1KRLA

Crystal structure of racemic dl-monellin in p-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
b'REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MONELLIN, CHAIN A
publication title Structural differences in D and L-monellin in the crystals of racemic mixture.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 7
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1krlA00
3MONA 1KRLA 4MONA
chains in the Genus database with same CATH superfamily
4RVFA 2E2II 1Y8CA 3VMHA 3TE5B 2JIMA 4A3MI 3CCE1 1RO4A 3HKZA 4S1TA 2RIQA 3BG0B 1FDIA 1VQKZ 3JAMb 4QTTA 3G4S1 5LL6f 3CCSZ 5A2Qf 1VQ8Z 3S2HI 1ZB9A 1RQFA 3D6WA 1KD12 3I55Z 1DL6A 1YIJ1 1YJW1 2OTL1 3S15I 3MONA 2V8JA 4RVHA 1VQ4Z 3HOVI 1WW9A 1X0TA 4BXXI 4BY1I 3S1NI 2WB1A 4RVGA 3CD6Z 3F3PC 3CMEZ 1WJ2A 3CCRZ 2VPXA 2QREB 4NB8A 2P28A 2RT9A 1X3ZA 4A3EI 5AN9F 1VQ81 2DE6A 1S72Z 2PM9A 3CCQZ 1VQLZ 4DK1A 1Q16A 4A3FI 1Y1WI 4NB9A 4A3DI 2DE5A 1VLAA 2F4MA 1Z02A 3CPWY 4NBBA 2GU2A 1K8A1 1VQ41 5IT9b 1K8A2 2AYDA 2NVTI 2RHBA 3IF8A 1YJ91 1QYPA 2R6MA 4MXUA 4A3CI 1QXFA 3FKII 3CME1 2JA6I 3CCR1 2HU9A 3CCJZ 1QF8A 3GTGI 4E31A 2R92I 4E30A 4QTUA 5FLXb 1RO0A 1YHQZ 1VQPZ 3S1QI 1TWAI 3CCEZ 2O4HA 5C44I 3D2LA 3PO3I 4XX2A 3I561 3CC21 1NP6A 4MRIA 3G4SZ 1Y1VI 3J81b 2BJOA 4MD8A 2P3YA 2KPIA 3S17I 1K83I 1Q862 3J80f 4E32A 2GTHA 1LQLA 1YJWZ 3GTPI 2I3CA 1Q7Y1 2OTLZ 3CC71 4A3JI 5T6BA 1YJNZ 4E2WA 3CQZI 3H3VJ 1P9NA 1ZH1A 2YU9I 1Z01A 3CCJ1 1Q822 3S14I 1PFTA 2VPZA 2QLVB 2VF1A 3ESWA 4AYBA 3CCV1 2LEXA 1VQP1 1YHQ1 2B63I 5D1PA 4DGLA 4A3LI 1WZNA 4TNUA 3CMA1 3CXCZ 1YUKA 2JA5I 3G71Z 3IFUA 2QRDB 3Q87A 1KD11 3IX0A 2JMOA 1KC82 2HF1A 2Q4ZA 3NDJA 3GTJI 3D9XA 4MONA 1N2FA 4E2YA 1TWCI 1Z03A 1YJN1 1TWGI 2M48A 1YJ9Z 5D1OB 1RO2A 4RS4A 2NVYI 2Y0SA 2QR1B 4NBFA 4MD7A 3P5JB 1X3WA 1TFIA 3K7AI 5A2Qb 3M4OI 3FQMA 2QEX1 4A3II 4A3KI 3G711 3I4NI 1M901 5T67A 3GTKI 1M902 4NBEA 3GTOI 3I56Z 3I07A 2G2KA 3CC2Z 2H85A 3TDHB 3S1RI 3GTLI 3NH5A 1ML8A 5CM2M 4HH4A 1JWHC 1N8R1 1NUIA 4HGZA 1N8R2 3RZOI 2RPRA 3CC7Z 3HOZI 2V3VA 3IR7A 4A3GI 2NAPA 2JIQA 5FLXf 2IZ3A 1QVGZ 1NJI1 2JS4A 1VQNZ 1NJI2 3J7A4 3VB9A 3CCVZ 4Y7NI 2VUMI 1SIWA 2QRCB 2JA8I 1FDOA 5FLMI 1TWHI 3CMAZ 3CC41 2E7ZA 1TWFI 4X6AI 2V45A 5IP7I 1Q861 2Q51A 2W04A 3MZKB 1K9M1 3CXCY 1K9M2 1WIIA 2E2JI 3QWUA 1KRLA 3CCM1 1YIT1 4NBHA 3VMGA 2PMZA 1JJ2Z 2VUGA 5C3EI 4A93I 1VQN1 2PK7A 1S7MA 1VQ61 1Q821 2GTIA 3EERA 4RVDA 3JAMf 3S1MI 4NH1C 1VQ91 2IZ4A 1VQ51 1YUAA 4HGYA 1M1K2 2QEXZ 2W03A 2IV2X 1AA6A 3GTMI 3J80b 2OZKA 3GTQI 3LUSA 3BG1B 1KC81 2OTJZ 2JA7I 2J6AA 2E2HI 4NFRA 1YI21 2NVQI 4BBSI 4EWCA 4Y52I 2DE7A 1QVFZ 5IP9I 1SFOI 2YADA 3OW2Z 2K5RA 1K731 4NOZA 1KQSZ 3S2DI 1K732 3KIHA 1L1OC 3NDIA 3NH8A 1VQMZ 2NVXI 3NFZA 3PO2I 3KIFA 1I3QI 1W2BZ 2QKDA 3I4MI 1VQ71 3RZDI 3S16I 1RLYA 3HOWI 2QA41 4NBAA 1VQOZ 1Q811 2JIRA 1ZB8A 3HOUI 4E2ZA 1Q812 3T4NB 3U50C 3G6EZ 2JUBA 2O53A 2F4OA 2OTJ1 1QVGY 2K3RA 2AKLA 3CC4Z 1USPB 5IT9f 1I50I 3EEDA 3VTNA 3M3YI 3VMIA 2JIOA 4BBRI 2M6NA 1VQK1 1VQM1 3F3FC 3CCMZ 1YITZ 4CL1A 3CCS1 3HOYI 2JR6A 2EGTA 4DQYB 3I551 3FQQA 1VQ6Z 5C4JI 2LFUA 3GCFA 4NBGA 1VQO1 4BY7I 4NBDA 3CCLZ 1VQ9Z 1JJ2Y 1WCMI 3J81f 1VQ5Z 2V8IA 3G6E1 2LIYA 2OOXB 2RBLA 3CD61 3PO3S 3CCUZ 2KI7B 4NBCA 1R9TI 1YI2Z 2OOYB 5D1OA 3MZLB 2V8KA 1Y1VS 4MD9A 2JIPA 3H0GI 3CPWZ 4RV9A 2R7ZI 2VPWA 4E2XA 4E33A 5T64A 1S721 4A3BI 3CCQ1 1VQL1 1RNIA 3HOXI 2ZAEB 2JNYA 1QVFY 4MH4A 3OW2Y 2R93I 1KQSY 1I6HI 1USPA 3GKQA 3CCL1 2WAQA 1M1K1 1VQ7Z 2VPYA 1YIJZ 2QA4Z 1Q7Y2 1W2BY 5C4XI 2E9HA 3NH4A 3CCU1 3GTMS
chains in the Genus database with same CATH topology
4RVFA 2E2II 3VMHA 3TE5B 4A3MI 3CCE1 1RO4A 3HKZA 4S1TA 2RIQA 3BG0B 1VQKZ 3JAMb 4QTTA 3G4S1 5LL6f 3CCSZ 5A2Qf 1VQ8Z 3S2HI 1ZB9A 1RQFA 3D6WA 1KD12 3I55Z 1DL6A 1YIJ1 1YJW1 2OTL1 3S15I 3MONA 2V8JA 4RVHA 1VQ4Z 3HOVI 1WW9A 1X0TA 4BXXI 4BY1I 3S1NI 2WB1A 4RVGA 3CD6Z 3F3PC 3CMEZ 3CCRZ 2QREB 4NB8A 2P28A 2RT9A 1X3ZA 4A3EI 5AN9F 1VQ81 2DE6A 1S72Z 2PM9A 3CCQZ 1VQLZ 4DK1A 4A3FI 1Y1WI 4NB9A 4A3DI 2DE5A 1VLAA 2F4MA 1Z02A 3CPWY 4NBBA 2GU2A 1K8A1 1VQ41 5IT9b 1K8A2 2NVTI 2RHBA 3IF8A 1YJ91 1QYPA 2R6MA 4MXUA 4A3CI 3FKII 3CME1 2JA6I 3CCR1 2HU9A 3CCJZ 1QF8A 3GTGI 4E31A 2R92I 4E30A 4QTUA 5FLXb 1RO0A 1YHQZ 1VQPZ 3S1QI 1TWAI 3CCEZ 2O4HA 5C44I 3PO3I 4XX2A 3I561 3CC21 1NP6A 4MRIA 3G4SZ 1Y1VI 3J81b 2BJOA 4MD8A 2P3YA 2KPIA 3S17I 1K83I 1Q862 3J80f 4E32A 2GTHA 1LQLA 1YJWZ 3GTPI 2I3CA 1Q7Y1 2OTLZ 3CC71 4A3JI 5T6BA 1YJNZ 4E2WA 3CQZI 3H3VJ 1P9NA 1ZH1A 2YU9I 1Z01A 3CCJ1 1Q822 3S14I 1PFTA 2QLVB 2VF1A 3ESWA 4AYBA 3CCV1 1VQP1 1YHQ1 2B63I 5D1PA 4DGLA 4A3LI 4TNUA 3CMA1 3CXCZ 1YUKA 2JA5I 3G71Z 3IFUA 2QRDB 3Q87A 1KD11 3IX0A 2JMOA 1KC82 2HF1A 2Q4ZA 3NDJA 3GTJI 3D9XA 4MONA 1N2FA 4E2YA 1TWCI 1Z03A 1YJN1 1TWGI 2M48A 1YJ9Z 5D1OB 1RO2A 4RS4A 2NVYI 2Y0SA 2QR1B 4NBFA 4MD7A 3P5JB 1X3WA 1TFIA 3K7AI 5A2Qb 3M4OI 3FQMA 2QEX1 4A3II 4A3KI 3G711 3I4NI 1M901 5T67A 3GTKI 1M902 4NBEA 3GTOI 3I56Z 3I07A 2G2KA 3CC2Z 2H85A 3TDHB 3S1RI 3GTLI 3NH5A 1ML8A 5CM2M 4HH4A 1JWHC 1N8R1 1NUIA 4HGZA 1N8R2 3RZOI 2RPRA 3CC7Z 3HOZI 4A3GI 5FLXf 2IZ3A 1QVGZ 1NJI1 2JS4A 1VQNZ 1NJI2 3J7A4 3VB9A 3CCVZ 4Y7NI 2VUMI 2QRCB 2JA8I 5FLMI 1TWHI 3CMAZ 3CC41 4X6AI 1TWFI 5IP7I 1Q861 2Q51A 2W04A 3MZKB 1K9M1 3CXCY 1K9M2 1WIIA 2E2JI 3QWUA 1KRLA 3CCM1 1YIT1 4NBHA 3VMGA 2PMZA 1JJ2Z 2VUGA 5C3EI 4A93I 1VQN1 2PK7A 1S7MA 1VQ61 1Q821 2GTIA 3EERA 4RVDA 3JAMf 3S1MI 4NH1C 1VQ91 2IZ4A 1VQ51 1YUAA 4HGYA 1M1K2 2QEXZ 2W03A 3GTMI 3J80b 2OZKA 3GTQI 3LUSA 3BG1B 1KC81 2OTJZ 2JA7I 2J6AA 2E2HI 4NFRA 1YI21 2NVQI 4BBSI 4EWCA 4Y52I 2DE7A 1QVFZ 5IP9I 1SFOI 2YADA 3OW2Z 2K5RA 1K731 4NOZA 1KQSZ 3S2DI 1K732 3KIHA 1L1OC 3NDIA 3NH8A 1VQMZ 2NVXI 3NFZA 3PO2I 3KIFA 1I3QI 1W2BZ 2QKDA 3I4MI 1VQ71 3RZDI 3S16I 1RLYA 3HOWI 2QA41 4NBAA 1VQOZ 1Q811 1ZB8A 3HOUI 4E2ZA 1Q812 3T4NB 3U50C 3G6EZ 2JUBA 2O53A 2F4OA 2OTJ1 1QVGY 2K3RA 2AKLA 3CC4Z 1USPB 5IT9f 1I50I 3EEDA 3VTNA 3M3YI 3VMIA 4BBRI 2M6NA 1VQK1 1VQM1 3F3FC 3CCMZ 1YITZ 4CL1A 3CCS1 3HOYI 2JR6A 2EGTA 4DQYB 3I551 3FQQA 1VQ6Z 5C4JI 2LFUA 3GCFA 4NBGA 1VQO1 4BY7I 4NBDA 3CCLZ 1VQ9Z 1JJ2Y 1WCMI 3J81f 1VQ5Z 2V8IA 3G6E1 2LIYA 2OOXB 2RBLA 3CD61 3PO3S 3CCUZ 2KI7B 4NBCA 1R9TI 1YI2Z 2OOYB 5D1OA 3MZLB 2V8KA 1Y1VS 4MD9A 3H0GI 3CPWZ 4RV9A 2R7ZI 4E2XA 4E33A 5T64A 1S721 4A3BI 3CCQ1 1VQL1 1RNIA 3HOXI 2ZAEB 2JNYA 1QVFY 4MH4A 3OW2Y 2R93I 1KQSY 1I6HI 1USPA 3GKQA 3CCL1 2WAQA 1M1K1 1VQ7Z 1YIJZ 2QA4Z 1Q7Y2 1W2BY 5C4XI 2E9HA 3NH4A 3CCU1 3GTMS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MON A;  1KRL A;  4MON A; 
#chains in the Genus database with same CATH topology
 4RVF A;  2E2I I;  1Y8C A;  3VMH A;  3TE5 B;  2JIM A;  4A3M I;  3CCE 1;  1RO4 A;  3HKZ A;  4S1T A;  2RIQ A;  3BG0 B;  1FDI A;  1VQK Z;  3JAM b;  4QTT A;  3G4S 1;  5LL6 f;  3CCS Z;  5A2Q f;  1VQ8 Z;  3S2H I;  1ZB9 A;  1RQF A;  3D6W A;  1KD1 2;  3I55 Z;  1DL6 A;  1YIJ 1;  1YJW 1;  2OTL 1;  3S15 I;  3MON A;  2V8J A;  4RVH A;  1VQ4 Z;  3HOV I;  1WW9 A;  1X0T A;  4BXX I;  4BY1 I;  3S1N I;  2WB1 A;  4RVG A;  3CD6 Z;  3F3P C;  3CME Z;  1WJ2 A;  3CCR Z;  2VPX A;  2QRE B;  4NB8 A;  2P28 A;  2RT9 A;  1X3Z A;  4A3E I;  5AN9 F;  1VQ8 1;  2DE6 A;  1S72 Z;  2PM9 A;  3CCQ Z;  1VQL Z;  4DK1 A;  1Q16 A;  4A3F I;  1Y1W I;  4NB9 A;  4A3D I;  2DE5 A;  1VLA A;  2F4M A;  1Z02 A;  3CPW Y;  4NBB A;  2GU2 A;  1K8A 1;  1VQ4 1;  5IT9 b;  1K8A 2;  2AYD A;  2NVT I;  2RHB A;  3IF8 A;  1YJ9 1;  1QYP A;  2R6M A;  4MXU A;  4A3C I;  1QXF A;  3FKI I;  3CME 1;  2JA6 I;  3CCR 1;  2HU9 A;  3CCJ Z;  1QF8 A;  3GTG I;  4E31 A;  2R92 I;  4E30 A;  4QTU A;  5FLX b;  1RO0 A;  1YHQ Z;  1VQP Z;  3S1Q I;  1TWA I;  3CCE Z;  2O4H A;  5C44 I;  3D2L A;  3PO3 I;  4XX2 A;  3I56 1;  3CC2 1;  1NP6 A;  4MRI A;  3G4S Z;  1Y1V I;  3J81 b;  2BJO A;  4MD8 A;  2P3Y A;  2KPI A;  3S17 I;  1K83 I;  1Q86 2;  3J80 f;  4E32 A;  2GTH A;  1LQL A;  1YJW Z;  3GTP I;  2I3C A;  1Q7Y 1;  2OTL Z;  3CC7 1;  4A3J I;  5T6B A;  1YJN Z;  4E2W A;  3CQZ I;  3H3V J;  1P9N A;  1ZH1 A;  2YU9 I;  1Z01 A;  3CCJ 1;  1Q82 2;  3S14 I;  1PFT A;  2VPZ A;  2QLV B;  2VF1 A;  3ESW A;  4AYB A;  3CCV 1;  2LEX A;  1VQP 1;  1YHQ 1;  2B63 I;  5D1P A;  4DGL A;  4A3L I;  1WZN A;  4TNU A;  3CMA 1;  3CXC Z;  1YUK A;  2JA5 I;  3G71 Z;  3IFU A;  2QRD B;  3Q87 A;  1KD1 1;  3IX0 A;  2JMO A;  1KC8 2;  2HF1 A;  2Q4Z A;  3NDJ A;  3GTJ I;  3D9X A;  4MON A;  1N2F A;  4E2Y A;  1TWC I;  1Z03 A;  1YJN 1;  1TWG I;  2M48 A;  1YJ9 Z;  5D1O B;  1RO2 A;  4RS4 A;  2NVY I;  2Y0S A;  2QR1 B;  4NBF A;  4MD7 A;  3P5J B;  1X3W A;  1TFI A;  3K7A I;  5A2Q b;  3M4O I;  3FQM A;  2QEX 1;  4A3I I;  4A3K I;  3G71 1;  3I4N I;  1M90 1;  5T67 A;  3GTK I;  1M90 2;  4NBE A;  3GTO I;  3I56 Z;  3I07 A;  2G2K A;  3CC2 Z;  2H85 A;  3TDH B;  3S1R I;  3GTL I;  3NH5 A;  1ML8 A;  5CM2 M;  4HH4 A;  1JWH C;  1N8R 1;  1NUI A;  4HGZ A;  1N8R 2;  3RZO I;  2RPR A;  3CC7 Z;  3HOZ I;  2V3V A;  3IR7 A;  4A3G I;  2NAP A;  2JIQ A;  5FLX f;  2IZ3 A;  1QVG Z;  1NJI 1;  2JS4 A;  1VQN Z;  1NJI 2;  3J7A 4;  3VB9 A;  3CCV Z;  4Y7N I;  2VUM I;  1SIW A;  2QRC B;  2JA8 I;  1FDO A;  5FLM I;  1TWH I;  3CMA Z;  3CC4 1;  2E7Z A;  1TWF I;  4X6A I;  2V45 A;  5IP7 I;  1Q86 1;  2Q51 A;  2W04 A;  3MZK B;  1K9M 1;  3CXC Y;  1K9M 2;  1WII A;  2E2J I;  3QWU A;  1KRL A;  3CCM 1;  1YIT 1;  4NBH A;  3VMG A;  2PMZ A;  1JJ2 Z;  2VUG A;  5C3E I;  4A93 I;  1VQN 1;  2PK7 A;  1S7M A;  1VQ6 1;  1Q82 1;  2GTI A;  3EER A;  4RVD A;  3JAM f;  3S1M I;  4NH1 C;  1VQ9 1;  2IZ4 A;  1VQ5 1;  1YUA A;  4HGY A;  1M1K 2;  2QEX Z;  2W03 A;  2IV2 X;  1AA6 A;  3GTM I;  3J80 b;  2OZK A;  3GTQ I;  3LUS A;  3BG1 B;  1KC8 1;  2OTJ Z;  2JA7 I;  2J6A A;  2E2H I;  4NFR A;  1YI2 1;  2NVQ I;  4BBS I;  4EWC A;  4Y52 I;  2DE7 A;  1QVF Z;  5IP9 I;  1SFO I;  2YAD A;  3OW2 Z;  2K5R A;  1K73 1;  4NOZ A;  1KQS Z;  3S2D I;  1K73 2;  3KIH A;  1L1O C;  3NDI A;  3NH8 A;  1VQM Z;  2NVX I;  3NFZ A;  3PO2 I;  3KIF A;  1I3Q I;  1W2B Z;  2QKD A;  3I4M I;  1VQ7 1;  3RZD I;  3S16 I;  1RLY A;  3HOW I;  2QA4 1;  4NBA A;  1VQO Z;  1Q81 1;  2JIR A;  1ZB8 A;  3HOU I;  4E2Z A;  1Q81 2;  3T4N B;  3U50 C;  3G6E Z;  2JUB A;  2O53 A;  2F4O A;  2OTJ 1;  1QVG Y;  2K3R A;  2AKL A;  3CC4 Z;  1USP B;  5IT9 f;  1I50 I;  3EED A;  3VTN A;  3M3Y I;  3VMI A;  2JIO A;  4BBR I;  2M6N A;  1VQK 1;  1VQM 1;  3F3F C;  3CCM Z;  1YIT Z;  4CL1 A;  3CCS 1;  3HOY I;  2JR6 A;  2EGT A;  4DQY B;  3I55 1;  3FQQ A;  1VQ6 Z;  5C4J I;  2LFU A;  3GCF A;  4NBG A;  1VQO 1;  4BY7 I;  4NBD A;  3CCL Z;  1VQ9 Z;  1JJ2 Y;  1WCM I;  3J81 f;  1VQ5 Z;  2V8I A;  3G6E 1;  2LIY A;  2OOX B;  2RBL A;  3CD6 1;  3PO3 S;  3CCU Z;  2KI7 B;  4NBC A;  1R9T I;  1YI2 Z;  2OOY B;  5D1O A;  3MZL B;  2V8K A;  1Y1V S;  4MD9 A;  2JIP A;  3H0G I;  3CPW Z;  4RV9 A;  2R7Z I;  2VPW A;  4E2X A;  4E33 A;  5T64 A;  1S72 1;  4A3B I;  3CCQ 1;  1VQL 1;  1RNI A;  3HOX I;  2ZAE B;  2JNY A;  1QVF Y;  4MH4 A;  3OW2 Y;  2R93 I;  1KQS Y;  1I6H I;  1USP A;  3GKQ A;  3CCL 1;  2WAQ A;  1M1K 1;  1VQ7 Z;  2VPY A;  1YIJ Z;  2QA4 Z;  1Q7Y 2;  1W2B Y;  5C4X I;  2E9H A;  3NH4 A;  3CCU 1;  3GTM S; 
#chains in the Genus database with same CATH homology
 4RVF A;  2E2I I;  3VMH A;  3TE5 B;  4A3M I;  3CCE 1;  1RO4 A;  3HKZ A;  4S1T A;  2RIQ A;  3BG0 B;  1VQK Z;  3JAM b;  4QTT A;  3G4S 1;  5LL6 f;  3CCS Z;  5A2Q f;  1VQ8 Z;  3S2H I;  1ZB9 A;  1RQF A;  3D6W A;  1KD1 2;  3I55 Z;  1DL6 A;  1YIJ 1;  1YJW 1;  2OTL 1;  3S15 I;  3MON A;  2V8J A;  4RVH A;  1VQ4 Z;  3HOV I;  1WW9 A;  1X0T A;  4BXX I;  4BY1 I;  3S1N I;  2WB1 A;  4RVG A;  3CD6 Z;  3F3P C;  3CME Z;  3CCR Z;  2QRE B;  4NB8 A;  2P28 A;  2RT9 A;  1X3Z A;  4A3E I;  5AN9 F;  1VQ8 1;  2DE6 A;  1S72 Z;  2PM9 A;  3CCQ Z;  1VQL Z;  4DK1 A;  4A3F I;  1Y1W I;  4NB9 A;  4A3D I;  2DE5 A;  1VLA A;  2F4M A;  1Z02 A;  3CPW Y;  4NBB A;  2GU2 A;  1K8A 1;  1VQ4 1;  5IT9 b;  1K8A 2;  2NVT I;  2RHB A;  3IF8 A;  1YJ9 1;  1QYP A;  2R6M A;  4MXU A;  4A3C I;  3FKI I;  3CME 1;  2JA6 I;  3CCR 1;  2HU9 A;  3CCJ Z;  1QF8 A;  3GTG I;  4E31 A;  2R92 I;  4E30 A;  4QTU A;  5FLX b;  1RO0 A;  1YHQ Z;  1VQP Z;  3S1Q I;  1TWA I;  3CCE Z;  2O4H A;  5C44 I;  3PO3 I;  4XX2 A;  3I56 1;  3CC2 1;  1NP6 A;  4MRI A;  3G4S Z;  1Y1V I;  3J81 b;  2BJO A;  4MD8 A;  2P3Y A;  2KPI A;  3S17 I;  1K83 I;  1Q86 2;  3J80 f;  4E32 A;  2GTH A;  1LQL A;  1YJW Z;  3GTP I;  2I3C A;  1Q7Y 1;  2OTL Z;  3CC7 1;  4A3J I;  5T6B A;  1YJN Z;  4E2W A;  3CQZ I;  3H3V J;  1P9N A;  1ZH1 A;  2YU9 I;  1Z01 A;  3CCJ 1;  1Q82 2;  3S14 I;  1PFT A;  2QLV B;  2VF1 A;  3ESW A;  4AYB A;  3CCV 1;  1VQP 1;  1YHQ 1;  2B63 I;  5D1P A;  4DGL A;  4A3L I;  4TNU A;  3CMA 1;  3CXC Z;  1YUK A;  2JA5 I;  3G71 Z;  3IFU A;  2QRD B;  3Q87 A;  1KD1 1;  3IX0 A;  2JMO A;  1KC8 2;  2HF1 A;  2Q4Z A;  3NDJ A;  3GTJ I;  3D9X A;  4MON A;  1N2F A;  4E2Y A;  1TWC I;  1Z03 A;  1YJN 1;  1TWG I;  2M48 A;  1YJ9 Z;  5D1O B;  1RO2 A;  4RS4 A;  2NVY I;  2Y0S A;  2QR1 B;  4NBF A;  4MD7 A;  3P5J B;  1X3W A;  1TFI A;  3K7A I;  5A2Q b;  3M4O I;  3FQM A;  2QEX 1;  4A3I I;  4A3K I;  3G71 1;  3I4N I;  1M90 1;  5T67 A;  3GTK I;  1M90 2;  4NBE A;  3GTO I;  3I56 Z;  3I07 A;  2G2K A;  3CC2 Z;  2H85 A;  3TDH B;  3S1R I;  3GTL I;  3NH5 A;  1ML8 A;  5CM2 M;  4HH4 A;  1JWH C;  1N8R 1;  1NUI A;  4HGZ A;  1N8R 2;  3RZO I;  2RPR A;  3CC7 Z;  3HOZ I;  4A3G I;  5FLX f;  2IZ3 A;  1QVG Z;  1NJI 1;  2JS4 A;  1VQN Z;  1NJI 2;  3J7A 4;  3VB9 A;  3CCV Z;  4Y7N I;  2VUM I;  2QRC B;  2JA8 I;  5FLM I;  1TWH I;  3CMA Z;  3CC4 1;  4X6A I;  1TWF I;  5IP7 I;  1Q86 1;  2Q51 A;  2W04 A;  3MZK B;  1K9M 1;  3CXC Y;  1K9M 2;  1WII A;  2E2J I;  3QWU A;  1KRL A;  3CCM 1;  1YIT 1;  4NBH A;  3VMG A;  2PMZ A;  1JJ2 Z;  2VUG A;  5C3E I;  4A93 I;  1VQN 1;  2PK7 A;  1S7M A;  1VQ6 1;  1Q82 1;  2GTI A;  3EER A;  4RVD A;  3JAM f;  3S1M I;  4NH1 C;  1VQ9 1;  2IZ4 A;  1VQ5 1;  1YUA A;  4HGY A;  1M1K 2;  2QEX Z;  2W03 A;  3GTM I;  3J80 b;  2OZK A;  3GTQ I;  3LUS A;  3BG1 B;  1KC8 1;  2OTJ Z;  2JA7 I;  2J6A A;  2E2H I;  4NFR A;  1YI2 1;  2NVQ I;  4BBS I;  4EWC A;  4Y52 I;  2DE7 A;  1QVF Z;  5IP9 I;  1SFO I;  2YAD A;  3OW2 Z;  2K5R A;  1K73 1;  4NOZ A;  1KQS Z;  3S2D I;  1K73 2;  3KIH A;  1L1O C;  3NDI A;  3NH8 A;  1VQM Z;  2NVX I;  3NFZ A;  3PO2 I;  3KIF A;  1I3Q I;  1W2B Z;  2QKD A;  3I4M I;  1VQ7 1;  3RZD I;  3S16 I;  1RLY A;  3HOW I;  2QA4 1;  4NBA A;  1VQO Z;  1Q81 1;  1ZB8 A;  3HOU I;  4E2Z A;  1Q81 2;  3T4N B;  3U50 C;  3G6E Z;  2JUB A;  2O53 A;  2F4O A;  2OTJ 1;  1QVG Y;  2K3R A;  2AKL A;  3CC4 Z;  1USP B;  5IT9 f;  1I50 I;  3EED A;  3VTN A;  3M3Y I;  3VMI A;  4BBR I;  2M6N A;  1VQK 1;  1VQM 1;  3F3F C;  3CCM Z;  1YIT Z;  4CL1 A;  3CCS 1;  3HOY I;  2JR6 A;  2EGT A;  4DQY B;  3I55 1;  3FQQ A;  1VQ6 Z;  5C4J I;  2LFU A;  3GCF A;  4NBG A;  1VQO 1;  4BY7 I;  4NBD A;  3CCL Z;  1VQ9 Z;  1JJ2 Y;  1WCM I;  3J81 f;  1VQ5 Z;  2V8I A;  3G6E 1;  2LIY A;  2OOX B;  2RBL A;  3CD6 1;  3PO3 S;  3CCU Z;  2KI7 B;  4NBC A;  1R9T I;  1YI2 Z;  2OOY B;  5D1O A;  3MZL B;  2V8K A;  1Y1V S;  4MD9 A;  3H0G I;  3CPW Z;  4RV9 A;  2R7Z I;  4E2X A;  4E33 A;  5T64 A;  1S72 1;  4A3B I;  3CCQ 1;  1VQL 1;  1RNI A;  3HOX I;  2ZAE B;  2JNY A;  1QVF Y;  4MH4 A;  3OW2 Y;  2R93 I;  1KQS Y;  1I6H I;  1USP A;  3GKQ A;  3CCL 1;  2WAQ A;  1M1K 1;  1VQ7 Z;  1YIJ Z;  2QA4 Z;  1Q7Y 2;  1W2B Y;  5C4X I;  2E9H A;  3NH4 A;  3CCU 1;  3GTM S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...