1KRLA

Crystal structure of racemic dl-monellin in p-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords MONELLIN, CHAIN A
publication title Structural differences in D and L-monellin in the crystals of racemic mixture.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 7
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1krlA00
3MONA 4MONA 1KRLA
chains in the Genus database with same CATH superfamily
1Z03A 1VQNZ 1YJ91 3GTGI 3TE5B 4A3FI 4A3GI 3CC2Z 2V8KA 2PM9A 1QVFZ 4NB8A 2DE5A 3S2HI 4DQYB 3HKZA 1K9M2 2P3YA 2GTIA 4NBDA 1KQSZ 1FDOA 3PO2I 1Z02A 3VB9A 5A2Qf 4NH1C 4A3KI 3G4S1 2QRCB 1VQL1 2E2HI 3BG0B 4NBHA 1KRLA 4X6AI 3BG1B 2V8IA 3S16I 3I07A 1TWHI 4E33A 1L1OC 3IX0A 4NBEA 3K7AI 4E2WA 3I561 2JMOA 3CCJ1 2NVXI 2VUMI 3Q87A 5C3EI 5D1OB 4A3EI 3G71Z 4MXUA 2LIYA 2YADA 1YIJZ 5IT9f 2KPIA 3CCE1 3M4OI 1NJI2 2QEX1 1S72Z 3G6E1 1VQP1 4A3DI 1FDIA 2E7ZA 4NFRA 1WJ2A 1ZB9A 2OOXB 2V3VA 4E32A 1VQ61 3CC7Z 2NAPA 2JIPA 1Q16A 1RO0A 2JUBA 1QVGZ 3NDIA 3S1RI 1Q862 2OTLZ 5T67A 1YIT1 2R93I 3S2DI 1K731 1N2FA 2E2JI 2LFUA 3CCL1 3GTOI 3D2LA 3CCVZ 2EGTA 5C44I 1VQM1 4A3BI 2K5RA 5IP9I 3CME1 2VUGA 3CCRZ 2OTJ1 5AN9F 1M901 4BBSI 2F4MA 3D9XA 2VPWA 4E31A 5CM2M 1N8R2 2QLVB 1SFOI 3GKQA 4MD7A 1WW9A 4S1TA 2V45A 1YJN1 1ZB8A 2VPZA 3HOZI 2JIMA 1VQKZ 3I55Z 2JA6I 4EWCA 1I3QI 5D1OA 3J7A4 5C4XI 3CC21 1KQSY 3S15I 3S1MI 3GTJI 1Q7Y2 1VQ9Z 3M3YI 1QYPA 2JA7I 1KD11 3VMIA 2QA41 1Y1VS 3CXCZ 1Q822 4NBFA 2W04A 1VQ71 1RQFA 1WIIA 1Y1VI 2DE7A 2G2KA 2IZ3A 2E2II 3KIHA 3QWUA 4XX2A 2JR6A 2RT9A 1VQ8Z 3OW2Y 4BBRI 1I6HI 2IZ4A 1NUIA 3LUSA 4QTUA 2PK7A 1YIJ1 1ZH1A 5A2Qb 1TWGI 3J80f 1Q811 2RPRA 3CD6Z 1VQ5Z 2VF1A 1YI2Z 3J80b 2BJOA 4Y7NI 2HF1A 3FQMA 3GCFA 1JWHC 3CCQ1 1YJW1 2JA5I 1USPB 4NBAA 4E2XA 1QVGY 3HOUI 1Q821 3S1NI 2VPYA 2WAQA 3CC71 3NDJA 3TDHB 2P28A 3HOVI 1M1K2 4RVHA 4Y52I 1KC82 1X3ZA 3NH5A 1WCMI 2OTL1 2R92I 2VPXA 3IF8A 5IT9b 3EERA 1Z01A 1K9M1 2NVTI 2NVQI 4NBCA 2AYDA 3H3VJ 3CPWY 2QR1B 3CCV1 2V8JA 2YU9I 4MD9A 1X3WA 3GTPI 2KI7B 3NH8A 1VQ4Z 3D6WA 2K3RA 4E2YA 3RZDI 2RIQA 4DGLA 4A3LI 3CCS1 3KIFA 3CCUZ 4A3II 1VQOZ 1WZNA 1JJ2Z 3GTMS 1VQK1 3S14I 2QKDA 1TFIA 3I551 1Y8CA 1M1K1 2M48A 3I56Z 1KC81 1TWCI 4CL1A 1VQ91 1NJI1 5D1PA 3GTLI 3CCEZ 2R6MA 3CMA1 5T64A 1YHQZ 3CQZI 4HGYA 2JIQA 1VQN1 2JNYA 3HOYI 2OZKA 1USPA 3NFZA 2B63I 1QVFY 3FQQA 4BXXI 1AA6A 2RHBA 1R9TI 4DK1A 5FLXf 3GTKI 1Q861 2RBLA 3P5JB 1SIWA 4MONA 3JAMf 1VQ81 1YITZ 4HGZA 4BY7I 3J81f 3EEDA 1RO4A 2O4HA 5LL6f 1YUAA 1K83I 3CCLZ 3F3PC 1LQLA 3CD61 3H0GI 4QTTA 3CMEZ 1PFTA 1W2BZ 3HOWI 2OTJZ 4RVFA 4A3CI 1N8R1 1VLAA 3CC4Z 2H85A 2ZAEB 3PO3S 4E2ZA 3I4MI 1YJNZ 3MZLB 1K8A2 3G711 3S17I 2Q51A 3F3FC 3MZKB 3PO3I 3CCMZ 1Q7Y1 5FLMI 3I4NI 2JIOA 1S721 1X0TA 3FKII 5IP7I 2Q4ZA 2J6AA 1S7MA 2JIRA 2QA4Z 3MONA 1YJ9Z 4MRIA 1VQ7Z 1VQ41 4HH4A 1JJ2Y 3GTQI 1RNIA 4RS4A 2W03A 1Y1WI 3CCU1 1VQO1 1RO2A 5C4JI 4NOZA 3VMGA 1K732 2GTHA 1K8A1 1I50I 5T6BA 3CCR1 1NP6A 1RLYA 3G4SZ 1M902 2LEXA 1VQLZ 2IV2X 3OW2Z 2JA8I 2GU2A 1YHQ1 4RVGA 2M6NA 4RV9A 4NBBA 4AYBA 2WB1A 3CCQZ 1YJWZ 2JS4A 4NBGA 3VTNA 2AKLA 1P9NA 3CCJZ 2HU9A 2PMZA 3CXCY 3IR7A 3GTMI 3IFUA 1TWAI 4E30A 3NH4A 2O53A 2QEXZ 3G6EZ 3RZOI 1W2BY 2NVYI 1VQPZ 1KD12 4A3MI 1QXFA 4NB9A 4RVDA 3U50C 1VQ6Z 2QREB 1YUKA 3S1QI 2QRDB 2Y0SA 1QF8A 4TNUA 3CPWZ 4A93I 1ML8A 4MD8A 5FLXb 3CC41 2OOYB 4MH4A 3JAMb 3CCSZ 3J81b 3ESWA 3T4NB 4BY1I 1TWFI 1DL6A 4A3JI 2I3CA 1VQMZ 3VMHA 3CCM1 1VQ51 1YI21 3HOXI 2F4OA 1Q812 2R7ZI 3CMAZ 2DE6A 2E9HA
chains in the Genus database with same CATH topology
1Z03A 1VQNZ 1YJ91 3GTGI 3TE5B 4A3FI 4A3GI 3CC2Z 2V8KA 2PM9A 1QVFZ 4NB8A 2DE5A 3S2HI 4DQYB 3HKZA 1K9M2 2P3YA 2GTIA 4NBDA 1KQSZ 3PO2I 1Z02A 3VB9A 5A2Qf 4NH1C 4A3KI 3G4S1 2QRCB 1VQL1 2E2HI 3BG0B 4NBHA 1KRLA 4X6AI 3BG1B 2V8IA 3S16I 3I07A 1TWHI 4E33A 1L1OC 3IX0A 4NBEA 3K7AI 4E2WA 3I561 2JMOA 3CCJ1 2NVXI 2VUMI 3Q87A 5C3EI 5D1OB 4A3EI 3G71Z 4MXUA 2LIYA 2YADA 1YIJZ 5IT9f 2KPIA 3CCE1 3M4OI 1NJI2 2QEX1 1S72Z 3G6E1 1VQP1 4A3DI 4NFRA 1ZB9A 2OOXB 4E32A 1VQ61 3CC7Z 1RO0A 2JUBA 1QVGZ 3NDIA 3S1RI 1Q862 2OTLZ 5T67A 1YIT1 2R93I 3S2DI 1K731 1N2FA 2E2JI 2LFUA 3CCL1 3GTOI 3CCVZ 2EGTA 5C44I 1VQM1 4A3BI 2K5RA 5IP9I 3CME1 2VUGA 3CCRZ 2OTJ1 5AN9F 1M901 4BBSI 2F4MA 3D9XA 4E31A 5CM2M 1N8R2 2QLVB 1SFOI 3GKQA 4MD7A 1WW9A 4S1TA 1YJN1 1ZB8A 3HOZI 1VQKZ 3I55Z 2JA6I 4EWCA 1I3QI 5D1OA 3J7A4 5C4XI 3CC21 1KQSY 3S15I 3S1MI 3GTJI 1Q7Y2 1VQ9Z 3M3YI 1QYPA 2JA7I 1KD11 3VMIA 2QA41 1Y1VS 3CXCZ 1Q822 4NBFA 2W04A 1VQ71 1RQFA 1WIIA 1Y1VI 2DE7A 2G2KA 2IZ3A 2E2II 3KIHA 3QWUA 4XX2A 2JR6A 2RT9A 1VQ8Z 3OW2Y 4BBRI 1I6HI 2IZ4A 1NUIA 3LUSA 4QTUA 2PK7A 1YIJ1 1ZH1A 5A2Qb 1TWGI 3J80f 1Q811 2RPRA 3CD6Z 1VQ5Z 2VF1A 1YI2Z 3J80b 2BJOA 4Y7NI 2HF1A 3FQMA 3GCFA 1JWHC 3CCQ1 1YJW1 2JA5I 1USPB 4NBAA 4E2XA 1QVGY 3HOUI 1Q821 3S1NI 2WAQA 3CC71 3NDJA 3TDHB 2P28A 3HOVI 1M1K2 4RVHA 4Y52I 1KC82 1X3ZA 3NH5A 1WCMI 2OTL1 2R92I 3IF8A 5IT9b 3EERA 1Z01A 1K9M1 2NVTI 2NVQI 4NBCA 3H3VJ 3CPWY 2QR1B 3CCV1 2V8JA 2YU9I 4MD9A 1X3WA 3GTPI 2KI7B 3NH8A 1VQ4Z 3D6WA 2K3RA 4E2YA 3RZDI 2RIQA 4DGLA 4A3LI 3CCS1 3KIFA 3CCUZ 4A3II 1VQOZ 1JJ2Z 3GTMS 1VQK1 3S14I 2QKDA 1TFIA 3I551 1M1K1 2M48A 3I56Z 1KC81 1TWCI 4CL1A 1VQ91 1NJI1 5D1PA 3GTLI 3CCEZ 2R6MA 3CMA1 5T64A 1YHQZ 3CQZI 4HGYA 1VQN1 2JNYA 3HOYI 2OZKA 1USPA 3NFZA 2B63I 1QVFY 3FQQA 4BXXI 2RHBA 1R9TI 4DK1A 5FLXf 3GTKI 1Q861 2RBLA 3P5JB 4MONA 3JAMf 1VQ81 1YITZ 4HGZA 4BY7I 3J81f 3EEDA 1RO4A 2O4HA 5LL6f 1YUAA 1K83I 3CCLZ 3F3PC 1LQLA 3CD61 3H0GI 4QTTA 3CMEZ 1PFTA 1W2BZ 3HOWI 2OTJZ 4RVFA 4A3CI 1N8R1 1VLAA 3CC4Z 2H85A 2ZAEB 3PO3S 4E2ZA 3I4MI 1YJNZ 3MZLB 1K8A2 3G711 3S17I 2Q51A 3F3FC 3MZKB 3PO3I 3CCMZ 1Q7Y1 5FLMI 3I4NI 1S721 1X0TA 3FKII 5IP7I 2Q4ZA 2J6AA 1S7MA 2QA4Z 3MONA 1YJ9Z 4MRIA 1VQ7Z 1VQ41 4HH4A 1JJ2Y 3GTQI 1RNIA 4RS4A 2W03A 1Y1WI 3CCU1 1VQO1 1RO2A 5C4JI 4NOZA 3VMGA 1K732 2GTHA 1K8A1 1I50I 5T6BA 3CCR1 1NP6A 1RLYA 3G4SZ 1M902 1VQLZ 2JA8I 3OW2Z 2GU2A 1YHQ1 4RVGA 2M6NA 4RV9A 4NBBA 4AYBA 2WB1A 3CCQZ 1YJWZ 2JS4A 4NBGA 3VTNA 2AKLA 1P9NA 3CCJZ 2HU9A 2PMZA 3CXCY 3GTMI 3IFUA 1TWAI 4E30A 3NH4A 2O53A 2QEXZ 3G6EZ 3RZOI 1W2BY 2NVYI 1VQPZ 1KD12 4A3MI 4NB9A 4RVDA 3U50C 1VQ6Z 2QREB 1YUKA 3S1QI 2QRDB 2Y0SA 1QF8A 4TNUA 3CPWZ 4A93I 1ML8A 4MD8A 5FLXb 3CC41 2OOYB 4MH4A 3JAMb 3CCSZ 3J81b 3ESWA 3T4NB 4BY1I 1TWFI 1DL6A 4A3JI 2I3CA 1VQMZ 3VMHA 3CCM1 1VQ51 1YI21 3HOXI 2F4OA 1Q812 2R7ZI 3CMAZ 2DE6A 2E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MON A;  4MON A;  1KRL A; 
#chains in the Genus database with same CATH topology
 1Z03 A;  1VQN Z;  1YJ9 1;  3GTG I;  3TE5 B;  4A3F I;  4A3G I;  3CC2 Z;  2V8K A;  2PM9 A;  1QVF Z;  4NB8 A;  2DE5 A;  3S2H I;  4DQY B;  3HKZ A;  1K9M 2;  2P3Y A;  2GTI A;  4NBD A;  1KQS Z;  1FDO A;  3PO2 I;  1Z02 A;  3VB9 A;  5A2Q f;  4NH1 C;  4A3K I;  3G4S 1;  2QRC B;  1VQL 1;  2E2H I;  3BG0 B;  4NBH A;  1KRL A;  4X6A I;  3BG1 B;  2V8I A;  3S16 I;  3I07 A;  1TWH I;  4E33 A;  1L1O C;  3IX0 A;  4NBE A;  3K7A I;  4E2W A;  3I56 1;  2JMO A;  3CCJ 1;  2NVX I;  2VUM I;  3Q87 A;  5C3E I;  5D1O B;  4A3E I;  3G71 Z;  4MXU A;  2LIY A;  2YAD A;  1YIJ Z;  5IT9 f;  2KPI A;  3CCE 1;  3M4O I;  1NJI 2;  2QEX 1;  1S72 Z;  3G6E 1;  1VQP 1;  4A3D I;  1FDI A;  2E7Z A;  4NFR A;  1WJ2 A;  1ZB9 A;  2OOX B;  2V3V A;  4E32 A;  1VQ6 1;  3CC7 Z;  2NAP A;  2JIP A;  1Q16 A;  1RO0 A;  2JUB A;  1QVG Z;  3NDI A;  3S1R I;  1Q86 2;  2OTL Z;  5T67 A;  1YIT 1;  2R93 I;  3S2D I;  1K73 1;  1N2F A;  2E2J I;  2LFU A;  3CCL 1;  3GTO I;  3D2L A;  3CCV Z;  2EGT A;  5C44 I;  1VQM 1;  4A3B I;  2K5R A;  5IP9 I;  3CME 1;  2VUG A;  3CCR Z;  2OTJ 1;  5AN9 F;  1M90 1;  4BBS I;  2F4M A;  3D9X A;  2VPW A;  4E31 A;  5CM2 M;  1N8R 2;  2QLV B;  1SFO I;  3GKQ A;  4MD7 A;  1WW9 A;  4S1T A;  2V45 A;  1YJN 1;  1ZB8 A;  2VPZ A;  3HOZ I;  2JIM A;  1VQK Z;  3I55 Z;  2JA6 I;  4EWC A;  1I3Q I;  5D1O A;  3J7A 4;  5C4X I;  3CC2 1;  1KQS Y;  3S15 I;  3S1M I;  3GTJ I;  1Q7Y 2;  1VQ9 Z;  3M3Y I;  1QYP A;  2JA7 I;  1KD1 1;  3VMI A;  2QA4 1;  1Y1V S;  3CXC Z;  1Q82 2;  4NBF A;  2W04 A;  1VQ7 1;  1RQF A;  1WII A;  1Y1V I;  2DE7 A;  2G2K A;  2IZ3 A;  2E2I I;  3KIH A;  3QWU A;  4XX2 A;  2JR6 A;  2RT9 A;  1VQ8 Z;  3OW2 Y;  4BBR I;  1I6H I;  2IZ4 A;  1NUI A;  3LUS A;  4QTU A;  2PK7 A;  1YIJ 1;  1ZH1 A;  5A2Q b;  1TWG I;  3J80 f;  1Q81 1;  2RPR A;  3CD6 Z;  1VQ5 Z;  2VF1 A;  1YI2 Z;  3J80 b;  2BJO A;  4Y7N I;  2HF1 A;  3FQM A;  3GCF A;  1JWH C;  3CCQ 1;  1YJW 1;  2JA5 I;  1USP B;  4NBA A;  4E2X A;  1QVG Y;  3HOU I;  1Q82 1;  3S1N I;  2VPY A;  2WAQ A;  3CC7 1;  3NDJ A;  3TDH B;  2P28 A;  3HOV I;  1M1K 2;  4RVH A;  4Y52 I;  1KC8 2;  1X3Z A;  3NH5 A;  1WCM I;  2OTL 1;  2R92 I;  2VPX A;  3IF8 A;  5IT9 b;  3EER A;  1Z01 A;  1K9M 1;  2NVT I;  2NVQ I;  4NBC A;  2AYD A;  3H3V J;  3CPW Y;  2QR1 B;  3CCV 1;  2V8J A;  2YU9 I;  4MD9 A;  1X3W A;  3GTP I;  2KI7 B;  3NH8 A;  1VQ4 Z;  3D6W A;  2K3R A;  4E2Y A;  3RZD I;  2RIQ A;  4DGL A;  4A3L I;  3CCS 1;  3KIF A;  3CCU Z;  4A3I I;  1VQO Z;  1WZN A;  1JJ2 Z;  3GTM S;  1VQK 1;  3S14 I;  2QKD A;  1TFI A;  3I55 1;  1Y8C A;  1M1K 1;  2M48 A;  3I56 Z;  1KC8 1;  1TWC I;  4CL1 A;  1VQ9 1;  1NJI 1;  5D1P A;  3GTL I;  3CCE Z;  2R6M A;  3CMA 1;  5T64 A;  1YHQ Z;  3CQZ I;  4HGY A;  2JIQ A;  1VQN 1;  2JNY A;  3HOY I;  2OZK A;  1USP A;  3NFZ A;  2B63 I;  1QVF Y;  3FQQ A;  4BXX I;  1AA6 A;  2RHB A;  1R9T I;  4DK1 A;  5FLX f;  3GTK I;  1Q86 1;  2RBL A;  3P5J B;  1SIW A;  4MON A;  3JAM f;  1VQ8 1;  1YIT Z;  4HGZ A;  4BY7 I;  3J81 f;  3EED A;  1RO4 A;  2O4H A;  5LL6 f;  1YUA A;  1K83 I;  3CCL Z;  3F3P C;  1LQL A;  3CD6 1;  3H0G I;  4QTT A;  3CME Z;  1PFT A;  1W2B Z;  3HOW I;  2OTJ Z;  4RVF A;  4A3C I;  1N8R 1;  1VLA A;  3CC4 Z;  2H85 A;  2ZAE B;  3PO3 S;  4E2Z A;  3I4M I;  1YJN Z;  3MZL B;  1K8A 2;  3G71 1;  3S17 I;  2Q51 A;  3F3F C;  3MZK B;  3PO3 I;  3CCM Z;  1Q7Y 1;  5FLM I;  3I4N I;  2JIO A;  1S72 1;  1X0T A;  3FKI I;  5IP7 I;  2Q4Z A;  2J6A A;  1S7M A;  2JIR A;  2QA4 Z;  3MON A;  1YJ9 Z;  4MRI A;  1VQ7 Z;  1VQ4 1;  4HH4 A;  1JJ2 Y;  3GTQ I;  1RNI A;  4RS4 A;  2W03 A;  1Y1W I;  3CCU 1;  1VQO 1;  1RO2 A;  5C4J I;  4NOZ A;  3VMG A;  1K73 2;  2GTH A;  1K8A 1;  1I50 I;  5T6B A;  3CCR 1;  1NP6 A;  1RLY A;  3G4S Z;  1M90 2;  2LEX A;  1VQL Z;  2IV2 X;  3OW2 Z;  2JA8 I;  2GU2 A;  1YHQ 1;  4RVG A;  2M6N A;  4RV9 A;  4NBB A;  4AYB A;  2WB1 A;  3CCQ Z;  1YJW Z;  2JS4 A;  4NBG A;  3VTN A;  2AKL A;  1P9N A;  3CCJ Z;  2HU9 A;  2PMZ A;  3CXC Y;  3IR7 A;  3GTM I;  3IFU A;  1TWA I;  4E30 A;  3NH4 A;  2O53 A;  2QEX Z;  3G6E Z;  3RZO I;  1W2B Y;  2NVY I;  1VQP Z;  1KD1 2;  4A3M I;  1QXF A;  4NB9 A;  4RVD A;  3U50 C;  1VQ6 Z;  2QRE B;  1YUK A;  3S1Q I;  2QRD B;  2Y0S A;  1QF8 A;  4TNU A;  3CPW Z;  4A93 I;  1ML8 A;  4MD8 A;  5FLX b;  3CC4 1;  2OOY B;  4MH4 A;  3JAM b;  3CCS Z;  3J81 b;  3ESW A;  3T4N B;  4BY1 I;  1TWF I;  1DL6 A;  4A3J I;  2I3C A;  1VQM Z;  3VMH A;  3CCM 1;  1VQ5 1;  1YI2 1;  3HOX I;  2F4O A;  1Q81 2;  2R7Z I;  3CMA Z;  2DE6 A;  2E9H A; 
#chains in the Genus database with same CATH homology
 1Z03 A;  1VQN Z;  1YJ9 1;  3GTG I;  3TE5 B;  4A3F I;  4A3G I;  3CC2 Z;  2V8K A;  2PM9 A;  1QVF Z;  4NB8 A;  2DE5 A;  3S2H I;  4DQY B;  3HKZ A;  1K9M 2;  2P3Y A;  2GTI A;  4NBD A;  1KQS Z;  3PO2 I;  1Z02 A;  3VB9 A;  5A2Q f;  4NH1 C;  4A3K I;  3G4S 1;  2QRC B;  1VQL 1;  2E2H I;  3BG0 B;  4NBH A;  1KRL A;  4X6A I;  3BG1 B;  2V8I A;  3S16 I;  3I07 A;  1TWH I;  4E33 A;  1L1O C;  3IX0 A;  4NBE A;  3K7A I;  4E2W A;  3I56 1;  2JMO A;  3CCJ 1;  2NVX I;  2VUM I;  3Q87 A;  5C3E I;  5D1O B;  4A3E I;  3G71 Z;  4MXU A;  2LIY A;  2YAD A;  1YIJ Z;  5IT9 f;  2KPI A;  3CCE 1;  3M4O I;  1NJI 2;  2QEX 1;  1S72 Z;  3G6E 1;  1VQP 1;  4A3D I;  4NFR A;  1ZB9 A;  2OOX B;  4E32 A;  1VQ6 1;  3CC7 Z;  1RO0 A;  2JUB A;  1QVG Z;  3NDI A;  3S1R I;  1Q86 2;  2OTL Z;  5T67 A;  1YIT 1;  2R93 I;  3S2D I;  1K73 1;  1N2F A;  2E2J I;  2LFU A;  3CCL 1;  3GTO I;  3CCV Z;  2EGT A;  5C44 I;  1VQM 1;  4A3B I;  2K5R A;  5IP9 I;  3CME 1;  2VUG A;  3CCR Z;  2OTJ 1;  5AN9 F;  1M90 1;  4BBS I;  2F4M A;  3D9X A;  4E31 A;  5CM2 M;  1N8R 2;  2QLV B;  1SFO I;  3GKQ A;  4MD7 A;  1WW9 A;  4S1T A;  1YJN 1;  1ZB8 A;  3HOZ I;  1VQK Z;  3I55 Z;  2JA6 I;  4EWC A;  1I3Q I;  5D1O A;  3J7A 4;  5C4X I;  3CC2 1;  1KQS Y;  3S15 I;  3S1M I;  3GTJ I;  1Q7Y 2;  1VQ9 Z;  3M3Y I;  1QYP A;  2JA7 I;  1KD1 1;  3VMI A;  2QA4 1;  1Y1V S;  3CXC Z;  1Q82 2;  4NBF A;  2W04 A;  1VQ7 1;  1RQF A;  1WII A;  1Y1V I;  2DE7 A;  2G2K A;  2IZ3 A;  2E2I I;  3KIH A;  3QWU A;  4XX2 A;  2JR6 A;  2RT9 A;  1VQ8 Z;  3OW2 Y;  4BBR I;  1I6H I;  2IZ4 A;  1NUI A;  3LUS A;  4QTU A;  2PK7 A;  1YIJ 1;  1ZH1 A;  5A2Q b;  1TWG I;  3J80 f;  1Q81 1;  2RPR A;  3CD6 Z;  1VQ5 Z;  2VF1 A;  1YI2 Z;  3J80 b;  2BJO A;  4Y7N I;  2HF1 A;  3FQM A;  3GCF A;  1JWH C;  3CCQ 1;  1YJW 1;  2JA5 I;  1USP B;  4NBA A;  4E2X A;  1QVG Y;  3HOU I;  1Q82 1;  3S1N I;  2WAQ A;  3CC7 1;  3NDJ A;  3TDH B;  2P28 A;  3HOV I;  1M1K 2;  4RVH A;  4Y52 I;  1KC8 2;  1X3Z A;  3NH5 A;  1WCM I;  2OTL 1;  2R92 I;  3IF8 A;  5IT9 b;  3EER A;  1Z01 A;  1K9M 1;  2NVT I;  2NVQ I;  4NBC A;  3H3V J;  3CPW Y;  2QR1 B;  3CCV 1;  2V8J A;  2YU9 I;  4MD9 A;  1X3W A;  3GTP I;  2KI7 B;  3NH8 A;  1VQ4 Z;  3D6W A;  2K3R A;  4E2Y A;  3RZD I;  2RIQ A;  4DGL A;  4A3L I;  3CCS 1;  3KIF A;  3CCU Z;  4A3I I;  1VQO Z;  1JJ2 Z;  3GTM S;  1VQK 1;  3S14 I;  2QKD A;  1TFI A;  3I55 1;  1M1K 1;  2M48 A;  3I56 Z;  1KC8 1;  1TWC I;  4CL1 A;  1VQ9 1;  1NJI 1;  5D1P A;  3GTL I;  3CCE Z;  2R6M A;  3CMA 1;  5T64 A;  1YHQ Z;  3CQZ I;  4HGY A;  1VQN 1;  2JNY A;  3HOY I;  2OZK A;  1USP A;  3NFZ A;  2B63 I;  1QVF Y;  3FQQ A;  4BXX I;  2RHB A;  1R9T I;  4DK1 A;  5FLX f;  3GTK I;  1Q86 1;  2RBL A;  3P5J B;  4MON A;  3JAM f;  1VQ8 1;  1YIT Z;  4HGZ A;  4BY7 I;  3J81 f;  3EED A;  1RO4 A;  2O4H A;  5LL6 f;  1YUA A;  1K83 I;  3CCL Z;  3F3P C;  1LQL A;  3CD6 1;  3H0G I;  4QTT A;  3CME Z;  1PFT A;  1W2B Z;  3HOW I;  2OTJ Z;  4RVF A;  4A3C I;  1N8R 1;  1VLA A;  3CC4 Z;  2H85 A;  2ZAE B;  3PO3 S;  4E2Z A;  3I4M I;  1YJN Z;  3MZL B;  1K8A 2;  3G71 1;  3S17 I;  2Q51 A;  3F3F C;  3MZK B;  3PO3 I;  3CCM Z;  1Q7Y 1;  5FLM I;  3I4N I;  1S72 1;  1X0T A;  3FKI I;  5IP7 I;  2Q4Z A;  2J6A A;  1S7M A;  2QA4 Z;  3MON A;  1YJ9 Z;  4MRI A;  1VQ7 Z;  1VQ4 1;  4HH4 A;  1JJ2 Y;  3GTQ I;  1RNI A;  4RS4 A;  2W03 A;  1Y1W I;  3CCU 1;  1VQO 1;  1RO2 A;  5C4J I;  4NOZ A;  3VMG A;  1K73 2;  2GTH A;  1K8A 1;  1I50 I;  5T6B A;  3CCR 1;  1NP6 A;  1RLY A;  3G4S Z;  1M90 2;  1VQL Z;  2JA8 I;  3OW2 Z;  2GU2 A;  1YHQ 1;  4RVG A;  2M6N A;  4RV9 A;  4NBB A;  4AYB A;  2WB1 A;  3CCQ Z;  1YJW Z;  2JS4 A;  4NBG A;  3VTN A;  2AKL A;  1P9N A;  3CCJ Z;  2HU9 A;  2PMZ A;  3CXC Y;  3GTM I;  3IFU A;  1TWA I;  4E30 A;  3NH4 A;  2O53 A;  2QEX Z;  3G6E Z;  3RZO I;  1W2B Y;  2NVY I;  1VQP Z;  1KD1 2;  4A3M I;  4NB9 A;  4RVD A;  3U50 C;  1VQ6 Z;  2QRE B;  1YUK A;  3S1Q I;  2QRD B;  2Y0S A;  1QF8 A;  4TNU A;  3CPW Z;  4A93 I;  1ML8 A;  4MD8 A;  5FLX b;  3CC4 1;  2OOY B;  4MH4 A;  3JAM b;  3CCS Z;  3J81 b;  3ESW A;  3T4N B;  4BY1 I;  1TWF I;  1DL6 A;  4A3J I;  2I3C A;  1VQM Z;  3VMH A;  3CCM 1;  1VQ5 1;  1YI2 1;  3HOX I;  2F4O A;  1Q81 2;  2R7Z I;  3CMA Z;  2DE6 A;  2E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...