1KRLA

Crystal structure of racemic dl-monellin in p-1
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
44
structure length
44
Chain Sequence
REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MONELLIN, CHAIN A
publication title Structural differences in D and L-monellin in the crystals of racemic mixture.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 7
structure length 44
sequence length 44
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.610 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1krlA00
4MONA 3MONA 1KRLA
chains in the Genus database with same CATH superfamily
1NJI2 1KRLA 1RO2A 3S16I 1WW9A 3S17I 3S1QI 3NDJA 3CXCZ 4QTUA 2VPWA 1TWAI 3QWUA 2RT9A 1Z02A 2M6NA 3CCE1 3RZOI 1USPA 1M902 3G4S1 3I55Z 1N2FA 2RBLA 1Z01A 3CCS1 3HOZI 2VPXA 1W2BZ 2DE6A 3GCFA 3HOYI 2F4OA 1QXFA 1VQP1 5CM2M 5C44I 1N8R1 3NH8A 2LFUA 1VQ7Z 3G6E1 2JIOA 3G71Z 2H85A 2O53A 3F3PC 3H0GI 3GTQI 3K7AI 4DK1A 2E2HI 3J80f 3I07A 4A3KI 3GTJI 2QEXZ 1YIT1 2I3CA 3S15I 1YI2Z 2OZKA 5IP7I 2R93I 3CPWY 4NH1C 3FQQA 4BY7I 3NDIA 3VTNA 1VLAA 1K731 1YJNZ 1YIJZ 4NB8A 1VQ4Z 4X6AI 2EGTA 3D2LA 4E32A 1ZH1A 1YUAA 4RVGA 1Q811 1NUIA 2W03A 4MD9A 1KC81 5C3EI 1Q862 1K9M1 3CXCY 2E2JI 4MRIA 3CMEZ 3GTPI 1K8A1 3NH4A 3ESWA 5FLXb 1Y1VS 1YJWZ 4HGZA 3CQZI 3I551 1QVGY 3JAMb 3HOVI 3J81b 2JA5I 3M3YI 1W2BY 3S2DI 1YHQZ 2K5RA 4RVDA 2JIQA 3CPWZ 2P28A 4RS4A 1RQFA 3LUSA 1Z03A 5D1OA 3I4NI 1VQ9Z 3CCLZ 3RZDI 3BG0B 3T4NB 2QA4Z 3G711 1I6HI 2P3YA 2V8IA 2WB1A 5IT9b 3EEDA 1VQ61 2M48A 1YJ9Z 1S72Z 2OTJ1 2QEX1 1I50I 1Q7Y1 1KD11 4DGLA 3PO3S 4MONA 1Y1VI 3EERA 2JA8I 1QVGZ 2JA6I 5C4XI 2RPRA 2F4MA 1NJI1 5A2Qb 1WCMI 4EWCA 1YIJ1 2JMOA 1VQ41 2GU2A 4BBSI 3S1RI 1TWFI 2OOXB 4A3II 4HGYA 1L1OC 5IP9I 3IR7A 4BBRI 1VQN1 4NBDA 3MZLB 1M901 1X3ZA 2IV2X 2HF1A 3CCM1 3HKZA 3CCRZ 4A3JI 4MD7A 1VQOZ 3HOXI 3NFZA 3CME1 3CCQZ 1YJW1 3S1NI 1VQ51 3P5JB 3S2HI 4E30A 3CMA1 4RV9A 3PO3I 2GTHA 1Q822 2VPZA 5FLXf 3GKQA 3GTMS 2WAQA 2VF1A 4DQYB 2Q51A 4TNUA 3CCL1 2JS4A 3JAMf 4A3MI 3J81f 2NAPA 2KI7B 2QA41 1VQ81 3I56Z 3G4SZ 3D6WA 2QREB 1QVFZ 1SFOI 2GTIA 2IZ4A 1M1K2 4A93I 5AN9F 3CC7Z 5T67A 2VUMI 1VQPZ 2DE5A 3D9XA 4MH4A 1S721 1DL6A 2PMZA 2E9HA 4BXXI 4AYBA 1FDIA 5T64A 3FQMA 3CCUZ 4E31A 1TWCI 2J6AA 3M4OI 4E2WA 2ZAEB 2RHBA 5IT9f 3S1MI 2IZ3A 1P9NA 1X0TA 3Q87A 3CD6Z 1R9TI 2BJOA 4NOZA 1M1K1 1Q861 2VUGA 5T6BA 3KIHA 1RLYA 4MD8A 1VQ71 1AA6A 4NBEA 2JIPA 2HU9A 5A2Qf 1VQKZ 3CCR1 3IF8A 1VQO1 4S1TA 2VPYA 3CC4Z 3I4MI 2R92I 3GTOI 2O4HA 2OTLZ 4NBHA 5C4JI 3J7A4 3PO2I 3CCQ1 1QF8A 1JJ2Z 4E2YA 1K83I 1ML8A 4NFRA 3VMHA 2V3VA 4A3BI 3GTLI 1YI21 4A3LI 1ZB8A 2E7ZA 3VMIA 2PK7A 1USPB 3BG1B 1VQLZ 1YJN1 3FKII 1N8R2 3GTKI 3CCVZ 2PM9A 3CCJZ 1I3QI 3CC2Z 2NVTI 1VQMZ 3MONA 2JNYA 3I561 3IX0A 3H3VJ 2R6MA 4MXUA 3MZKB 1QVFY 5D1PA 2Y0SA 2LIYA 3CC71 2AYDA 2JIMA 3IFUA 1WJ2A 1TFIA 4RVFA 3VMGA 2QRDB 2OOYB 5FLMI 1PFTA 1WZNA 2E2II 2V8KA 2R7ZI 1LQLA 5LL6f 4NBCA 3CCU1 3OW2Z 2B63I 1KQSZ 3HOUI 1YHQ1 2NVQI 4XX2A 1K732 3CD61 1VQ6Z 1QYPA 3NH5A 1Q812 2OTJZ 3VB9A 1VQ91 2QR1B 3S14I 1KC82 4A3EI 3CCEZ 1WIIA 4E2XA 2JUBA 1SIWA 2YADA 3CCSZ 1K9M2 3F3FC 4A3CI 1VQK1 4NBAA 1K8A2 4RVHA 2NVYI 3CC41 2OTL1 1JJ2Y 1RO0A 1Y8CA 2QRCB 1YJ91 2JR6A 1NP6A 3J80b 4A3FI 1Q821 2NVXI 1Y1WI 4Y52I 4NBGA 3G6EZ 1VQNZ 3KIFA 1TWGI 4QTTA 1S7MA 3CCMZ 1FDOA 2W04A 3TE5B 2V8JA 1VQL1 1RO4A 4A3GI 2LEXA 3CCV1 2DE7A 4A3DI 3CCJ1 1TWHI 3CC21 1VQM1 1YITZ 2JA7I 1VQ5Z 2RIQA 3TDHB 2K3RA 4BY1I 3GTMI 1YUKA 1X3WA 3U50C 2G2KA 2Q4ZA 3GTGI 3CMAZ 1Q16A 1JWHC 4HH4A 5D1OB 2QKDA 3HOWI 2QLVB 2YU9I 1ZB9A 4NBFA 4Y7NI 1Q7Y2 4NB9A 1KD12 4NBBA 2AKLA 3OW2Y 4E2ZA 2V45A 4E33A 4CL1A 1KQSY 2JIRA 1VQ8Z 1RNIA 2KPIA
chains in the Genus database with same CATH topology
1NJI2 1KRLA 1RO2A 3S16I 1WW9A 3S17I 3S1QI 3NDJA 3CXCZ 4QTUA 1TWAI 3QWUA 2RT9A 1Z02A 2M6NA 3CCE1 3RZOI 1USPA 1M902 3G4S1 3I55Z 1N2FA 2RBLA 1Z01A 3CCS1 3HOZI 1W2BZ 2DE6A 3GCFA 3HOYI 2F4OA 1VQP1 5CM2M 5C44I 1N8R1 3NH8A 2LFUA 1VQ7Z 3G6E1 3G71Z 2H85A 2O53A 3F3PC 3H0GI 3GTQI 3K7AI 4DK1A 2E2HI 3J80f 3I07A 4A3KI 3GTJI 2QEXZ 1YIT1 2I3CA 3S15I 1YI2Z 2OZKA 5IP7I 2R93I 3CPWY 4NH1C 3FQQA 4BY7I 3NDIA 3VTNA 1VLAA 1K731 1YJNZ 1YIJZ 4NB8A 1VQ4Z 4X6AI 2EGTA 4E32A 1ZH1A 1YUAA 4RVGA 1Q811 1NUIA 2W03A 4MD9A 1KC81 5C3EI 1Q862 1K9M1 3CXCY 2E2JI 4MRIA 3CMEZ 3GTPI 1K8A1 3NH4A 3ESWA 5FLXb 1Y1VS 1YJWZ 4HGZA 3CQZI 3I551 1QVGY 3JAMb 3HOVI 3J81b 2JA5I 3M3YI 1W2BY 3S2DI 1YHQZ 2K5RA 4RVDA 3CPWZ 2P28A 4RS4A 1RQFA 3LUSA 1Z03A 5D1OA 3I4NI 1VQ9Z 3CCLZ 3RZDI 3BG0B 3T4NB 2QA4Z 3G711 1I6HI 2P3YA 2V8IA 2WB1A 5IT9b 3EEDA 1VQ61 2M48A 1YJ9Z 1S72Z 2OTJ1 2QEX1 1I50I 1Q7Y1 1KD11 4DGLA 3PO3S 4MONA 1Y1VI 3EERA 2JA8I 1QVGZ 2JA6I 5C4XI 2RPRA 2F4MA 1NJI1 5A2Qb 1WCMI 4EWCA 1YIJ1 2JMOA 1VQ41 2GU2A 4BBSI 3S1RI 1TWFI 2OOXB 4A3II 4HGYA 1L1OC 5IP9I 4BBRI 1VQN1 4NBDA 3MZLB 1M901 1X3ZA 2HF1A 3CCM1 3HKZA 3CCRZ 4A3JI 4MD7A 1VQOZ 3HOXI 3NFZA 3CME1 3CCQZ 1YJW1 3S1NI 1VQ51 3P5JB 3S2HI 4E30A 3CMA1 4RV9A 3PO3I 2GTHA 1Q822 5FLXf 3GKQA 3GTMS 2WAQA 2VF1A 4DQYB 2Q51A 4TNUA 3CCL1 2JS4A 3JAMf 4A3MI 3J81f 2KI7B 2QA41 1VQ81 3I56Z 3G4SZ 3D6WA 2QREB 1QVFZ 1SFOI 2GTIA 2IZ4A 1M1K2 4A93I 5AN9F 3CC7Z 5T67A 2VUMI 1VQPZ 2DE5A 3D9XA 4MH4A 1S721 1DL6A 2PMZA 2E9HA 4BXXI 4AYBA 5T64A 3FQMA 3CCUZ 4E31A 1TWCI 2J6AA 3M4OI 4E2WA 2ZAEB 2RHBA 5IT9f 3S1MI 2IZ3A 1P9NA 1X0TA 3Q87A 3CD6Z 1R9TI 2BJOA 4NOZA 1M1K1 1Q861 2VUGA 5T6BA 3KIHA 1RLYA 4MD8A 1VQ71 4NBEA 2HU9A 5A2Qf 1VQKZ 3CCR1 3IF8A 1VQO1 4S1TA 3CC4Z 3I4MI 2R92I 3GTOI 2O4HA 2OTLZ 4NBHA 5C4JI 3J7A4 3PO2I 1QF8A 3CCQ1 1JJ2Z 4E2YA 1K83I 1ML8A 4NFRA 3VMHA 4A3BI 3GTLI 1YI21 4A3LI 1ZB8A 3VMIA 2PK7A 1USPB 3BG1B 1VQLZ 1YJN1 3FKII 1N8R2 3GTKI 3CCVZ 2PM9A 3CCJZ 1I3QI 3CC2Z 2NVTI 1VQMZ 3MONA 2JNYA 3I561 3IX0A 3H3VJ 2R6MA 4MXUA 3MZKB 1QVFY 5D1PA 2Y0SA 2LIYA 3CC71 3IFUA 1TFIA 4RVFA 3VMGA 2QRDB 2OOYB 5FLMI 1PFTA 2E2II 2V8KA 2R7ZI 1LQLA 5LL6f 4NBCA 3CCU1 3OW2Z 2B63I 1KQSZ 3HOUI 1YHQ1 2NVQI 4XX2A 1K732 3CD61 1VQ6Z 1QYPA 3NH5A 1Q812 2OTJZ 3VB9A 1VQ91 2QR1B 3S14I 1KC82 4A3EI 3CCEZ 1WIIA 4E2XA 2JUBA 2YADA 3CCSZ 1K9M2 3F3FC 4A3CI 1VQK1 4NBAA 1K8A2 4RVHA 2NVYI 3CC41 2OTL1 1JJ2Y 1RO0A 2QRCB 1YJ91 2JR6A 1NP6A 3J80b 4A3FI 1Q821 2NVXI 1Y1WI 4Y52I 4NBGA 3G6EZ 1VQNZ 3KIFA 1TWGI 4QTTA 1S7MA 3CCMZ 2W04A 3TE5B 2V8JA 1VQL1 1RO4A 4A3GI 3CCV1 2DE7A 4A3DI 3CCJ1 1TWHI 3CC21 1VQM1 1YITZ 2JA7I 1VQ5Z 2RIQA 3TDHB 2K3RA 4BY1I 3GTMI 1YUKA 1X3WA 3U50C 2G2KA 2Q4ZA 3GTGI 3CMAZ 1JWHC 4HH4A 5D1OB 2QKDA 3HOWI 2QLVB 2YU9I 1ZB9A 4NBFA 4Y7NI 1Q7Y2 4NB9A 1KD12 4NBBA 2AKLA 3OW2Y 4E2ZA 4E33A 4CL1A 1KQSY 1VQ8Z 1RNIA 2KPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MON A;  3MON A;  1KRL A; 
#chains in the Genus database with same CATH topology
 1NJI 2;  1KRL A;  1RO2 A;  3S16 I;  1WW9 A;  3S17 I;  3S1Q I;  3NDJ A;  3CXC Z;  4QTU A;  2VPW A;  1TWA I;  3QWU A;  2RT9 A;  1Z02 A;  2M6N A;  3CCE 1;  3RZO I;  1USP A;  1M90 2;  3G4S 1;  3I55 Z;  1N2F A;  2RBL A;  1Z01 A;  3CCS 1;  3HOZ I;  2VPX A;  1W2B Z;  2DE6 A;  3GCF A;  3HOY I;  2F4O A;  1QXF A;  1VQP 1;  5CM2 M;  5C44 I;  1N8R 1;  3NH8 A;  2LFU A;  1VQ7 Z;  3G6E 1;  2JIO A;  3G71 Z;  2H85 A;  2O53 A;  3F3P C;  3H0G I;  3GTQ I;  3K7A I;  4DK1 A;  2E2H I;  3J80 f;  3I07 A;  4A3K I;  3GTJ I;  2QEX Z;  1YIT 1;  2I3C A;  3S15 I;  1YI2 Z;  2OZK A;  5IP7 I;  2R93 I;  3CPW Y;  4NH1 C;  3FQQ A;  4BY7 I;  3NDI A;  3VTN A;  1VLA A;  1K73 1;  1YJN Z;  1YIJ Z;  4NB8 A;  1VQ4 Z;  4X6A I;  2EGT A;  3D2L A;  4E32 A;  1ZH1 A;  1YUA A;  4RVG A;  1Q81 1;  1NUI A;  2W03 A;  4MD9 A;  1KC8 1;  5C3E I;  1Q86 2;  1K9M 1;  3CXC Y;  2E2J I;  4MRI A;  3CME Z;  3GTP I;  1K8A 1;  3NH4 A;  3ESW A;  5FLX b;  1Y1V S;  1YJW Z;  4HGZ A;  3CQZ I;  3I55 1;  1QVG Y;  3JAM b;  3HOV I;  3J81 b;  2JA5 I;  3M3Y I;  1W2B Y;  3S2D I;  1YHQ Z;  2K5R A;  4RVD A;  2JIQ A;  3CPW Z;  2P28 A;  4RS4 A;  1RQF A;  3LUS A;  1Z03 A;  5D1O A;  3I4N I;  1VQ9 Z;  3CCL Z;  3RZD I;  3BG0 B;  3T4N B;  2QA4 Z;  3G71 1;  1I6H I;  2P3Y A;  2V8I A;  2WB1 A;  5IT9 b;  3EED A;  1VQ6 1;  2M48 A;  1YJ9 Z;  1S72 Z;  2OTJ 1;  2QEX 1;  1I50 I;  1Q7Y 1;  1KD1 1;  4DGL A;  3PO3 S;  4MON A;  1Y1V I;  3EER A;  2JA8 I;  1QVG Z;  2JA6 I;  5C4X I;  2RPR A;  2F4M A;  1NJI 1;  5A2Q b;  1WCM I;  4EWC A;  1YIJ 1;  2JMO A;  1VQ4 1;  2GU2 A;  4BBS I;  3S1R I;  1TWF I;  2OOX B;  4A3I I;  4HGY A;  1L1O C;  5IP9 I;  3IR7 A;  4BBR I;  1VQN 1;  4NBD A;  3MZL B;  1M90 1;  1X3Z A;  2IV2 X;  2HF1 A;  3CCM 1;  3HKZ A;  3CCR Z;  4A3J I;  4MD7 A;  1VQO Z;  3HOX I;  3NFZ A;  3CME 1;  3CCQ Z;  1YJW 1;  3S1N I;  1VQ5 1;  3P5J B;  3S2H I;  4E30 A;  3CMA 1;  4RV9 A;  3PO3 I;  2GTH A;  1Q82 2;  2VPZ A;  5FLX f;  3GKQ A;  3GTM S;  2WAQ A;  2VF1 A;  4DQY B;  2Q51 A;  4TNU A;  3CCL 1;  2JS4 A;  3JAM f;  4A3M I;  3J81 f;  2NAP A;  2KI7 B;  2QA4 1;  1VQ8 1;  3I56 Z;  3G4S Z;  3D6W A;  2QRE B;  1QVF Z;  1SFO I;  2GTI A;  2IZ4 A;  1M1K 2;  4A93 I;  5AN9 F;  3CC7 Z;  5T67 A;  2VUM I;  1VQP Z;  2DE5 A;  3D9X A;  4MH4 A;  1S72 1;  1DL6 A;  2PMZ A;  2E9H A;  4BXX I;  4AYB A;  1FDI A;  5T64 A;  3FQM A;  3CCU Z;  4E31 A;  1TWC I;  2J6A A;  3M4O I;  4E2W A;  2ZAE B;  2RHB A;  5IT9 f;  3S1M I;  2IZ3 A;  1P9N A;  1X0T A;  3Q87 A;  3CD6 Z;  1R9T I;  2BJO A;  4NOZ A;  1M1K 1;  1Q86 1;  2VUG A;  5T6B A;  3KIH A;  1RLY A;  4MD8 A;  1VQ7 1;  1AA6 A;  4NBE A;  2JIP A;  2HU9 A;  5A2Q f;  1VQK Z;  3CCR 1;  3IF8 A;  1VQO 1;  4S1T A;  2VPY A;  3CC4 Z;  3I4M I;  2R92 I;  3GTO I;  2O4H A;  2OTL Z;  4NBH A;  5C4J I;  3J7A 4;  3PO2 I;  3CCQ 1;  1QF8 A;  1JJ2 Z;  4E2Y A;  1K83 I;  1ML8 A;  4NFR A;  3VMH A;  2V3V A;  4A3B I;  3GTL I;  1YI2 1;  4A3L I;  1ZB8 A;  2E7Z A;  3VMI A;  2PK7 A;  1USP B;  3BG1 B;  1VQL Z;  1YJN 1;  3FKI I;  1N8R 2;  3GTK I;  3CCV Z;  2PM9 A;  3CCJ Z;  1I3Q I;  3CC2 Z;  2NVT I;  1VQM Z;  3MON A;  2JNY A;  3I56 1;  3IX0 A;  3H3V J;  2R6M A;  4MXU A;  3MZK B;  1QVF Y;  5D1P A;  2Y0S A;  2LIY A;  3CC7 1;  2AYD A;  2JIM A;  3IFU A;  1WJ2 A;  1TFI A;  4RVF A;  3VMG A;  2QRD B;  2OOY B;  5FLM I;  1PFT A;  1WZN A;  2E2I I;  2V8K A;  2R7Z I;  1LQL A;  5LL6 f;  4NBC A;  3CCU 1;  3OW2 Z;  2B63 I;  1KQS Z;  3HOU I;  1YHQ 1;  2NVQ I;  4XX2 A;  1K73 2;  3CD6 1;  1VQ6 Z;  1QYP A;  3NH5 A;  1Q81 2;  2OTJ Z;  3VB9 A;  1VQ9 1;  2QR1 B;  3S14 I;  1KC8 2;  4A3E I;  3CCE Z;  1WII A;  4E2X A;  2JUB A;  1SIW A;  2YAD A;  3CCS Z;  1K9M 2;  3F3F C;  4A3C I;  1VQK 1;  4NBA A;  1K8A 2;  4RVH A;  2NVY I;  3CC4 1;  2OTL 1;  1JJ2 Y;  1RO0 A;  1Y8C A;  2QRC B;  1YJ9 1;  2JR6 A;  1NP6 A;  3J80 b;  4A3F I;  1Q82 1;  2NVX I;  1Y1W I;  4Y52 I;  4NBG A;  3G6E Z;  1VQN Z;  3KIF A;  1TWG I;  4QTT A;  1S7M A;  3CCM Z;  1FDO A;  2W04 A;  3TE5 B;  2V8J A;  1VQL 1;  1RO4 A;  4A3G I;  2LEX A;  3CCV 1;  2DE7 A;  4A3D I;  3CCJ 1;  1TWH I;  3CC2 1;  1VQM 1;  1YIT Z;  2JA7 I;  1VQ5 Z;  2RIQ A;  3TDH B;  2K3R A;  4BY1 I;  3GTM I;  1YUK A;  1X3W A;  3U50 C;  2G2K A;  2Q4Z A;  3GTG I;  3CMA Z;  1Q16 A;  1JWH C;  4HH4 A;  5D1O B;  2QKD A;  3HOW I;  2QLV B;  2YU9 I;  1ZB9 A;  4NBF A;  4Y7N I;  1Q7Y 2;  4NB9 A;  1KD1 2;  4NBB A;  2AKL A;  3OW2 Y;  4E2Z A;  2V45 A;  4E33 A;  4CL1 A;  1KQS Y;  2JIR A;  1VQ8 Z;  1RNI A;  2KPI A; 
#chains in the Genus database with same CATH homology
 1NJI 2;  1KRL A;  1RO2 A;  3S16 I;  1WW9 A;  3S17 I;  3S1Q I;  3NDJ A;  3CXC Z;  4QTU A;  1TWA I;  3QWU A;  2RT9 A;  1Z02 A;  2M6N A;  3CCE 1;  3RZO I;  1USP A;  1M90 2;  3G4S 1;  3I55 Z;  1N2F A;  2RBL A;  1Z01 A;  3CCS 1;  3HOZ I;  1W2B Z;  2DE6 A;  3GCF A;  3HOY I;  2F4O A;  1VQP 1;  5CM2 M;  5C44 I;  1N8R 1;  3NH8 A;  2LFU A;  1VQ7 Z;  3G6E 1;  3G71 Z;  2H85 A;  2O53 A;  3F3P C;  3H0G I;  3GTQ I;  3K7A I;  4DK1 A;  2E2H I;  3J80 f;  3I07 A;  4A3K I;  3GTJ I;  2QEX Z;  1YIT 1;  2I3C A;  3S15 I;  1YI2 Z;  2OZK A;  5IP7 I;  2R93 I;  3CPW Y;  4NH1 C;  3FQQ A;  4BY7 I;  3NDI A;  3VTN A;  1VLA A;  1K73 1;  1YJN Z;  1YIJ Z;  4NB8 A;  1VQ4 Z;  4X6A I;  2EGT A;  4E32 A;  1ZH1 A;  1YUA A;  4RVG A;  1Q81 1;  1NUI A;  2W03 A;  4MD9 A;  1KC8 1;  5C3E I;  1Q86 2;  1K9M 1;  3CXC Y;  2E2J I;  4MRI A;  3CME Z;  3GTP I;  1K8A 1;  3NH4 A;  3ESW A;  5FLX b;  1Y1V S;  1YJW Z;  4HGZ A;  3CQZ I;  3I55 1;  1QVG Y;  3JAM b;  3HOV I;  3J81 b;  2JA5 I;  3M3Y I;  1W2B Y;  3S2D I;  1YHQ Z;  2K5R A;  4RVD A;  3CPW Z;  2P28 A;  4RS4 A;  1RQF A;  3LUS A;  1Z03 A;  5D1O A;  3I4N I;  1VQ9 Z;  3CCL Z;  3RZD I;  3BG0 B;  3T4N B;  2QA4 Z;  3G71 1;  1I6H I;  2P3Y A;  2V8I A;  2WB1 A;  5IT9 b;  3EED A;  1VQ6 1;  2M48 A;  1YJ9 Z;  1S72 Z;  2OTJ 1;  2QEX 1;  1I50 I;  1Q7Y 1;  1KD1 1;  4DGL A;  3PO3 S;  4MON A;  1Y1V I;  3EER A;  2JA8 I;  1QVG Z;  2JA6 I;  5C4X I;  2RPR A;  2F4M A;  1NJI 1;  5A2Q b;  1WCM I;  4EWC A;  1YIJ 1;  2JMO A;  1VQ4 1;  2GU2 A;  4BBS I;  3S1R I;  1TWF I;  2OOX B;  4A3I I;  4HGY A;  1L1O C;  5IP9 I;  4BBR I;  1VQN 1;  4NBD A;  3MZL B;  1M90 1;  1X3Z A;  2HF1 A;  3CCM 1;  3HKZ A;  3CCR Z;  4A3J I;  4MD7 A;  1VQO Z;  3HOX I;  3NFZ A;  3CME 1;  3CCQ Z;  1YJW 1;  3S1N I;  1VQ5 1;  3P5J B;  3S2H I;  4E30 A;  3CMA 1;  4RV9 A;  3PO3 I;  2GTH A;  1Q82 2;  5FLX f;  3GKQ A;  3GTM S;  2WAQ A;  2VF1 A;  4DQY B;  2Q51 A;  4TNU A;  3CCL 1;  2JS4 A;  3JAM f;  4A3M I;  3J81 f;  2KI7 B;  2QA4 1;  1VQ8 1;  3I56 Z;  3G4S Z;  3D6W A;  2QRE B;  1QVF Z;  1SFO I;  2GTI A;  2IZ4 A;  1M1K 2;  4A93 I;  5AN9 F;  3CC7 Z;  5T67 A;  2VUM I;  1VQP Z;  2DE5 A;  3D9X A;  4MH4 A;  1S72 1;  1DL6 A;  2PMZ A;  2E9H A;  4BXX I;  4AYB A;  5T64 A;  3FQM A;  3CCU Z;  4E31 A;  1TWC I;  2J6A A;  3M4O I;  4E2W A;  2ZAE B;  2RHB A;  5IT9 f;  3S1M I;  2IZ3 A;  1P9N A;  1X0T A;  3Q87 A;  3CD6 Z;  1R9T I;  2BJO A;  4NOZ A;  1M1K 1;  1Q86 1;  2VUG A;  5T6B A;  3KIH A;  1RLY A;  4MD8 A;  1VQ7 1;  4NBE A;  2HU9 A;  5A2Q f;  1VQK Z;  3CCR 1;  3IF8 A;  1VQO 1;  4S1T A;  3CC4 Z;  3I4M I;  2R92 I;  3GTO I;  2O4H A;  2OTL Z;  4NBH A;  5C4J I;  3J7A 4;  3PO2 I;  1QF8 A;  3CCQ 1;  1JJ2 Z;  4E2Y A;  1K83 I;  1ML8 A;  4NFR A;  3VMH A;  4A3B I;  3GTL I;  1YI2 1;  4A3L I;  1ZB8 A;  3VMI A;  2PK7 A;  1USP B;  3BG1 B;  1VQL Z;  1YJN 1;  3FKI I;  1N8R 2;  3GTK I;  3CCV Z;  2PM9 A;  3CCJ Z;  1I3Q I;  3CC2 Z;  2NVT I;  1VQM Z;  3MON A;  2JNY A;  3I56 1;  3IX0 A;  3H3V J;  2R6M A;  4MXU A;  3MZK B;  1QVF Y;  5D1P A;  2Y0S A;  2LIY A;  3CC7 1;  3IFU A;  1TFI A;  4RVF A;  3VMG A;  2QRD B;  2OOY B;  5FLM I;  1PFT A;  2E2I I;  2V8K A;  2R7Z I;  1LQL A;  5LL6 f;  4NBC A;  3CCU 1;  3OW2 Z;  2B63 I;  1KQS Z;  3HOU I;  1YHQ 1;  2NVQ I;  4XX2 A;  1K73 2;  3CD6 1;  1VQ6 Z;  1QYP A;  3NH5 A;  1Q81 2;  2OTJ Z;  3VB9 A;  1VQ9 1;  2QR1 B;  3S14 I;  1KC8 2;  4A3E I;  3CCE Z;  1WII A;  4E2X A;  2JUB A;  2YAD A;  3CCS Z;  1K9M 2;  3F3F C;  4A3C I;  1VQK 1;  4NBA A;  1K8A 2;  4RVH A;  2NVY I;  3CC4 1;  2OTL 1;  1JJ2 Y;  1RO0 A;  2QRC B;  1YJ9 1;  2JR6 A;  1NP6 A;  3J80 b;  4A3F I;  1Q82 1;  2NVX I;  1Y1W I;  4Y52 I;  4NBG A;  3G6E Z;  1VQN Z;  3KIF A;  1TWG I;  4QTT A;  1S7M A;  3CCM Z;  2W04 A;  3TE5 B;  2V8J A;  1VQL 1;  1RO4 A;  4A3G I;  3CCV 1;  2DE7 A;  4A3D I;  3CCJ 1;  1TWH I;  3CC2 1;  1VQM 1;  1YIT Z;  2JA7 I;  1VQ5 Z;  2RIQ A;  3TDH B;  2K3R A;  4BY1 I;  3GTM I;  1YUK A;  1X3W A;  3U50 C;  2G2K A;  2Q4Z A;  3GTG I;  3CMA Z;  1JWH C;  4HH4 A;  5D1O B;  2QKD A;  3HOW I;  2QLV B;  2YU9 I;  1ZB9 A;  4NBF A;  4Y7N I;  1Q7Y 2;  4NB9 A;  1KD1 2;  4NBB A;  2AKL A;  3OW2 Y;  4E2Z A;  4E33 A;  4CL1 A;  1KQS Y;  1VQ8 Z;  1RNI A;  2KPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...