1KRLA

Crystal structure of racemic dl-monellin in p-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural differences in D and L-monellin in the crystals of racemic mixture.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
molecule keywords MONELLIN, CHAIN A
total genus 7
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1krlA00
1KRLA 4MONA 3MONA
chains in the Genus database with same CATH superfamily
1YJ91 2E2JI 2H85A 2P3YA 3QWUA 2VPZA 5AN9F 1YIJZ 1VQ81 3G6EZ 2PK7A 1VQ51 3CCU1 1K9M1 1LQLA 2LEXA 2R93I 3HOVI 2OOYB 2JA5I 4NOZA 4E2XA 1YITZ 2JS4A 2QREB 4BXXI 3KIFA 1ML8A 3CC4Z 3CD61 4BBRI 1VQL1 1RO2A 4A3BI 2HU9A 4BBSI 2M6NA 4RV9A 3CCE1 1WIIA 2RIQA 3CCJZ 1M1K2 2JA7I 1Q7Y1 1VQO1 5FLMI 2KPIA 4E2YA 3MZLB 3CCQZ 2IZ3A 3LUSA 1VQN1 3CCRZ 3HOWI 3CPWY 1M1K1 3J81b 3NH5A 4MXUA 3J80f 2DE6A 1SIWA 1Y1WI 1QF8A 2K3RA 3ESWA 1L1OC 1YJW1 3TE5B 2GTHA 3GTPI 4RVFA 1VQ41 3GCFA 1K83I 4NBDA 1KC82 2LIYA 1YUAA 1S721 1M901 1VQ91 5T6BA 4A3DI 3S1RI 3VMGA 2W04A 1VQ9Z 1WJ2A 1W2BZ 1JWHC 4HGYA 1YUKA 5A2Qf 2Q51A 1NUIA 4A3MI 4S1TA 2E2HI 3HKZA 2JUBA 2EGTA 2HF1A 2B63I 2IV2X 3D6WA 1Q861 2VUGA 3CCUZ 1Q862 1N2FA 1K8A2 5IT9b 1Z03A 4NBCA 2R92I 2P28A 4NBEA 3HOYI 2JIOA 4NBGA 1Z01A 3CCS1 3VTNA 1RO4A 4MH4A 1N8R1 1M902 1YI2Z 1Y1VS 4NB8A 3IX0A 1VQLZ 1VLAA 3OW2Y 2PM9A 3CCEZ 1AA6A 3VMHA 1FDOA 1X3WA 1USPA 2NVYI 3F3PC 2E7ZA 1VQKZ 3IFUA 2V8JA 2QEX1 1YHQZ 2I3CA 3CQZI 1VQOZ 3GTGI 1X3ZA 2AYDA 1TWHI 2QA41 1PFTA 2RT9A 1YJ9Z 1TWGI 1FDIA 3GTQI 3OW2Z 3GTMI 3S2DI 4A3II 3CC2Z 3CCMZ 1JJ2Y 1Q7Y2 2OTJ1 3S16I 4QTUA 1R9TI 1QVGZ 3BG0B 3RZOI 3FQMA 1Y1VI 3S1NI 1YHQ1 4E31A 4RVHA 4Y7NI 1YIT1 2JIPA 2M48A 3NH8A 5FLXb 3I55Z 1YJNZ 2DE7A 3IR7A 3JAMb 1QVGY 1YJN1 1ZB9A 4MRIA 3NH4A 2J6AA 4MD9A 5T67A 3NDIA 3I4MI 1YIJ1 3NFZA 2VPYA 3CME1 2GTIA 4HH4A 1KQSY 3CCJ1 3CMEZ 1KD12 4NB9A 3CPWZ 3CCV1 3CMA1 3M4OI 3NDJA 4NBAA 3EERA 1ZB8A 1X0TA 1K9M2 2QR1B 3VMIA 1VQMZ 4RVGA 1KD11 1RNIA 3CCL1 3CC7Z 1NJI1 2WB1A 3MZKB 3U50C 3CCLZ 2QEXZ 2OTLZ 2V8KA 5IP9I 4A3FI 3GKQA 4QTTA 2E9HA 2OOXB 2QKDA 3CCR1 1W2BY 1RO0A 3S1MI 2F4MA 2QRDB 4AYBA 5LL6f 1N8R2 3Q87A 1WZNA 1TWAI 2JA6I 2W03A 2JA8I 3M3YI 2V45A 3FQQA 1WCMI 1I3QI 3S1QI 2JR6A 3CC21 5T64A 2K5RA 1RQFA 4E30A 1P9NA 3CCM1 1Q812 2R7ZI 1VQPZ 2WAQA 1Q16A 3S15I 3GTJI 3G6E1 1KRLA 4A3EI 2PMZA 2GU2A 4NH1C 5D1OA 3T4NB 3S17I 2JNYA 5CM2M 3PO3I 3J81f 3H3VJ 1QVFZ 1SFOI 1NP6A 3TDHB 3CD6Z 4BY7I 3CC41 3GTMS 1S7MA 3RZDI 3CXCZ 1USPB 2JIRA 3VB9A 2F4OA 3KIHA 3IF8A 4EWCA 4DGLA 4A3CI 5C4JI 1K8A1 1VQNZ 1QYPA 3CCVZ 3PO2I 3I56Z 2V3VA 1K732 2VPWA 3J80b 3G4SZ 3HOUI 3EEDA 3I07A 3S14I 3G4S1 4CL1A 2RBLA 1JJ2Z 5A2Qb 4A3LI 3CC71 4MONA 4TNUA 1VQK1 1KC81 2ZAEB 4A3KI 2V8IA 2VUMI 1S72Z 5FLXf 4Y52I 2OTL1 5IT9f 4NBBA 1YJWZ 2QA4Z 4A3GI 1KQSZ 2R6MA 4NBHA 2VF1A 1VQ7Z 1TWFI 2O53A 2VPXA 1K731 1VQ71 2AKLA 4E33A 5D1OB 1VQ8Z 1I6HI 3P5JB 1I50I 1WW9A 5C44I 1QVFY 2JIQA 2O4HA 2Q4ZA 4NBFA 5D1PA 4A3JI 1VQP1 1NJI2 3D2LA 3GTKI 2NVTI 3CCSZ 2OTJZ 2JMOA 3CMAZ 3BG1B 4MD7A 3F3FC 5C3EI 3J7A4 1TWCI 1VQ5Z 5IP7I 4MD8A 4HGZA 1Q822 2DE5A 2KI7B 2E2II 3HOZI 1Q811 2QRCB 1VQ6Z 4E2WA 4E2ZA 3PO3S 1ZH1A 3I4NI 3JAMf 4RS4A 3MONA 2Y0SA 2RHBA 4RVDA 4DQYB 1VQ61 3H0GI 4XX2A 2QLVB 3CCQ1 3FKII 1YI21 3CXCY 4DK1A 1Y8CA 3I561 2RPRA 4NFRA 2YADA 3S2HI 1VQM1 3G71Z 2IZ4A 1QXFA 2JIMA 2NVQI 2NVXI 1VQ4Z 4X6AI 3D9XA 2YU9I 3K7AI 2NAPA 3GTOI 3GTLI 1Z02A 2BJOA 1RLYA 2LFUA 4A93I 3HOXI 4BY1I 2G2KA 1Q821 1TFIA 3G711 3I551 1DL6A 5C4XI 2OZKA 4E32A
chains in the Genus database with same CATH topology
1YJ91 2E2JI 2H85A 2P3YA 3QWUA 5AN9F 1YIJZ 1VQ81 3G6EZ 2PK7A 1VQ51 3CCU1 1K9M1 1LQLA 2R93I 3HOVI 2OOYB 2JA5I 4NOZA 4E2XA 1YITZ 2JS4A 2QREB 4BXXI 3KIFA 1ML8A 3CC4Z 3CD61 4BBRI 1VQL1 1RO2A 4A3BI 2HU9A 4BBSI 2M6NA 4RV9A 3CCE1 1WIIA 2RIQA 3CCJZ 1M1K2 2JA7I 1Q7Y1 1VQO1 5FLMI 2KPIA 4E2YA 3MZLB 3CCQZ 2IZ3A 3LUSA 1VQN1 3CCRZ 3HOWI 3CPWY 1M1K1 3J81b 3NH5A 4MXUA 3J80f 2DE6A 1Y1WI 1QF8A 2K3RA 3ESWA 1L1OC 1YJW1 3TE5B 2GTHA 3GTPI 4RVFA 1VQ41 3GCFA 1K83I 4NBDA 1KC82 2LIYA 1YUAA 1S721 1M901 1VQ91 5T6BA 4A3DI 3S1RI 3VMGA 2W04A 1VQ9Z 1W2BZ 1JWHC 4HGYA 1YUKA 5A2Qf 2Q51A 1NUIA 4A3MI 4S1TA 2E2HI 3HKZA 2JUBA 2EGTA 2HF1A 2B63I 3D6WA 1Q861 2VUGA 3CCUZ 1Q862 1N2FA 1K8A2 5IT9b 1Z03A 4NBCA 2R92I 2P28A 4NBEA 3HOYI 4NBGA 1Z01A 3CCS1 3VTNA 1RO4A 4MH4A 1N8R1 1M902 1YI2Z 1Y1VS 4NB8A 3IX0A 1VQLZ 1VLAA 3OW2Y 2PM9A 3CCEZ 3VMHA 1X3WA 1USPA 2NVYI 3F3PC 1VQKZ 3IFUA 2V8JA 2QEX1 1YHQZ 2I3CA 3CQZI 1VQOZ 3GTGI 1X3ZA 1TWHI 2QA41 1PFTA 2RT9A 1YJ9Z 1TWGI 3GTQI 3OW2Z 3GTMI 3S2DI 4A3II 3CC2Z 3CCMZ 1JJ2Y 1Q7Y2 2OTJ1 3S16I 4QTUA 1R9TI 1QVGZ 3BG0B 3RZOI 3FQMA 1Y1VI 3S1NI 1YHQ1 4E31A 4RVHA 4Y7NI 1YIT1 2M48A 3NH8A 5FLXb 3I55Z 1YJNZ 2DE7A 3JAMb 1QVGY 1YJN1 1ZB9A 4MRIA 3NH4A 2J6AA 4MD9A 5T67A 3NDIA 3I4MI 1YIJ1 3NFZA 3CME1 2GTIA 4HH4A 1KQSY 3CCJ1 3CMEZ 1KD12 4NB9A 3CPWZ 3CCV1 3CMA1 3M4OI 3NDJA 4NBAA 3EERA 1ZB8A 1X0TA 1K9M2 2QR1B 3VMIA 1VQMZ 4RVGA 1KD11 1RNIA 3CCL1 3CC7Z 1NJI1 2WB1A 3MZKB 3U50C 3CCLZ 2QEXZ 2OTLZ 2V8KA 5IP9I 4A3FI 3GKQA 4QTTA 2E9HA 2OOXB 2QKDA 3CCR1 1W2BY 1RO0A 3S1MI 2F4MA 2QRDB 4AYBA 5LL6f 1N8R2 3Q87A 1TWAI 2JA6I 2W03A 2JA8I 3M3YI 3FQQA 1WCMI 1I3QI 3S1QI 2JR6A 3CC21 5T64A 2K5RA 1RQFA 4E30A 1P9NA 3CCM1 1Q812 2R7ZI 1VQPZ 2WAQA 3S15I 3GTJI 3G6E1 1KRLA 4A3EI 2PMZA 2GU2A 4NH1C 5D1OA 3T4NB 3S17I 2JNYA 5CM2M 3PO3I 3J81f 3H3VJ 1QVFZ 1SFOI 1NP6A 3TDHB 3CD6Z 4BY7I 3CC41 3GTMS 1S7MA 3RZDI 3CXCZ 1USPB 3VB9A 2F4OA 3KIHA 3IF8A 4EWCA 4DGLA 4A3CI 5C4JI 1K8A1 1VQNZ 1QYPA 3CCVZ 3PO2I 3I56Z 1K732 3J80b 3G4SZ 3HOUI 3EEDA 3I07A 3S14I 3G4S1 4CL1A 2RBLA 1JJ2Z 5A2Qb 4A3LI 3CC71 4MONA 4TNUA 1VQK1 1KC81 2ZAEB 4A3KI 2V8IA 2VUMI 1S72Z 5FLXf 4Y52I 2OTL1 5IT9f 4NBBA 1YJWZ 2QA4Z 4A3GI 1KQSZ 2R6MA 4NBHA 2VF1A 1VQ7Z 1TWFI 2O53A 1K731 1VQ71 2AKLA 4E33A 5D1OB 1VQ8Z 1I6HI 3P5JB 1I50I 1WW9A 5C44I 1QVFY 2Q4ZA 2O4HA 4NBFA 5D1PA 4A3JI 1VQP1 1NJI2 3GTKI 2NVTI 3CCSZ 2OTJZ 2JMOA 3CMAZ 3BG1B 4MD7A 3F3FC 5C3EI 3J7A4 1TWCI 1VQ5Z 5IP7I 4MD8A 4HGZA 1Q822 2DE5A 2KI7B 2E2II 3HOZI 1Q811 2QRCB 1VQ6Z 4E2WA 4E2ZA 3PO3S 1ZH1A 3I4NI 3JAMf 4RS4A 3MONA 2Y0SA 2RHBA 4RVDA 4DQYB 1VQ61 3H0GI 4XX2A 2QLVB 3CCQ1 3FKII 1YI21 3CXCY 4DK1A 3I561 2RPRA 4NFRA 2YADA 3S2HI 1VQM1 3G71Z 2IZ4A 2NVQI 2NVXI 1VQ4Z 4X6AI 3D9XA 2YU9I 3K7AI 3GTOI 3GTLI 1Z02A 2BJOA 1RLYA 2LFUA 4A93I 3HOXI 4BY1I 2G2KA 1Q821 1TFIA 3G711 3I551 1DL6A 5C4XI 2OZKA 4E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRL A;  4MON A;  3MON A; 
#chains in the Genus database with same CATH topology
 1YJ9 1;  2E2J I;  2H85 A;  2P3Y A;  3QWU A;  2VPZ A;  5AN9 F;  1YIJ Z;  1VQ8 1;  3G6E Z;  2PK7 A;  1VQ5 1;  3CCU 1;  1K9M 1;  1LQL A;  2LEX A;  2R93 I;  3HOV I;  2OOY B;  2JA5 I;  4NOZ A;  4E2X A;  1YIT Z;  2JS4 A;  2QRE B;  4BXX I;  3KIF A;  1ML8 A;  3CC4 Z;  3CD6 1;  4BBR I;  1VQL 1;  1RO2 A;  4A3B I;  2HU9 A;  4BBS I;  2M6N A;  4RV9 A;  3CCE 1;  1WII A;  2RIQ A;  3CCJ Z;  1M1K 2;  2JA7 I;  1Q7Y 1;  1VQO 1;  5FLM I;  2KPI A;  4E2Y A;  3MZL B;  3CCQ Z;  2IZ3 A;  3LUS A;  1VQN 1;  3CCR Z;  3HOW I;  3CPW Y;  1M1K 1;  3J81 b;  3NH5 A;  4MXU A;  3J80 f;  2DE6 A;  1SIW A;  1Y1W I;  1QF8 A;  2K3R A;  3ESW A;  1L1O C;  1YJW 1;  3TE5 B;  2GTH A;  3GTP I;  4RVF A;  1VQ4 1;  3GCF A;  1K83 I;  4NBD A;  1KC8 2;  2LIY A;  1YUA A;  1S72 1;  1M90 1;  1VQ9 1;  5T6B A;  4A3D I;  3S1R I;  3VMG A;  2W04 A;  1VQ9 Z;  1WJ2 A;  1W2B Z;  1JWH C;  4HGY A;  1YUK A;  5A2Q f;  2Q51 A;  1NUI A;  4A3M I;  4S1T A;  2E2H I;  3HKZ A;  2JUB A;  2EGT A;  2HF1 A;  2B63 I;  2IV2 X;  3D6W A;  1Q86 1;  2VUG A;  3CCU Z;  1Q86 2;  1N2F A;  1K8A 2;  5IT9 b;  1Z03 A;  4NBC A;  2R92 I;  2P28 A;  4NBE A;  3HOY I;  2JIO A;  4NBG A;  1Z01 A;  3CCS 1;  3VTN A;  1RO4 A;  4MH4 A;  1N8R 1;  1M90 2;  1YI2 Z;  1Y1V S;  4NB8 A;  3IX0 A;  1VQL Z;  1VLA A;  3OW2 Y;  2PM9 A;  3CCE Z;  1AA6 A;  3VMH A;  1FDO A;  1X3W A;  1USP A;  2NVY I;  3F3P C;  2E7Z A;  1VQK Z;  3IFU A;  2V8J A;  2QEX 1;  1YHQ Z;  2I3C A;  3CQZ I;  1VQO Z;  3GTG I;  1X3Z A;  2AYD A;  1TWH I;  2QA4 1;  1PFT A;  2RT9 A;  1YJ9 Z;  1TWG I;  1FDI A;  3GTQ I;  3OW2 Z;  3GTM I;  3S2D I;  4A3I I;  3CC2 Z;  3CCM Z;  1JJ2 Y;  1Q7Y 2;  2OTJ 1;  3S16 I;  4QTU A;  1R9T I;  1QVG Z;  3BG0 B;  3RZO I;  3FQM A;  1Y1V I;  3S1N I;  1YHQ 1;  4E31 A;  4RVH A;  4Y7N I;  1YIT 1;  2JIP A;  2M48 A;  3NH8 A;  5FLX b;  3I55 Z;  1YJN Z;  2DE7 A;  3IR7 A;  3JAM b;  1QVG Y;  1YJN 1;  1ZB9 A;  4MRI A;  3NH4 A;  2J6A A;  4MD9 A;  5T67 A;  3NDI A;  3I4M I;  1YIJ 1;  3NFZ A;  2VPY A;  3CME 1;  2GTI A;  4HH4 A;  1KQS Y;  3CCJ 1;  3CME Z;  1KD1 2;  4NB9 A;  3CPW Z;  3CCV 1;  3CMA 1;  3M4O I;  3NDJ A;  4NBA A;  3EER A;  1ZB8 A;  1X0T A;  1K9M 2;  2QR1 B;  3VMI A;  1VQM Z;  4RVG A;  1KD1 1;  1RNI A;  3CCL 1;  3CC7 Z;  1NJI 1;  2WB1 A;  3MZK B;  3U50 C;  3CCL Z;  2QEX Z;  2OTL Z;  2V8K A;  5IP9 I;  4A3F I;  3GKQ A;  4QTT A;  2E9H A;  2OOX B;  2QKD A;  3CCR 1;  1W2B Y;  1RO0 A;  3S1M I;  2F4M A;  2QRD B;  4AYB A;  5LL6 f;  1N8R 2;  3Q87 A;  1WZN A;  1TWA I;  2JA6 I;  2W03 A;  2JA8 I;  3M3Y I;  2V45 A;  3FQQ A;  1WCM I;  1I3Q I;  3S1Q I;  2JR6 A;  3CC2 1;  5T64 A;  2K5R A;  1RQF A;  4E30 A;  1P9N A;  3CCM 1;  1Q81 2;  2R7Z I;  1VQP Z;  2WAQ A;  1Q16 A;  3S15 I;  3GTJ I;  3G6E 1;  1KRL A;  4A3E I;  2PMZ A;  2GU2 A;  4NH1 C;  5D1O A;  3T4N B;  3S17 I;  2JNY A;  5CM2 M;  3PO3 I;  3J81 f;  3H3V J;  1QVF Z;  1SFO I;  1NP6 A;  3TDH B;  3CD6 Z;  4BY7 I;  3CC4 1;  3GTM S;  1S7M A;  3RZD I;  3CXC Z;  1USP B;  2JIR A;  3VB9 A;  2F4O A;  3KIH A;  3IF8 A;  4EWC A;  4DGL A;  4A3C I;  5C4J I;  1K8A 1;  1VQN Z;  1QYP A;  3CCV Z;  3PO2 I;  3I56 Z;  2V3V A;  1K73 2;  2VPW A;  3J80 b;  3G4S Z;  3HOU I;  3EED A;  3I07 A;  3S14 I;  3G4S 1;  4CL1 A;  2RBL A;  1JJ2 Z;  5A2Q b;  4A3L I;  3CC7 1;  4MON A;  4TNU A;  1VQK 1;  1KC8 1;  2ZAE B;  4A3K I;  2V8I A;  2VUM I;  1S72 Z;  5FLX f;  4Y52 I;  2OTL 1;  5IT9 f;  4NBB A;  1YJW Z;  2QA4 Z;  4A3G I;  1KQS Z;  2R6M A;  4NBH A;  2VF1 A;  1VQ7 Z;  1TWF I;  2O53 A;  2VPX A;  1K73 1;  1VQ7 1;  2AKL A;  4E33 A;  5D1O B;  1VQ8 Z;  1I6H I;  3P5J B;  1I50 I;  1WW9 A;  5C44 I;  1QVF Y;  2JIQ A;  2O4H A;  2Q4Z A;  4NBF A;  5D1P A;  4A3J I;  1VQP 1;  1NJI 2;  3D2L A;  3GTK I;  2NVT I;  3CCS Z;  2OTJ Z;  2JMO A;  3CMA Z;  3BG1 B;  4MD7 A;  3F3F C;  5C3E I;  3J7A 4;  1TWC I;  1VQ5 Z;  5IP7 I;  4MD8 A;  4HGZ A;  1Q82 2;  2DE5 A;  2KI7 B;  2E2I I;  3HOZ I;  1Q81 1;  2QRC B;  1VQ6 Z;  4E2W A;  4E2Z A;  3PO3 S;  1ZH1 A;  3I4N I;  3JAM f;  4RS4 A;  3MON A;  2Y0S A;  2RHB A;  4RVD A;  4DQY B;  1VQ6 1;  3H0G I;  4XX2 A;  2QLV B;  3CCQ 1;  3FKI I;  1YI2 1;  3CXC Y;  4DK1 A;  1Y8C A;  3I56 1;  2RPR A;  4NFR A;  2YAD A;  3S2H I;  1VQM 1;  3G71 Z;  2IZ4 A;  1QXF A;  2JIM A;  2NVQ I;  2NVX I;  1VQ4 Z;  4X6A I;  3D9X A;  2YU9 I;  3K7A I;  2NAP A;  3GTO I;  3GTL I;  1Z02 A;  2BJO A;  1RLY A;  2LFU A;  4A93 I;  3HOX I;  4BY1 I;  2G2K A;  1Q82 1;  1TFI A;  3G71 1;  3I55 1;  1DL6 A;  5C4X I;  2OZK A;  4E32 A; 
#chains in the Genus database with same CATH homology
 1YJ9 1;  2E2J I;  2H85 A;  2P3Y A;  3QWU A;  5AN9 F;  1YIJ Z;  1VQ8 1;  3G6E Z;  2PK7 A;  1VQ5 1;  3CCU 1;  1K9M 1;  1LQL A;  2R93 I;  3HOV I;  2OOY B;  2JA5 I;  4NOZ A;  4E2X A;  1YIT Z;  2JS4 A;  2QRE B;  4BXX I;  3KIF A;  1ML8 A;  3CC4 Z;  3CD6 1;  4BBR I;  1VQL 1;  1RO2 A;  4A3B I;  2HU9 A;  4BBS I;  2M6N A;  4RV9 A;  3CCE 1;  1WII A;  2RIQ A;  3CCJ Z;  1M1K 2;  2JA7 I;  1Q7Y 1;  1VQO 1;  5FLM I;  2KPI A;  4E2Y A;  3MZL B;  3CCQ Z;  2IZ3 A;  3LUS A;  1VQN 1;  3CCR Z;  3HOW I;  3CPW Y;  1M1K 1;  3J81 b;  3NH5 A;  4MXU A;  3J80 f;  2DE6 A;  1Y1W I;  1QF8 A;  2K3R A;  3ESW A;  1L1O C;  1YJW 1;  3TE5 B;  2GTH A;  3GTP I;  4RVF A;  1VQ4 1;  3GCF A;  1K83 I;  4NBD A;  1KC8 2;  2LIY A;  1YUA A;  1S72 1;  1M90 1;  1VQ9 1;  5T6B A;  4A3D I;  3S1R I;  3VMG A;  2W04 A;  1VQ9 Z;  1W2B Z;  1JWH C;  4HGY A;  1YUK A;  5A2Q f;  2Q51 A;  1NUI A;  4A3M I;  4S1T A;  2E2H I;  3HKZ A;  2JUB A;  2EGT A;  2HF1 A;  2B63 I;  3D6W A;  1Q86 1;  2VUG A;  3CCU Z;  1Q86 2;  1N2F A;  1K8A 2;  5IT9 b;  1Z03 A;  4NBC A;  2R92 I;  2P28 A;  4NBE A;  3HOY I;  4NBG A;  1Z01 A;  3CCS 1;  3VTN A;  1RO4 A;  4MH4 A;  1N8R 1;  1M90 2;  1YI2 Z;  1Y1V S;  4NB8 A;  3IX0 A;  1VQL Z;  1VLA A;  3OW2 Y;  2PM9 A;  3CCE Z;  3VMH A;  1X3W A;  1USP A;  2NVY I;  3F3P C;  1VQK Z;  3IFU A;  2V8J A;  2QEX 1;  1YHQ Z;  2I3C A;  3CQZ I;  1VQO Z;  3GTG I;  1X3Z A;  1TWH I;  2QA4 1;  1PFT A;  2RT9 A;  1YJ9 Z;  1TWG I;  3GTQ I;  3OW2 Z;  3GTM I;  3S2D I;  4A3I I;  3CC2 Z;  3CCM Z;  1JJ2 Y;  1Q7Y 2;  2OTJ 1;  3S16 I;  4QTU A;  1R9T I;  1QVG Z;  3BG0 B;  3RZO I;  3FQM A;  1Y1V I;  3S1N I;  1YHQ 1;  4E31 A;  4RVH A;  4Y7N I;  1YIT 1;  2M48 A;  3NH8 A;  5FLX b;  3I55 Z;  1YJN Z;  2DE7 A;  3JAM b;  1QVG Y;  1YJN 1;  1ZB9 A;  4MRI A;  3NH4 A;  2J6A A;  4MD9 A;  5T67 A;  3NDI A;  3I4M I;  1YIJ 1;  3NFZ A;  3CME 1;  2GTI A;  4HH4 A;  1KQS Y;  3CCJ 1;  3CME Z;  1KD1 2;  4NB9 A;  3CPW Z;  3CCV 1;  3CMA 1;  3M4O I;  3NDJ A;  4NBA A;  3EER A;  1ZB8 A;  1X0T A;  1K9M 2;  2QR1 B;  3VMI A;  1VQM Z;  4RVG A;  1KD1 1;  1RNI A;  3CCL 1;  3CC7 Z;  1NJI 1;  2WB1 A;  3MZK B;  3U50 C;  3CCL Z;  2QEX Z;  2OTL Z;  2V8K A;  5IP9 I;  4A3F I;  3GKQ A;  4QTT A;  2E9H A;  2OOX B;  2QKD A;  3CCR 1;  1W2B Y;  1RO0 A;  3S1M I;  2F4M A;  2QRD B;  4AYB A;  5LL6 f;  1N8R 2;  3Q87 A;  1TWA I;  2JA6 I;  2W03 A;  2JA8 I;  3M3Y I;  3FQQ A;  1WCM I;  1I3Q I;  3S1Q I;  2JR6 A;  3CC2 1;  5T64 A;  2K5R A;  1RQF A;  4E30 A;  1P9N A;  3CCM 1;  1Q81 2;  2R7Z I;  1VQP Z;  2WAQ A;  3S15 I;  3GTJ I;  3G6E 1;  1KRL A;  4A3E I;  2PMZ A;  2GU2 A;  4NH1 C;  5D1O A;  3T4N B;  3S17 I;  2JNY A;  5CM2 M;  3PO3 I;  3J81 f;  3H3V J;  1QVF Z;  1SFO I;  1NP6 A;  3TDH B;  3CD6 Z;  4BY7 I;  3CC4 1;  3GTM S;  1S7M A;  3RZD I;  3CXC Z;  1USP B;  3VB9 A;  2F4O A;  3KIH A;  3IF8 A;  4EWC A;  4DGL A;  4A3C I;  5C4J I;  1K8A 1;  1VQN Z;  1QYP A;  3CCV Z;  3PO2 I;  3I56 Z;  1K73 2;  3J80 b;  3G4S Z;  3HOU I;  3EED A;  3I07 A;  3S14 I;  3G4S 1;  4CL1 A;  2RBL A;  1JJ2 Z;  5A2Q b;  4A3L I;  3CC7 1;  4MON A;  4TNU A;  1VQK 1;  1KC8 1;  2ZAE B;  4A3K I;  2V8I A;  2VUM I;  1S72 Z;  5FLX f;  4Y52 I;  2OTL 1;  5IT9 f;  4NBB A;  1YJW Z;  2QA4 Z;  4A3G I;  1KQS Z;  2R6M A;  4NBH A;  2VF1 A;  1VQ7 Z;  1TWF I;  2O53 A;  1K73 1;  1VQ7 1;  2AKL A;  4E33 A;  5D1O B;  1VQ8 Z;  1I6H I;  3P5J B;  1I50 I;  1WW9 A;  5C44 I;  1QVF Y;  2Q4Z A;  2O4H A;  4NBF A;  5D1P A;  4A3J I;  1VQP 1;  1NJI 2;  3GTK I;  2NVT I;  3CCS Z;  2OTJ Z;  2JMO A;  3CMA Z;  3BG1 B;  4MD7 A;  3F3F C;  5C3E I;  3J7A 4;  1TWC I;  1VQ5 Z;  5IP7 I;  4MD8 A;  4HGZ A;  1Q82 2;  2DE5 A;  2KI7 B;  2E2I I;  3HOZ I;  1Q81 1;  2QRC B;  1VQ6 Z;  4E2W A;  4E2Z A;  3PO3 S;  1ZH1 A;  3I4N I;  3JAM f;  4RS4 A;  3MON A;  2Y0S A;  2RHB A;  4RVD A;  4DQY B;  1VQ6 1;  3H0G I;  4XX2 A;  2QLV B;  3CCQ 1;  3FKI I;  1YI2 1;  3CXC Y;  4DK1 A;  3I56 1;  2RPR A;  4NFR A;  2YAD A;  3S2H I;  1VQM 1;  3G71 Z;  2IZ4 A;  2NVQ I;  2NVX I;  1VQ4 Z;  4X6A I;  3D9X A;  2YU9 I;  3K7A I;  3GTO I;  3GTL I;  1Z02 A;  2BJO A;  1RLY A;  2LFU A;  4A93 I;  3HOX I;  4BY1 I;  2G2K A;  1Q82 1;  1TFI A;  3G71 1;  3I55 1;  1DL6 A;  5C4X I;  2OZK A;  4E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...