1KRLA

Crystal structure of racemic dl-monellin in p-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MONELLIN, CHAIN A
publication title Structural differences in D and L-monellin in the crystals of racemic mixture.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 7
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1krlA00
1KRLA 4MONA 3MONA
chains in the Genus database with same CATH superfamily
1W2BY 2JA6I 2JIMA 3P5JB 3EERA 2W03A 3I561 1KC81 3GTLI 1YITZ 2NVYI 3CC2Z 1VLAA 2F4OA 3CCR1 3CC7Z 4HGZA 1L1OC 2NVQI 2V8JA 2HU9A 5C4XI 1N8R1 5LL6f 3IF8A 4Y52I 3S17I 3J81f 2P28A 3CCM1 3PO3I 2DE6A 4NBCA 3H0GI 4RVHA 1Q822 5FLXb 1R9TI 4TNUA 1VQ81 4A3EI 3U50C 1VQM1 1VQKZ 3GTQI 3RZOI 3CCUZ 3GTMS 2OTLZ 2Q4ZA 5AN9F 2QA41 1VQNZ 1X3WA 2VPYA 3PO2I 3I551 2NAPA 2I3CA 3OW2Y 1VQ41 4NH1C 3I4MI 4NBAA 1VQ51 4QTUA 3CXCY 1K8A2 3CCLZ 1VQPZ 3S2HI 1X3ZA 3K7AI 1TFIA 2E9HA 3Q87A 4RVFA 2W04A 4NB9A 3CC21 1Q861 4MXUA 1NP6A 5A2Qf 2JIOA 1P9NA 1TWCI 1QVFY 1K732 2QRDB 1K83I 2RIQA 1VQ6Z 1VQ91 3D6WA 1Q7Y1 2E2II 1M901 1VQ7Z 3S2DI 2VF1A 3I56Z 4MRIA 3CCE1 2IV2X 2Q51A 5C44I 4A3GI 1ZH1A 3CCRZ 1Y1WI 2VPWA 1YUAA 2QLVB 4A93I 2JA8I 5C3EI 3BG0B 3CCMZ 1VQL1 5IT9b 4Y7NI 3CCL1 2G2KA 1FDIA 4E2YA 1VQMZ 3G711 2B63I 1Y1VI 3S1QI 1RQFA 1JJ2Z 4NBHA 2YU9I 4A3JI 3S16I 2DE7A 3I55Z 2OOXB 1KD11 3BG1B 3J80b 3GCFA 1QVGZ 1VQ4Z 2NVTI 3IR7A 4BBRI 3GTPI 2E2JI 1VQ71 3CC41 1SFOI 4NB8A 1N2FA 2M6NA 4XX2A 3J81b 2AYDA 4BY7I 3I4NI 2K5RA 4DGLA 2QREB 2GTHA 3NDJA 3H3VJ 1VQ9Z 3HOZI 2O4HA 3D2LA 4CL1A 1K9M2 1K8A1 5IP9I 3TE5B 3CCVZ 3G4S1 3CCEZ 1Y8CA 2JNYA 2RBLA 4E30A 2V8IA 1X0TA 1VQLZ 4A3LI 3GTMI 1KC82 1K731 1I6HI 2GU2A 1TWAI 2JIPA 3GTKI 3TDHB 3HOXI 1Z02A 1NJI1 4HH4A 5A2Qb 3G71Z 3CCS1 5D1PA 4A3KI 4DQYB 3HOUI 2YADA 4QTTA 1M1K1 2RHBA 1YI2Z 1Q811 4S1TA 1PFTA 3T4NB 3CME1 2F4MA 3S1RI 5IP7I 2HF1A 2M48A 3CPWZ 2KI7B 2AKLA 4RS4A 3VMHA 3MZLB 4E33A 1I3QI 2R6MA 4NBBA 3CC4Z 3CCV1 1YUKA 2OZKA 3J7A4 2EGTA 3KIFA 1QYPA 4HGYA 1RLYA 4EWCA 3GKQA 1VQO1 3RZDI 1QXFA 1YJW1 3LUSA 3IX0A 2Y0SA 2QEX1 2JA5I 4E32A 1Q862 1WJ2A 1KQSZ 1I50I 3ESWA 3NFZA 3G4SZ 2VUMI 4BXXI 2J6AA 2IZ4A 1YJN1 2JUBA 3VMGA 2R7ZI 3FQMA 3S1NI 3VB9A 1YI21 3HOWI 2VPXA 1JWHC 2PM9A 3NDIA 1Q7Y2 5D1OA 4RVGA 2O53A 2QR1B 3HOVI 2JIQA 2LEXA 1FDOA 1KRLA 1W2BZ 1QF8A 3KIHA 5IT9f 1S721 1Q821 2JMOA 3CCSZ 3CCQZ 4A3CI 3EEDA 2RPRA 2E7ZA 1JJ2Y 3MZKB 2BJOA 3CMEZ 4DK1A 2PMZA 1QVGY 5T64A 4E2ZA 3HKZA 5T6BA 3J80f 3M4OI 2R92I 3JAMf 1AA6A 3PO3S 4MD8A 4NBDA 1Z03A 1YHQ1 1KD12 4MD9A 3GTJI 4NBGA 3CCJZ 3F3FC 1TWHI 2E2HI 2JIRA 2R93I 2PK7A 2ZAEB 3OW2Z 4A3BI 3CQZI 3S14I 1VQOZ 1YJWZ 2JR6A 5C4JI 4A3DI 3NH8A 2GTIA 3CXCZ 2QEXZ 2KPIA 3FKII 1NUIA 3CMA1 2JS4A 4X6AI 1YIJ1 1LQLA 2QRCB 4MD7A 2LIYA 5FLXf 2H85A 4NBFA 4AYBA 4RV9A 4MH4A 3G6EZ 3CCQ1 1TWGI 1N8R2 2OTJZ 1YJNZ 1ZB9A 5D1OB 4E31A 4NOZA 1DL6A 4E2XA 1Z01A 1QVFZ 1YJ91 4E2WA 3IFUA 4MONA 4BBSI 3D9XA 3MONA 2IZ3A 2DE5A 1S72Z 1ML8A 1SIWA 1YIT1 3QWUA 3GTGI 1USPB 3CD6Z 3GTOI 2K3RA 3CC71 2WB1A 3CCJ1 3FQQA 2P3YA 5FLMI 1TWFI 3M3YI 3VMIA 2V45A 1RO2A 1NJI2 3CPWY 1Q16A 4RVDA 1VQK1 2JA7I 3NH4A 1WCMI 1ZB8A 3CCU1 1M1K2 1RO0A 1Q812 2OTL1 3G6E1 1YHQZ 2OTJ1 1VQN1 4A3MI 2VPZA 2LFUA 1RO4A 2NVXI 5CM2M 2V3VA 3HOYI 3F3PC 3S15I 1WZNA 1Y1VS 1M902 1VQP1 1VQ8Z 3CMAZ 4NBEA 1YIJZ 1KQSY 3VTNA 2WAQA 1S7MA 3CD61 1K9M1 2QA4Z 2OOYB 2VUGA 1WIIA 3S1MI 3I07A 1USPA 1WW9A 2RT9A 2V8KA 4A3FI 4NFRA 1RNIA 3JAMb 1YJ9Z 4BY1I 3NH5A 5T67A 4A3II 1VQ5Z 1VQ61 2QKDA
chains in the Genus database with same CATH topology
1W2BY 2JA6I 3P5JB 3EERA 2W03A 3I561 1KC81 3GTLI 1YITZ 2NVYI 3CC2Z 1VLAA 2F4OA 3CCR1 3CC7Z 4HGZA 1L1OC 2NVQI 2V8JA 2HU9A 5C4XI 1N8R1 5LL6f 3IF8A 4Y52I 3S17I 3J81f 2P28A 3CCM1 3PO3I 2DE6A 4NBCA 3H0GI 4RVHA 1Q822 5FLXb 1R9TI 4TNUA 1VQ81 4A3EI 3U50C 1VQM1 1VQKZ 3GTQI 3RZOI 3CCUZ 3GTMS 2OTLZ 2Q4ZA 5AN9F 2QA41 1VQNZ 1X3WA 3PO2I 3I551 2I3CA 3OW2Y 1VQ41 4NH1C 3I4MI 4NBAA 1VQ51 4QTUA 3CXCY 1K8A2 3CCLZ 1VQPZ 3S2HI 1X3ZA 3K7AI 1TFIA 2E9HA 3Q87A 4RVFA 2W04A 4NB9A 3CC21 1Q861 4MXUA 1NP6A 5A2Qf 1P9NA 1TWCI 1QVFY 1K732 2QRDB 1K83I 2RIQA 1VQ6Z 1VQ91 3D6WA 1Q7Y1 2E2II 1M901 1VQ7Z 3S2DI 2VF1A 3I56Z 4MRIA 3CCE1 2Q51A 5C44I 4A3GI 1ZH1A 3CCRZ 1Y1WI 1YUAA 2QLVB 4A93I 2JA8I 5C3EI 3BG0B 3CCMZ 1VQL1 5IT9b 4Y7NI 3CCL1 2G2KA 4E2YA 1VQMZ 3G711 2B63I 1Y1VI 3S1QI 1RQFA 1JJ2Z 4NBHA 2YU9I 4A3JI 3S16I 2DE7A 3I55Z 2OOXB 1KD11 3BG1B 3J80b 3GCFA 1QVGZ 1VQ4Z 2NVTI 4BBRI 3GTPI 2E2JI 1VQ71 3CC41 1SFOI 4NB8A 1N2FA 2M6NA 4XX2A 3J81b 4BY7I 3I4NI 2K5RA 4DGLA 2QREB 2GTHA 3NDJA 3H3VJ 1VQ9Z 3HOZI 2O4HA 4CL1A 1K9M2 1K8A1 5IP9I 3TE5B 3CCVZ 3G4S1 3CCEZ 2JNYA 2RBLA 4E30A 2V8IA 1X0TA 1VQLZ 4A3LI 3GTMI 1KC82 1K731 1I6HI 2GU2A 1TWAI 3GTKI 3TDHB 3HOXI 1Z02A 1NJI1 4HH4A 5A2Qb 3G71Z 3CCS1 5D1PA 4A3KI 4DQYB 3HOUI 2YADA 4QTTA 1M1K1 2RHBA 1YI2Z 1Q811 4S1TA 1PFTA 3T4NB 3CME1 2F4MA 3S1RI 5IP7I 2HF1A 2M48A 3CPWZ 2KI7B 2AKLA 4RS4A 3VMHA 3MZLB 4E33A 1I3QI 2R6MA 4NBBA 3CC4Z 3CCV1 1YUKA 2OZKA 3J7A4 2EGTA 3KIFA 1QYPA 4HGYA 1RLYA 4EWCA 3GKQA 1VQO1 3RZDI 1YJW1 3LUSA 3IX0A 2Y0SA 2QEX1 2JA5I 4E32A 1Q862 1KQSZ 1I50I 3ESWA 3NFZA 3G4SZ 2VUMI 4BXXI 2J6AA 2IZ4A 1YJN1 2JUBA 3VMGA 2R7ZI 3FQMA 3S1NI 3VB9A 1YI21 3HOWI 1JWHC 2PM9A 3NDIA 1Q7Y2 5D1OA 4RVGA 2O53A 2QR1B 3HOVI 1KRLA 1W2BZ 1QF8A 3KIHA 5IT9f 1S721 1Q821 2JMOA 3CCSZ 3CCQZ 4A3CI 3EEDA 2RPRA 1JJ2Y 3MZKB 2BJOA 3CMEZ 4DK1A 2PMZA 1QVGY 5T64A 4E2ZA 3HKZA 5T6BA 3J80f 3M4OI 2R92I 3JAMf 3PO3S 4MD8A 4NBDA 1Z03A 1YHQ1 1KD12 4MD9A 3GTJI 4NBGA 3CCJZ 3F3FC 1TWHI 2E2HI 2R93I 2PK7A 2ZAEB 3OW2Z 4A3BI 3CQZI 3S14I 1VQOZ 1YJWZ 2JR6A 5C4JI 4A3DI 3NH8A 2GTIA 3CXCZ 2QEXZ 2KPIA 3FKII 1NUIA 3CMA1 2JS4A 4X6AI 1YIJ1 1LQLA 2QRCB 4MD7A 2LIYA 5FLXf 2H85A 4NBFA 4AYBA 4RV9A 4MH4A 3G6EZ 3CCQ1 1TWGI 1N8R2 2OTJZ 1YJNZ 1ZB9A 5D1OB 4E31A 4NOZA 1DL6A 4E2XA 1Z01A 1QVFZ 1YJ91 4E2WA 3IFUA 4MONA 4BBSI 3D9XA 3MONA 2IZ3A 2DE5A 1S72Z 1ML8A 1YIT1 3QWUA 3GTGI 1USPB 3CD6Z 3GTOI 2K3RA 3CC71 2WB1A 3CCJ1 3FQQA 2P3YA 5FLMI 1TWFI 3M3YI 3VMIA 1RO2A 1NJI2 3CPWY 4RVDA 1VQK1 2JA7I 3NH4A 1WCMI 1ZB8A 3CCU1 1M1K2 1RO0A 1Q812 2OTL1 3G6E1 1YHQZ 2OTJ1 1VQN1 4A3MI 2LFUA 1RO4A 2NVXI 5CM2M 3HOYI 3F3PC 3S15I 1Y1VS 1M902 1VQP1 1VQ8Z 3CMAZ 4NBEA 1YIJZ 1KQSY 3VTNA 2WAQA 1S7MA 3CD61 1K9M1 2QA4Z 2OOYB 2VUGA 1WIIA 3S1MI 3I07A 1USPA 1WW9A 2RT9A 2V8KA 4A3FI 4NFRA 1RNIA 3JAMb 1YJ9Z 4BY1I 3NH5A 5T67A 4A3II 1VQ5Z 1VQ61 2QKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRL A;  4MON A;  3MON A; 
#chains in the Genus database with same CATH topology
 1W2B Y;  2JA6 I;  2JIM A;  3P5J B;  3EER A;  2W03 A;  3I56 1;  1KC8 1;  3GTL I;  1YIT Z;  2NVY I;  3CC2 Z;  1VLA A;  2F4O A;  3CCR 1;  3CC7 Z;  4HGZ A;  1L1O C;  2NVQ I;  2V8J A;  2HU9 A;  5C4X I;  1N8R 1;  5LL6 f;  3IF8 A;  4Y52 I;  3S17 I;  3J81 f;  2P28 A;  3CCM 1;  3PO3 I;  2DE6 A;  4NBC A;  3H0G I;  4RVH A;  1Q82 2;  5FLX b;  1R9T I;  4TNU A;  1VQ8 1;  4A3E I;  3U50 C;  1VQM 1;  1VQK Z;  3GTQ I;  3RZO I;  3CCU Z;  3GTM S;  2OTL Z;  2Q4Z A;  5AN9 F;  2QA4 1;  1VQN Z;  1X3W A;  2VPY A;  3PO2 I;  3I55 1;  2NAP A;  2I3C A;  3OW2 Y;  1VQ4 1;  4NH1 C;  3I4M I;  4NBA A;  1VQ5 1;  4QTU A;  3CXC Y;  1K8A 2;  3CCL Z;  1VQP Z;  3S2H I;  1X3Z A;  3K7A I;  1TFI A;  2E9H A;  3Q87 A;  4RVF A;  2W04 A;  4NB9 A;  3CC2 1;  1Q86 1;  4MXU A;  1NP6 A;  5A2Q f;  2JIO A;  1P9N A;  1TWC I;  1QVF Y;  1K73 2;  2QRD B;  1K83 I;  2RIQ A;  1VQ6 Z;  1VQ9 1;  3D6W A;  1Q7Y 1;  2E2I I;  1M90 1;  1VQ7 Z;  3S2D I;  2VF1 A;  3I56 Z;  4MRI A;  3CCE 1;  2IV2 X;  2Q51 A;  5C44 I;  4A3G I;  1ZH1 A;  3CCR Z;  1Y1W I;  2VPW A;  1YUA A;  2QLV B;  4A93 I;  2JA8 I;  5C3E I;  3BG0 B;  3CCM Z;  1VQL 1;  5IT9 b;  4Y7N I;  3CCL 1;  2G2K A;  1FDI A;  4E2Y A;  1VQM Z;  3G71 1;  2B63 I;  1Y1V I;  3S1Q I;  1RQF A;  1JJ2 Z;  4NBH A;  2YU9 I;  4A3J I;  3S16 I;  2DE7 A;  3I55 Z;  2OOX B;  1KD1 1;  3BG1 B;  3J80 b;  3GCF A;  1QVG Z;  1VQ4 Z;  2NVT I;  3IR7 A;  4BBR I;  3GTP I;  2E2J I;  1VQ7 1;  3CC4 1;  1SFO I;  4NB8 A;  1N2F A;  2M6N A;  4XX2 A;  3J81 b;  2AYD A;  4BY7 I;  3I4N I;  2K5R A;  4DGL A;  2QRE B;  2GTH A;  3NDJ A;  3H3V J;  1VQ9 Z;  3HOZ I;  2O4H A;  3D2L A;  4CL1 A;  1K9M 2;  1K8A 1;  5IP9 I;  3TE5 B;  3CCV Z;  3G4S 1;  3CCE Z;  1Y8C A;  2JNY A;  2RBL A;  4E30 A;  2V8I A;  1X0T A;  1VQL Z;  4A3L I;  3GTM I;  1KC8 2;  1K73 1;  1I6H I;  2GU2 A;  1TWA I;  2JIP A;  3GTK I;  3TDH B;  3HOX I;  1Z02 A;  1NJI 1;  4HH4 A;  5A2Q b;  3G71 Z;  3CCS 1;  5D1P A;  4A3K I;  4DQY B;  3HOU I;  2YAD A;  4QTT A;  1M1K 1;  2RHB A;  1YI2 Z;  1Q81 1;  4S1T A;  1PFT A;  3T4N B;  3CME 1;  2F4M A;  3S1R I;  5IP7 I;  2HF1 A;  2M48 A;  3CPW Z;  2KI7 B;  2AKL A;  4RS4 A;  3VMH A;  3MZL B;  4E33 A;  1I3Q I;  2R6M A;  4NBB A;  3CC4 Z;  3CCV 1;  1YUK A;  2OZK A;  3J7A 4;  2EGT A;  3KIF A;  1QYP A;  4HGY A;  1RLY A;  4EWC A;  3GKQ A;  1VQO 1;  3RZD I;  1QXF A;  1YJW 1;  3LUS A;  3IX0 A;  2Y0S A;  2QEX 1;  2JA5 I;  4E32 A;  1Q86 2;  1WJ2 A;  1KQS Z;  1I50 I;  3ESW A;  3NFZ A;  3G4S Z;  2VUM I;  4BXX I;  2J6A A;  2IZ4 A;  1YJN 1;  2JUB A;  3VMG A;  2R7Z I;  3FQM A;  3S1N I;  3VB9 A;  1YI2 1;  3HOW I;  2VPX A;  1JWH C;  2PM9 A;  3NDI A;  1Q7Y 2;  5D1O A;  4RVG A;  2O53 A;  2QR1 B;  3HOV I;  2JIQ A;  2LEX A;  1FDO A;  1KRL A;  1W2B Z;  1QF8 A;  3KIH A;  5IT9 f;  1S72 1;  1Q82 1;  2JMO A;  3CCS Z;  3CCQ Z;  4A3C I;  3EED A;  2RPR A;  2E7Z A;  1JJ2 Y;  3MZK B;  2BJO A;  3CME Z;  4DK1 A;  2PMZ A;  1QVG Y;  5T64 A;  4E2Z A;  3HKZ A;  5T6B A;  3J80 f;  3M4O I;  2R92 I;  3JAM f;  1AA6 A;  3PO3 S;  4MD8 A;  4NBD A;  1Z03 A;  1YHQ 1;  1KD1 2;  4MD9 A;  3GTJ I;  4NBG A;  3CCJ Z;  3F3F C;  1TWH I;  2E2H I;  2JIR A;  2R93 I;  2PK7 A;  2ZAE B;  3OW2 Z;  4A3B I;  3CQZ I;  3S14 I;  1VQO Z;  1YJW Z;  2JR6 A;  5C4J I;  4A3D I;  3NH8 A;  2GTI A;  3CXC Z;  2QEX Z;  2KPI A;  3FKI I;  1NUI A;  3CMA 1;  2JS4 A;  4X6A I;  1YIJ 1;  1LQL A;  2QRC B;  4MD7 A;  2LIY A;  5FLX f;  2H85 A;  4NBF A;  4AYB A;  4RV9 A;  4MH4 A;  3G6E Z;  3CCQ 1;  1TWG I;  1N8R 2;  2OTJ Z;  1YJN Z;  1ZB9 A;  5D1O B;  4E31 A;  4NOZ A;  1DL6 A;  4E2X A;  1Z01 A;  1QVF Z;  1YJ9 1;  4E2W A;  3IFU A;  4MON A;  4BBS I;  3D9X A;  3MON A;  2IZ3 A;  2DE5 A;  1S72 Z;  1ML8 A;  1SIW A;  1YIT 1;  3QWU A;  3GTG I;  1USP B;  3CD6 Z;  3GTO I;  2K3R A;  3CC7 1;  2WB1 A;  3CCJ 1;  3FQQ A;  2P3Y A;  5FLM I;  1TWF I;  3M3Y I;  3VMI A;  2V45 A;  1RO2 A;  1NJI 2;  3CPW Y;  1Q16 A;  4RVD A;  1VQK 1;  2JA7 I;  3NH4 A;  1WCM I;  1ZB8 A;  3CCU 1;  1M1K 2;  1RO0 A;  1Q81 2;  2OTL 1;  3G6E 1;  1YHQ Z;  2OTJ 1;  1VQN 1;  4A3M I;  2VPZ A;  2LFU A;  1RO4 A;  2NVX I;  5CM2 M;  2V3V A;  3HOY I;  3F3P C;  3S15 I;  1WZN A;  1Y1V S;  1M90 2;  1VQP 1;  1VQ8 Z;  3CMA Z;  4NBE A;  1YIJ Z;  1KQS Y;  3VTN A;  2WAQ A;  1S7M A;  3CD6 1;  1K9M 1;  2QA4 Z;  2OOY B;  2VUG A;  1WII A;  3S1M I;  3I07 A;  1USP A;  1WW9 A;  2RT9 A;  2V8K A;  4A3F I;  4NFR A;  1RNI A;  3JAM b;  1YJ9 Z;  4BY1 I;  3NH5 A;  5T67 A;  4A3I I;  1VQ5 Z;  1VQ6 1;  2QKD A; 
#chains in the Genus database with same CATH homology
 1W2B Y;  2JA6 I;  3P5J B;  3EER A;  2W03 A;  3I56 1;  1KC8 1;  3GTL I;  1YIT Z;  2NVY I;  3CC2 Z;  1VLA A;  2F4O A;  3CCR 1;  3CC7 Z;  4HGZ A;  1L1O C;  2NVQ I;  2V8J A;  2HU9 A;  5C4X I;  1N8R 1;  5LL6 f;  3IF8 A;  4Y52 I;  3S17 I;  3J81 f;  2P28 A;  3CCM 1;  3PO3 I;  2DE6 A;  4NBC A;  3H0G I;  4RVH A;  1Q82 2;  5FLX b;  1R9T I;  4TNU A;  1VQ8 1;  4A3E I;  3U50 C;  1VQM 1;  1VQK Z;  3GTQ I;  3RZO I;  3CCU Z;  3GTM S;  2OTL Z;  2Q4Z A;  5AN9 F;  2QA4 1;  1VQN Z;  1X3W A;  3PO2 I;  3I55 1;  2I3C A;  3OW2 Y;  1VQ4 1;  4NH1 C;  3I4M I;  4NBA A;  1VQ5 1;  4QTU A;  3CXC Y;  1K8A 2;  3CCL Z;  1VQP Z;  3S2H I;  1X3Z A;  3K7A I;  1TFI A;  2E9H A;  3Q87 A;  4RVF A;  2W04 A;  4NB9 A;  3CC2 1;  1Q86 1;  4MXU A;  1NP6 A;  5A2Q f;  1P9N A;  1TWC I;  1QVF Y;  1K73 2;  2QRD B;  1K83 I;  2RIQ A;  1VQ6 Z;  1VQ9 1;  3D6W A;  1Q7Y 1;  2E2I I;  1M90 1;  1VQ7 Z;  3S2D I;  2VF1 A;  3I56 Z;  4MRI A;  3CCE 1;  2Q51 A;  5C44 I;  4A3G I;  1ZH1 A;  3CCR Z;  1Y1W I;  1YUA A;  2QLV B;  4A93 I;  2JA8 I;  5C3E I;  3BG0 B;  3CCM Z;  1VQL 1;  5IT9 b;  4Y7N I;  3CCL 1;  2G2K A;  4E2Y A;  1VQM Z;  3G71 1;  2B63 I;  1Y1V I;  3S1Q I;  1RQF A;  1JJ2 Z;  4NBH A;  2YU9 I;  4A3J I;  3S16 I;  2DE7 A;  3I55 Z;  2OOX B;  1KD1 1;  3BG1 B;  3J80 b;  3GCF A;  1QVG Z;  1VQ4 Z;  2NVT I;  4BBR I;  3GTP I;  2E2J I;  1VQ7 1;  3CC4 1;  1SFO I;  4NB8 A;  1N2F A;  2M6N A;  4XX2 A;  3J81 b;  4BY7 I;  3I4N I;  2K5R A;  4DGL A;  2QRE B;  2GTH A;  3NDJ A;  3H3V J;  1VQ9 Z;  3HOZ I;  2O4H A;  4CL1 A;  1K9M 2;  1K8A 1;  5IP9 I;  3TE5 B;  3CCV Z;  3G4S 1;  3CCE Z;  2JNY A;  2RBL A;  4E30 A;  2V8I A;  1X0T A;  1VQL Z;  4A3L I;  3GTM I;  1KC8 2;  1K73 1;  1I6H I;  2GU2 A;  1TWA I;  3GTK I;  3TDH B;  3HOX I;  1Z02 A;  1NJI 1;  4HH4 A;  5A2Q b;  3G71 Z;  3CCS 1;  5D1P A;  4A3K I;  4DQY B;  3HOU I;  2YAD A;  4QTT A;  1M1K 1;  2RHB A;  1YI2 Z;  1Q81 1;  4S1T A;  1PFT A;  3T4N B;  3CME 1;  2F4M A;  3S1R I;  5IP7 I;  2HF1 A;  2M48 A;  3CPW Z;  2KI7 B;  2AKL A;  4RS4 A;  3VMH A;  3MZL B;  4E33 A;  1I3Q I;  2R6M A;  4NBB A;  3CC4 Z;  3CCV 1;  1YUK A;  2OZK A;  3J7A 4;  2EGT A;  3KIF A;  1QYP A;  4HGY A;  1RLY A;  4EWC A;  3GKQ A;  1VQO 1;  3RZD I;  1YJW 1;  3LUS A;  3IX0 A;  2Y0S A;  2QEX 1;  2JA5 I;  4E32 A;  1Q86 2;  1KQS Z;  1I50 I;  3ESW A;  3NFZ A;  3G4S Z;  2VUM I;  4BXX I;  2J6A A;  2IZ4 A;  1YJN 1;  2JUB A;  3VMG A;  2R7Z I;  3FQM A;  3S1N I;  3VB9 A;  1YI2 1;  3HOW I;  1JWH C;  2PM9 A;  3NDI A;  1Q7Y 2;  5D1O A;  4RVG A;  2O53 A;  2QR1 B;  3HOV I;  1KRL A;  1W2B Z;  1QF8 A;  3KIH A;  5IT9 f;  1S72 1;  1Q82 1;  2JMO A;  3CCS Z;  3CCQ Z;  4A3C I;  3EED A;  2RPR A;  1JJ2 Y;  3MZK B;  2BJO A;  3CME Z;  4DK1 A;  2PMZ A;  1QVG Y;  5T64 A;  4E2Z A;  3HKZ A;  5T6B A;  3J80 f;  3M4O I;  2R92 I;  3JAM f;  3PO3 S;  4MD8 A;  4NBD A;  1Z03 A;  1YHQ 1;  1KD1 2;  4MD9 A;  3GTJ I;  4NBG A;  3CCJ Z;  3F3F C;  1TWH I;  2E2H I;  2R93 I;  2PK7 A;  2ZAE B;  3OW2 Z;  4A3B I;  3CQZ I;  3S14 I;  1VQO Z;  1YJW Z;  2JR6 A;  5C4J I;  4A3D I;  3NH8 A;  2GTI A;  3CXC Z;  2QEX Z;  2KPI A;  3FKI I;  1NUI A;  3CMA 1;  2JS4 A;  4X6A I;  1YIJ 1;  1LQL A;  2QRC B;  4MD7 A;  2LIY A;  5FLX f;  2H85 A;  4NBF A;  4AYB A;  4RV9 A;  4MH4 A;  3G6E Z;  3CCQ 1;  1TWG I;  1N8R 2;  2OTJ Z;  1YJN Z;  1ZB9 A;  5D1O B;  4E31 A;  4NOZ A;  1DL6 A;  4E2X A;  1Z01 A;  1QVF Z;  1YJ9 1;  4E2W A;  3IFU A;  4MON A;  4BBS I;  3D9X A;  3MON A;  2IZ3 A;  2DE5 A;  1S72 Z;  1ML8 A;  1YIT 1;  3QWU A;  3GTG I;  1USP B;  3CD6 Z;  3GTO I;  2K3R A;  3CC7 1;  2WB1 A;  3CCJ 1;  3FQQ A;  2P3Y A;  5FLM I;  1TWF I;  3M3Y I;  3VMI A;  1RO2 A;  1NJI 2;  3CPW Y;  4RVD A;  1VQK 1;  2JA7 I;  3NH4 A;  1WCM I;  1ZB8 A;  3CCU 1;  1M1K 2;  1RO0 A;  1Q81 2;  2OTL 1;  3G6E 1;  1YHQ Z;  2OTJ 1;  1VQN 1;  4A3M I;  2LFU A;  1RO4 A;  2NVX I;  5CM2 M;  3HOY I;  3F3P C;  3S15 I;  1Y1V S;  1M90 2;  1VQP 1;  1VQ8 Z;  3CMA Z;  4NBE A;  1YIJ Z;  1KQS Y;  3VTN A;  2WAQ A;  1S7M A;  3CD6 1;  1K9M 1;  2QA4 Z;  2OOY B;  2VUG A;  1WII A;  3S1M I;  3I07 A;  1USP A;  1WW9 A;  2RT9 A;  2V8K A;  4A3F I;  4NFR A;  1RNI A;  3JAM b;  1YJ9 Z;  4BY1 I;  3NH5 A;  5T67 A;  4A3I I;  1VQ5 Z;  1VQ6 1;  2QKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...