  5AN9 F;  2NVQ I;  4DK1 A;  2QEX 1;  4BY1 I;  1VQ4 Z;  2OTJ Z;  1Z02 A;  1QYP A;  4NB8 A;  4E31 A;  1VQL Z;  1W2B Z;  2JNY A;  2YAD A;  2OOX B;  4MD8 A;  3VB9 A;  3RZO I;  3OW2 Y;  2P3Y A;  2V8J A;  3CCJ 1;  1VQN Z;  3J7A 4;  4RV9 A;  3NH8 A;  3GTM S;  2ZAE B;  5D1O A;  4MH4 A;  2DE6 A;  1WCM I;  1QVG Z;  1YJ9 1;  1X3Z A;  3VTN A;  4E2W A;  3S2D I;  2GTI A;  4MRI A;  3IF8 A;  2RIQ A;  3KIH A;  1YIT Z;  3I55 Z;  3CME Z;  3TE5 B;  5FLX b;  1RO4 A;  3CCE Z;  1YHQ 1;  4RS4 A;  3GCF A;  3J80 b;  3S14 I;  4A3L I;  1YIJ Z;  3K7A I;  1Y1W I;  2IZ3 A;  3HOV I;  1ZH1 A;  2QRD B;  1M90 1;  3CCQ 1;  3S1M I;  5IT9 b;  4A93 I;  1VQ8 1;  3NH5 A;  5T67 A;  1Q86 2;  1JWH C;  3JAM f;  3EER A;  4BY7 I;  4NOZ A;  2W04 A;  3G4S Z;  1Q86 1;  3CCV Z;  4DQY B;  3PO2 I;  4Y7N I;  5D1O B;  5C4J I;  1VQM 1;  3F3P C;  5A2Q b;  2JUB A;  1YI2 Z;  2IZ4 A;  3MON A;  2R92 I;  3G71 1;  1TFI A;  1VQK Z;  5FLX f;  3NFZ A;  1P9N A;  3HOU I;  1N2F A;  1X3W A;  1K83 I;  1S72 1;  2JR6 A;  3CCR 1;  4A3C I;  1KQS Z;  3G6E 1;  1K73 2;  3CC4 Z;  3GTM I;  3H3V J;  3S2H I;  5IT9 f;  2HU9 A;  1K73 1;  1YJW 1;  1K9M 2;  2M6N A;  2WAQ A;  3CPW Z;  3CC2 Z;  4MD7 A;  1KRL A;  1QF8 A;  3CXC Z;  1K9M 1;  2J6A A;  3P5J B;  1TWH I;  2OTL Z;  1ZB9 A;  4A3G I;  4MD9 A;  4NBH A;  5A2Q f;  2NVT I;  3CCM 1;  3NH4 A;  3VMH A;  1VQ6 1;  2R6M A;  2QA4 Z;  1ZB8 A;  3H0G I;  3S1N I;  1VQO 1;  1YJN 1;  2LIY A;  4DGL A;  1Z03 A;  3GTP I;  3GTJ I;  4NFR A;  3I56 1;  2OZK A;  1VQ4 1;  4QTU A;  2OTJ 1;  4HGY A;  1NP6 A;  4NBF A;  3JAM b;  1RQF A;  2QKD A;  1VQL 1;  4E30 A;  1N8R 2;  2NVY I;  1ML8 A;  3GTK I;  3PO3 S;  2R7Z I;  3CCL Z;  1N8R 1;  1KD1 2;  1QVF Y;  1USP A;  1VQ5 1;  5C3E I;  3IX0 A;  1KD1 1;  1JJ2 Y;  1VQN 1;  2I3C A;  1TWC I;  3CCS 1;  1TWA I;  1VQ9 Z;  3OW2 Z;  4BXX I;  4XX2 A;  2JA8 I;  1L1O C;  1K8A 2;  3D6W A;  2JS4 A;  3CCQ Z;  2QRC B;  2QRE B;  3Q87 A;  1YUA A;  1K8A 1;  1VQ7 Z;  3EED A;  2O4H A;  1VQ8 Z;  1VLA A;  2DE7 A;  3I55 1;  1YIT 1;  4BBR I;  4MON A;  3CME 1;  5IP9 I;  4NBB A;  2LFU A;  2BJO A;  1YIJ 1;  3GTQ I;  3VMG A;  1VQP Z;  3IFU A;  3HOW I;  2M48 A;  4A3D I;  3NDJ A;  2K5R A;  1LQL A;  2KPI A;  4NBA A;  1TWF I;  1SFO I;  1NJI 2;  3HOY I;  2Q51 A;  3HKZ A;  3U50 C;  1USP B;  3CCU 1;  1NJI 1;  4MXU A;  2PM9 A;  2PMZ A;  5CM2 M;  4E33 A;  3CD6 1;  2EGT A;  3S15 I;  3MZL B;  3ESW A;  3CCV 1;  5D1P A;  3CMA Z;  1Z01 A;  1YI2 1;  2P28 A;  4BBS I;  4HH4 A;  4A3F I;  1VQK 1;  1W2B Y;  3J81 b;  3GTL I;  5T64 A;  1YUK A;  3M3Y I;  3PO3 I;  2QLV B;  2QEX Z;  2HF1 A;  3CC7 1;  2JA7 I;  1DL6 A;  1I50 I;  2E2J I;  4A3E I;  2JA6 I;  3T4N B;  1WII A;  2F4O A;  1Q82 2;  5C44 I;  2F4M A;  1Q7Y 2;  3BG1 B;  5T6B A;  5FLM I;  3GKQ A;  4A3K I;  1RO2 A;  3CC4 1;  1S7M A;  1VQO Z;  2OOY B;  1YJN Z;  1Q7Y 1;  3GTO I;  1Y1V S;  3FQM A;  2V8I A;  3I4N I;  4S1T A;  3CCJ Z;  1QVG Y;  2JA5 I;  2RPR A;  2V8K A;  2DE5 A;  3CC2 1;  4NBE A;  4E32 A;  4QTT A;  2NVX I;  2PK7 A;  2RBL A;  5LL6 f;  2OTL 1;  1YJ9 Z;  3M4O I;  2VF1 A;  3F3F C;  2H85 A;  2VUG A;  2Y0S A;  3D9X A;  2B63 I;  5C4X I;  2QA4 1;  4CL1 A;  1VQ5 Z;  3J81 f;  1KC8 2;  4NH1 C;  4TNU A;  1KC8 1;  1YHQ Z;  3CCS Z;  2QR1 B;  4AYB A;  3FQQ A;  3S1R I;  2JMO A;  4RVG A;  3I07 A;  4RVD A;  1RNI A;  3CCL 1;  2AKL A;  2VUM I;  1I6H I;  3S17 I;  3HOZ I;  2E9H A;  3LUS A;  3CCE 1;  1QVF Z;  2G2K A;  1M90 2;  3S1Q I;  4RVH A;  5IP7 I;  1VQM Z;  1VQ9 1;  3KIF A;  4NBC A;  1R9T I;  2R93 I;  4NBG A;  4EWC A;  2GU2 A;  1JJ2 Z;  1WW9 A;  4RVF A;  3G71 Z;  4E2Y A;  3HOX I;  4A3M I;  3S16 I;  1VQ7 1;  1Q81 2;  3CCU Z;  1KQS Y;  2KI7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...