4S1TA

Crystal structure of the mutant i26a/n52a of the endoribonuclease from human coronavirus 229e
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
347
structure length
342
Chain Sequence
b'SGLENIAFNVVNKGSFVGADGELPVAASGDKVFVRDGNTDNLVFVNKTSLPTAIAFELFAKRKVGLTPPLSILKNLGVVATYKFVLWDYEAERPLTSFTKSVCGYTDFAEDVCTCYDNSIQGSYERFTLSTNAVLFSATAVKTGGKSLPAIKLNFGMLNGNAIATVNIKNINWFVYVRKDGKPVDHYDGFYTQGRNLQDFLPRSTMEEDFLNMDIGVFIQKYGLEDFNFEHVVYGDVSKTTLGGLHLLISQVRLSKMGILKAEEFVAASDITLKCCTVTYLNDPSSKTVCTYMDLLLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFYPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate-specific endoribonuclease
publication title Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229E
rcsb
source organism Human coronavirus 229e
molecule tags Hydrolase
total genus 86
structure length 342
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4s1tA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s1tA02
2RHBA 2GTIA 2OZKA 4RS4A 2H85A 2GTHA 4S1TA
chains in the Genus database with same CATH superfamily
3KB8A 5CM9C 1TZ2A 1YK1A 1PL6A 3K05A 1T15A 4ZU3A 3I9V1 3VR6A 4NEHB 1KJWA 1JDNA 3A10A 3E4DA 3PSAA 4O6VA 1I6HI 4IIXA 2VTBA 2IBSA 1UKBA 3Q7IA 1PSZA 3M1YA 1G3UA 2NP6A 1I4TD 2VHTA 4GHWA 3NDIA 4B8ZA 1E5XA 2JW5A 2NWQA 5CJPA 2QRCB 3NBYC 4TKUA 4IDDA 2HLNA 4UUNA 5JASA 1V37A 3A1UA 1RVV1 4WASA 5K8CA 3QNWA 1PK7A 4EWLA 3R7DA 5AJHA 4Q4DA 2OGTA 3FNBA 3KRTA 2Z2XA 1YMVA 3MINA 4BFXA 2H52A 3HADA 3RVOA 2RB4A 1L4FA 1P8AA 3DYBA 1JWHC 5F7OA 3B1WA 4C0JA 1JJBA 1JB1A 1OE0A 3AGPA 3WL4A 3ICQB 1T5LA 1C7IA 4HGNA 4GQIA 5A04A 4Y1EA 4AKGA 4EA7A 2JAHA 4ARZA 3K5WA 2AJ8A 2D4HA 1Q812 2RE8A 2I1VB 4ER7A 3T0IA 4ZVLA 2IYTA 1N2GA 2XNCA 2SNIE 4K9DA 4U0KA 1LX7A 2FEPA 3PSHA 1ZCFA 5HE8A 1OZGA 4Z1MA 3O7WA 3IF8A 3FGPA 4NNPA 2NVQI 4IIFA 5A3SA 3SQOA 1WBDA 2HCFA 3ZNNA 2RKWA 3NBZC 3BIFA 4GYJA 3LPMA 2NU9A 3I09A 4X0EA 3OQBA 3PUIA 3ZUGA 3CMEZ 3EFHA 5G1NA 3RWBA 2QN6A 1SURA 4OQZA 1GUAA 1ZEJA 1W88A 1WF6A 1DBRA 2OWEA 3HC7A 3L5KA 1T34A 1Z4LA 2DTEA 1CRQA 1F3LA 1TO2E 3IOBA 4QYMA 1Z0DA 3AF5A 4WLFA 5LP6F 3AERA 3JRXA 4G1MB 4PGGA 1QVVA 1T36A 2WV9A 4TYWA 3FUUA 5KOHB 1ZL0A 2ZJ5A 1K6JA 1UFVA 1X1EA 3MMXA 5C80A 5KTNA 1AV7A 2J9GA 4CG0A 4CLOB 4PGAA 5LZ2A 1JWLA 5C32A 1YS7A 1S72Z 3FCYA 4J0EA 4HN4B 4NV0A 1OHHA 2SKEA 3ENZA 3K09A 4BY7I 1CUYA 4JASB 4BS9A 1Z06A 1QQAA 3QFFA 5F51A 3LT0A 3V1YA 5FNVA 2AZ4A 4ZYLA 2GYYA 5FJIA 4MGEA 2NM0A 4B3CA 1KEVA 3RGGA 5B36A 3TW4A 4GICA 3I5AA 1TCAA 1Z5OA 6GPBA 5EJIA 2CLMB 3THWA 3VR5H 2XF2A 5B3AA 1CZHA 4D9JA 1WPRA 1GA4A 1WG8A 4KC0A 4EKGA 4RVCA 1JHQA 2HRRA 2HH9A 3O8OB 1JJFA 4E46A 4EI2A 3E81A 3B85A 3K32A 1SR8A 4REMA 5E6UA 3PDIB 5C8DA 1VG9B 2C5FA 2NSJA 3FROA 2O3TA 5NLLA 1Z0IA 3W06A 1HOTA 4HJXA 3G2MA 3VDXA 5IEBA 3VDNB 5A9TA 4ZOQI 5BN1A 4IS2A 3RSLA 1F8XA 5IYZB 3S2YA 4R9SA 5EZQA 4CJXA 1MW8X 4M89A 5HKLA 1UBLS 2P8JA 3CFYA 2C9OA 5DYNA 2BGJA 1KARA 1OI7A 2HF2A 2FRXA 4OHFA 1YQXA 4FFBA 1P0MA 4ZVRA 4G0OA 2VBCA 3R7NA 2VA8A 5FBQB 3AV0B 3MWDA 3PXBA 1T6YA 5DF1A 2FFJA 2ZIUB 2BUCA 3I9MA 3JAKA 3CRZA 4HR7A 3ZV5A 4POOA 2BM8A 4MMZB 2ZB8A 3BMOA 4NCHA 1PJTA 2C9ZA 5CGQB 3RFUA 1XV5A 3RZDI 3ICEA 1G8GA 1P74A 5FR2A 1G8FA 1U4OA 5ALPA 1XVAA 4B45A 4KREA 1C4XA 2BGRA 1MFPA 1S9DA 4QPPA 4FEYA 2VP4A 4RZUA 3WGQA 2DUJA 1YIJZ 1VL0A 4KQ6A 4MNTA 5BT8A 1BVHA 5KZMB 1SHKA 3U0VA 4EPRA 2HA6A 1X80B 3DAFA 3NRCA 4FUQA 3K0HA 3PD0A 2VHJA 3DTVD 1LI5A 3I5MA 2I6QA 1FYXA 1P9LA 2FPIB 3IHKA 3N2ZB 3N5KA 4N8DA 3R6DA 1RKXA 4HD8A 4RGQA 4TKVA 1KVUA 5L7TA 2DBVO 2WUVA 1A96A 4G0VA 3F0TA 2QV0A 2Q7XA 3ZWOA 5E38A 4DLNA 4GQBA 2IFTA 3EGDA 4NK5A 4R6WA 2D3TA 2NO9A 3DB2A 4OFZA 3FB1A 1NE2A 1XI2A 4R0VA 2FSVC 2A7QA 4C0BA 2KLHA 3ANLA 4ZO7A 3M49A 4JLKA 4H1WA 1AURA 3AUTA 4CUZA 3VU9B 5JTUA 3K9FC 4N47A 5HOEA 3FWHA 4J6EA 2K4MA 3GG9A 3KKKA 5CK5A 1GV0A 4LC9A 4IJWA 2XUIA 1HYHA 1TMGE 3P32A 4ZTZB 4BO3A 4XQ9A 1JJ2Z 4UM9B 1DFHA 1W4RA 2P0AA 5TPZD 2VF2A 1FVXA 1F2DA 1NXXA 1QWOA 2IPNA 1IAQA 2PR7A 1V11B 4J0DA 1P4GA 4KYVA 4UU0A 1XTTA 2R8XA 3Q72A 4AN1A 4CCYB 5FR1A 3NRBA 2BONA 4E1BA 2JJQA 3GYBA 1B00A 1SCUB 1GGHA 4J0KA 5GY7A 3O4IA 4MD8A 2PUWA 1WL8A 1XQVA 2JZOA 2IHUA 4FXPA 4BY1I 3ZH2A 4HNTA 4MWGA 2JS4A 4RSMA 1ISMA 1HSZA 2C5EA 3PFNA 3WISA 2Q5HA 3CLSC 1JG4A 4L5JA 1MUUA 1FP4B 1R37A 3OX3A 2ZGVA 3P0IA 4ITRC 5E95A 4E4YA 3S2UA 5F4BA 4RFLA 1MW9X 4YT8A 3I64A 3M34A 3DZBA 3O2JA 4AP6A 4D8XA 1W85B 4XIJA 1MAHA 4CUKA 3HCOA 2P1ZA 3L7IA 4C0KA 1YI0A 2RGCA 1EFVB 2ZTLA 4MVJM 1YVDA 1VQN1 1JIVA 4WTOA 4HH1A 5H5JA 3RS5A 3T12A 2W6JA 4NPCA 4DRZA 2G04A 4ZHQA 3GWZA 3GPBA 2FSFA 2QSZA 2X8BA 2XMRA 4EABA 3NVMB 4EYGA 4F85A 1JFSA 1Q0QA 5FEMA 2XADA 3MELA 3EZLA 4IGKA 2QEQA 2XTMA 4DQ0A 1OCEA 2YZ2A 5DLPA 5CMLA 2Q3CA 4QELA 2CC2A 5KDLA 1USIA 4CMHA 4D56A 5CHEA 2QRDB 3TE5B 1KO4A 4N5LA 2WYOA 4MWTA 3D0QA 2VDNB 4XQ0A 2JIOA 2ZE8A 3M4ZA 1I4LD 1JN0A 2FXVA 3F1LA 3LDHA 3L8GA 3NB0A 4I6EA 4ND6A 5IAKA 3U3MA 1ZINA 2ZSUA 3KM0A 4D3FA 3SIPA 2VBGA 2I8LA 4IDEA 1RLIA 1SCNE 2PFKA 2WZDA 3PGA1 1VSQA 4B1FA 3KNZA 2ZATA 2ZSAA 3DPSA 4L0DA 3TOVA 4M8LA 1LRKA 4BX3A 4CG1A 4A36A 1ECLA 2F59A 3OJCA 3KK0A 3NBQA 3O3MB 4IG9A 2F8SA 1LSOA 2GM9A 5I9IA 3IPCA 5JDCA 3PNBA 4GVLA 3KJZA 2B4KA 2W03A 1NUIA 4BO4A 5GM1A 1LGYA 1X0VA 1X86B 3AUYA 4FPXA 3KT8A 4UCQA 1JHZA 1TCBA 2GO7A 2PWYA 2JLZA 1ORTA 1RBZA 4D25A 5JNRA 5JO0A 3I8SA 1ZVMA 1UOQA 1VQOZ 1NQTA 1NVUQ 4GOKA 4CR6A 1LV8A 3N8KA 3JYQA 4OBXA 4UUOA 3W8FA 2SKCA 2B35A 2WHRA 3LOUA 3OD5A 3TOCA 4D26A 3UG7A 4HWSA 3S5UA 2ZRLA 5ALEA 4G5HA 2C31A 4R71A 4GG1A 4B4WA 4YRFA 1Y1KE 4IO0A 1N3BA 2Q6TA 3L05A 4F4DA 1C1XA 4G5YA 4DR3B 4DQKA 4TTTS 4YRQA 2EGHA 4RVSA 3PD7A 1RC8A 4RNDB 3L18A 4LKOA 4O4JB 2B37A 2JLRA 2QVXX 2R92I 2HJHA 3PTZA 2Q99A 3KOMA 3Q8WA 3E8MA 2NZWA 1A2OA 1A5TA 4Z1OA 4TN1A 5IVHA 3I5XA 3K1AA 2I33A 2QGFA 3UHJA 2ALJA 3RWOA 1A50B 3H9UA 1VTKA 1T0PA 3QELA 3D02A 1Q0SA 2W11A 4UQOA 3RYHB 3OPXA 3WYNA 4A93I 4F7WA 2R60A 3OU2A 1G16A 5JRDS 1F4PA 4QVIA 4ABTA 1YJXA 1NKSA 2OZLA 1B6TA 2JGNA 2Q1UA 1MT3A 3PEEA 4GZ6A 4II2A 4CM9A 5K4HA 4PSUA 3HL0A 1I01A 1Y4SA 3FW1A 1KQ3A 3LUDA 1S2DA 2AJLI 3KKZA 4WN3A 2ZR9A 2WUEA 3TW6A 3P9XA 4O0MA 3WP1B 2CJPA 4KUGA 4L73A 1P17A 1PK9A 2F1IA 2H00A 3QVUA 1ZR4A 1FDTA 3AUSA 2AFIE 2CCKA 4WX2B 1AZWA 4BP9A 4WCFC 4F3RA 2JVKA 5ITSA 2RKBA 4HBZA 5ALRA 4BQOA 2H6EA 1ZU4A 3JALB 3OZBA 1JAYA 2EARA 2IPOA 2IGBA 4TTSA 4ZO6A 4JI1B 3T1YB 4LCEA 2W71A 4NOJA 1OJ7A 3GLHB 3SZRA 4DSOA 2XKBA 1T3TA 4BY9E 4YN3A 4X7BA 1NJ6A 2HU5A 4BVAA 4ZT5A 1M2GA 4JN6B 3HXOA 1HE1C 1IK4A 1TQ8A 1P7ZA 1Y8RA 3PQ8A 4DM4A 2AMYA 3WDLA 5TXGA 1P2FA 2QX8A 2WM2A 4C88A 3PDJA 3THSA 2A0KA 4IJUA 4Z9YA 2YJGA 4BHTA 3KLPX 2C2WA 4XVRA 3VJKA 1L5QA 1WUKS 1YQDA 3MD0A 4GD3Q 4PRKA 3CVOA 4R51A 5JXWA 5LWQA 3DXYA 4QZVA 3MIIA 4IXWA 2VQFB 2PO5A 3LYLA 1PNTA 1G5HA 5B4VA 2WD9A 5JYDA 4B8YA 2FN9A 1F1JA 2PE5A 5C7IO 1HDIA 1QIHA 1OW3B 2AYXA 4DK1A 4IIUA 4ZCSA 1JPVA 4DLZA 5KYNA 3VDQA 1RS0A 1C7RA 3WGMA 3DMDA 4CQLB 2PUAA 2J07A 3ZDYB 2MSCB 4WZBE 1OYYA 3L40A 2LPMA 4HLQB 5ICSA 4DB4A 2A9OA 3CKMA 1U6JA 5K0NA 4XX1A 4FOPA 1K3UB 5C31A 4BIIA 4DR6B 5DBOA 1MX5A 4E5SA 1WABA 1VJ0A 5FLXb 2GHRA 2J0UA 5IP5A 4KDRA 2R7AA 2X5NA 1VJRA 1YFLA 2REXB 3TG2A 3LOPA 2Z2ZA 4GWKA 3RVPA 3M4XA 4LHEA 5LQDA 3MJFA 2BP7A 3LQRA 4KMSA 2IYLD 4LQDA 4MW1A 4PNPA 4RM2A 3TLJA 1ZIYA 1GPJA 3HM2A 5G0WA 1ZD5A 3JARA 3QUCA 3WGVA 4IKPA 4PAOA 1BEZA 3OH8A 4F5WA 3RIHA 2CV2A 2NZVG 1B8VA 1XTBA 2JFUA 3SOPA 1IVYA 1NVDA 2P3LA 3F8TA 2HMVA 4RANA 1ZC3A 4MYUA 4XM1A 2IT1A 3SZ3A 4RFSA 3DLBA 1CRWG 5JCXA 3DAHA 4MHTA 1U1GA 5LYJB 1OFUA 4LOLA 5IU6A 1N6PA 3IOYA 5IP9I 4CMEC 1ZXLA 5JIBA 1DBWA 5FL3A 3W3AH 4HX2A 3GT3A 4IIJF 3VB9A 1AUVA 4HRAA 1B23P 5AW7A 1IN8A 1HQKA 1Z45A 1A88A 2V03A 1ENOA 4JLPA 1UXHA 4RF2A 2IWRA 2PU5A 2JGFA 2XRMA 4C08A 1PFYA 4E2FA 3CEJA 1TIKA 1UJBA 4LTNA 2GVDC 4RVNA 3WLMA 2GF0A 3CW8X 3UO8B 4RTQA 4DGLA 1GXSB 3LHSA 1UPUA 1G63A 2BFEB 2C83A 2VDLB 2XDWA 2Y9PB 3DE5X 3ESBA 3IAHA 4NLLA 1GZ7A 5CA0A 2VJOA 1SQ5A 2JHGA 3K0FB 3EIXA 3HACA 4JI4B 1MG5A 3LXRA 1VSTA 3U56A 3EG5A 3UK1A 3OIFA 4QQRA 4ZVUA 4X71A 2HA0A 2B7CA 3BB4A 4CMKA 1DC7A 2YFQA 4LOKA 2VHEA 1JZSA 1ZH4A 4M88A 3IA7A 2RHRA 1OUMA 4R7TA 3KXLA 3HJRA 4L9RA 2RH9B 5JECA 2VEOA 1TLLA 1FDSA 3ED1A 4Q7EA 3H1TA 2RC5A 3U7QA 5BR7A 4M1EA 4F3NA 1RRVA 1QIEA 1VMKA 2P62A 1K5GA 4BVJA 4MR8A 3VKGA 1VRWA 1B6GA 1Z62A 2XB9A 2CCJA 4P2GA 4Y0NA 5LQMA 1MGOA 3X1KA 3W6UA 4DCSA 5T4BA 1EWKA 1NMEA 3HKZA 1RP7A 1UP6A 3C3PA 3I32A 4E08A 1OX4A 1D2EA 2J3JA 1IB0A 3NOOA 3ZJ4A 1JWBB 1GPYA 3HOVI 3K5HA 1Y33E 1VPWA 3V3TA 3MTGA 1VQM1 1Z39A 1FJGB 3OKAA 3ET4A 3VR3D 3VBEA 5U9CA 1YRBA 1UEIA 5EHNA 5KQPA 2HU7A 3ODPA 3SU8A 5AXBA 2C9BA 1PS9A 3E82A 4ZQGA 2OCLA 1GNTA 1YOVB 3L0SA 3HJNA 1EVEA 2NADA 1NXPA 4TMWA 3S29A 2O8BB 4FIDA 3V97A 5DHPA 4RY2A 3FTCA 4DG5A 1ZG3A 1KMQA 1M6VB 2GNOA 2GVNA 3D5TA 4QYIB 4K88A 4DV6B 4BVBA 1W8DA 2UZ4A 4NJMB 1GP2A 2NSHA 5KI6A 1BJKA 2PH1A 3NTRA 1P6UA 4RM3A 3TE7A 2FSVA 3EIHA 3OBIA 5EQTA 5EJ2A 1M6WA 4BVKA 4CTMA 2PMWB 1M6YA 5DM1A 3ZZNA 3OA0A 1LS6A 2WU8A 3U3RA 3T94A 4PGMA 5IK2A 2BDEA 4MA4A 5CA0F 4L2IA 1J0CA 1FMTA 1RBMA 2HFJA 4PBRA 1UAAA 1EQAA 3C8ZA 1Y34E 1U8ZA 1UR5A 3GDGA 3H1EA 3PXEA 1NBEA 4OFWA 3F7OA 4TZ0A 2WA2A 3C3KA 3AXSA 2VRBA 5AICA 2C2BA 2CL5A 4E0BA 4EMBA 1X8JA 2EBFX 1LQLA 3OZ7A 1A4RA 4IICA 3OQVA 3L06A 1OB2A 3BXOA 4INZA 1ONPA 3HXTA 3NM4A 1B6SA 4TTJA 1D4AA 1FDRA 2GJAA 5CYGA 4LK3A 2PGDA 3RE1A 3AESA 1ONSA 4ROTA 1VBNA 3KBOA 1N2JA 1T3SA 4YIHA 5JH7B 1Q7GA 2F4VB 2IEAA 3NHWA 2G0TA 4KYUA 1T5BA 4G1CA 3GA0A 2GAFA 2BKUA 5CP8A 4C2BA 2OXRA 1K7YA 2P2GA 4FJ0A 3EEYA 4G1EB 2LIYA 4KOEC 4OU4A 5A4KA 3QMWA 3EXG2 2HYIC 1UJ4A 3FRIA 1UJ5A 4JLSA 2O7NA 3CN7A 4N0PA 1Q5PA 3AMVA 4DXHA 4G26A 2H0AA 4J4HA 5JPDA 4HAWA 4IGAA 3QENA 2YJ5A 4S2UA 4XVHA 2XB6A 5AI0A 4CLEA 4HFJA 1DRJA 3VO8A 1OYVA 4P0PB 4DWVA 3K9BA 4NBLA 1PGNA 4UQLA 1CUGA 1XIVA 2AOTA 2EQAA 1OA1A 2ZWIA 2WB2A 2UXDB 3SHTA 5GV7A 1MRNA 3U7RA 3O1HB 1E1QD 3B1ZA 1X2BA 4PQYA 2X41A 1PJSA 1FVOA 1TA4A 4JL5A 3DL7A 4FCTA 4H7KA 4TXMA 2OKGA 4QEZA 1CUWA 1NYLA 1IXKA 4I1SA 1VL8A 2C59A 3WGLA 3HO6A 4LRUA 3J7AC 1G1MA 2YXDA 2Q6LA 3JYLA 4HZGA 4ZAXA 2Z2JA 2I2BA 4UD6A 4MD7A 121PA 4KKXB 4GX2A 1OLSB 1UWCA 5JHGB 3PQ6A 3L77A 4J7UA 3TRDA 1ZA1A 4EW1A 3DEYX 4V1CI 3GP8A 4EVQA 3CBQA 1QE5A 4GLFA 3PD1A 4ZU6X 2PNFA 3L8MA 4NE7A 1E1CA 3TEFA 1YV9A 1QZUA 1XVUA 2CMGA 1E3WB 2DUWA 2H2FA 4U9IS 4ZEWA 3IMFA 3VMIA 3MWFA 1IH8A 4FFDA 1RMQA 5T3UA 3WBFA 1XAIA 4F56A 3TK1A 3QWAA 2OHVA 4FDMA 1R16A 3R76A 3CME1 4CQJA 2P9GA 5KB3A 2QWXA 2XYPA 1C9DB 1ZLXA 2IZ4A 1RYDA 2WY2D 3B51X 4RS3A 2AV6A 3KKPA 2HT6A 1RACA 2RBEA 5FQOA 1IXYA 1L5YA 3QSGA 5KWVA 2D0IA 2WVGA 2YWCA 1Z4IA 3KAQA 4FFVA 4R2IA 1QXFA 2Y1OA 3L84A 3VVLA 4IJQA 2VH2A 4IJ5A 1Z5WA 5BSRA 1G6KA 2UDPA 3Q8KA 5L6MB 4E13A 1IPEA 4JJ6A 3GJZA 4JR0A 4W9NC 4R1MA 3RAJA 4A6DA 3RUDA 2JFYA 4F2DA 3CCVZ 4Y2TA 2GN2A 1S721 1H2AS 3OO0A 4CM8A 4V0SA 5M5BA 1U2RA 1NOKA 1QC5A 5KHAA 1E98A 3FKSA 3HPQA 2EL9A 1NNUA 3A1NA 1PCXA 2GSWA 1EWQA 1T6ZA 1CZUA 1QO9A 3CINA 3UB2A 3KR2A 1D8TA 2JIDA 1F6WA 1T2AA 1X7WB 2FMKA 1L6RA 2RK3A 3DFZA 3T4PA 5FX2A 1YA6A 2I3GA 1I2AA 1KH2A 1UMDA 1KORA 2D8AA 4QVKA 1ADBA 4WWHA 4E31A 1ADFA 2Q6IA 4NMXB 4IS3A 2CFIA 1ZPDA 3G2IA 1UAGA 2IP2A 4E21A 5KNBH 1QS0B 2CDRA 1DOZA 1SU6A 2CWDA 4FMCB 1E2BA 5CHYA 2FZCA 1M6HA 3DEZA 2MCFA 4WCFA 3CY6A 3TL3A 3DEKA 1JLHA 1YDMA 2QUBA 4A0QA 1ZS9A 3I07A 3KIFA 2GSDA 2LD4A 4MVWA 4OQFA 1KO8A 2CK3D 4C0LA 3ANSA 4DEXA 5E6SA 3OA2A 3EK2A 4YBRA 1KDRA 3ZVKA 2ZYHA 4R16A 3AVWA 4YCDA 2FEKA 4CKEA 3STHA 5DBHX 3F3YA 1YB2A 1AHHA 1YSCA 1R18A 3H5RA 4BGEA 3DBLB 3P9ZA 2CXRA 2YVLA 4LWZA 3F5MA 4BUJA 1NFFA 3RYFA 2XCSB 2JA1A 2FG5A 3ETNA 3PF8A 1PLLA 1T43A 2GUWA 2XLCA 3NOXA 4RSGA 2X0EA 4Q3CA 4DN6A 2YKGA 2PH7A 4J0HA 1YZKA 1Z5UA 1W34A 2G7ZA 4BPRA 4MVJI 3C45A 2PUCA 4Z4IA 2FR8A 3ID6C 5ICFA 5JJKA 2VNKA 1YIJ1 4D99A 4O08A 1X3SA 1P39A 4EFDA 2IYSA 1YJ8A 3CQ9A 3S2EA 3OE1A 4LDAA 3AB7A 5GV8A 1QAQA 2B4QA 3UMFA 3EYWA 1HA3A 4X60A 4LDZA 2O9JA 2Q3MA 2ZU6A 2LTAA 3Q12A 2Y99A 4MJ3A 5FXMA 3EG9B 2GEBA 4JEUA 2P5UA 1MO6A 1KI3A 2WWTA 4QO7A 5DGTA 5SZKB 2YXPX 2OYSA 2CVOA 3MAAC 1EFUA 1BAPA 3KYDB 3LY7A 3QUBA 3GQBB 3KQPA 3KZNA 1Z0SA 4QXRA 1UBGA 4CEJA 4J76A 4YALA 5CD1A 1WCYA 2NZYA 3ABQB 3R0JA 3BCUA 5HKBA 2GKGA 3QLEA 1L7PA 4XDZA 2PWAA 1GFIA 1GNLA 1SVLA 4A3EI 1Q21A 1JHRA 3ZNPA 3PC7A 4BQPA 2Q07A 2O4CA 2NYRA 3FYUC 4L95C 4C30A 2QLMA 1NR7A 3AX6A 4G5XA 5B6PA 2YTZA 2C3UA 3FHTA 2RH8A 4NENA 1RPZA 4KNYA 1XWWA 1GN8A 4OGLA 4MDFA 2HW8A 2J8ZA 2M6LA 3KTOA 1OBCA 1NAHA 2LKCA 1QH1B 4HDNB 4ZAGA 3W5BA 5HRAA 3B78A 4QHTA 3JQAA 3OJLA 1DQYA 3NP9A 2HKIA 4FUTA 2FEWB 4EOGA 1P18A 1BS2A 3K1JA 5K3FA 2ZI3A 4M4SA 1OXSC 2QPTA 3AB8A 3UM9A 2JA8I 3UA3A 4KQHA 4WXRA 5E2BA 4LISA 3WNDA 1K4KA 4NQRA 4DLSA 1Z4NA 5EXSA 3FUTA 3N05A 2ZJOA 2M6KA 5DV9A 1YIAA 2MYPA 4C43A 4TUYB 5J3JA 3ZG6A 2BE9A 2QVGA 3GJ0A 2ZULA 1G6OA 2Q3DA 5J4KA 1E9FA 1SUFA 4QWMA 3R5HA 1LC3A 3ZWVA 5EJGA 3U3DA 3RAGA 4X5OA 3UB3A 2YFHA 3KKOA 4D7AA 2PUTA 1DC5A 3KU4A 2VDPB 4Z86A 4LUCA 2IHJA 5AKKA 1NRXA 1RFLA 2IPMA 4G8CA 1EJBA 5KU7A 2ZJFA 4YR9A 4R01A 3JZAA 2RI6A 1MX9A 1WSBA 1IN6A 3PBKA 3L7YA 5K8IA 2F1KA 3WGUA 2WAXA 4HZUA 4LJAA 4JDUA 3EPKA 5FBVB 3ESWA 1E79D 3R3JA 2VH1A 3VMGA 5KSYA 2VJPA 3ZE7A 4KK3A 3ROQA 4PFQA 3ROTA 3JX9A 4YR7A 1JW9B 1XRPA 1F0NA 5CEFA 3SEAA 3GNLA 3PLAE 2FJPA 3STWA 2YDXA 2OAQ1 3G2HA 3O8BA 4Q02A 4B7ZA 4RDIA 1E6UA 5F73A 4MRVA 2OLJA 3GBVA 2HRZA 3L43A 4MV8A 4XOUA 3RASA 3WQBA 1KHTA 2MHCA 3FMFA 3OC6A 2WJYA 4PXAA 3C6BA 3I45A 4C5AA 2H0RA 1MO5A 1UMKA 2FWJA 1Q7Y1 1H1LA 4D3XA 4NBFA 1YJBA 4NZPA 1N7HA 5G0TA 1Q7TA 3AR3A 2VK4A 4P36A 4DGQA 3T7JA 2A3NA 4DJ5X 5FOSA 2PZMA 1D04A 2OO5C 1EEXB 3AKDA 1C4WA 4Q9DA 1LRLA 1EVKA 1VQO1 4E5DA 2VYFA 2HF9A 1GQYA 1XXHB 1T5TA 1CQIA 1JXAA 1PT5A 4QSMA 3PYXA 3BXZA 3E70C 4R84A 3L04A 3G3EA 4DRYA 2VQEB 2DHDA 2QAGB 4EFLA 1K5DA 1D2NA 3Q7SA 4NBUA 1LTHR 1ORRA 2FYTA 2ZE7A 2ZUWA 3JYOA 1UK8A 3WWPA 1NBOA 2EV9A 3WZMA 1DAKA 4DUGA 1GPMA 3AETA 1FOEB 3BRWA 3IVXA 4PXYA 1W1WA 3VHXA 4HVLA 4FFWA 2ZQYA 3DCNA 2ODAA 3RSGA 1JIUA 3OE7D 5ALSA 3SZMA 4ENQA 1TRKA 3UJCA 2ZANA 1FDWA 5LL6f 2XRZA 5DI3A 3HCDA 3N0RA 1ARZA 4NZMA 5INTA 3AOGA 1WETA 2DEUA 4B85A 4BZPA 2QNBA 4XGQA 1B4DA 1ZCBA 3EVDA 1L1QA 1MKYA 4H7FA 1LVGA 2QRPA 3H6HA 4JQYA 4ZQIA 4YXWA 4B87A 1VPEA 3U7FB 1PS0A 4GZ5A 1SHJA 4MW6A 2H1LA 2D0PB 2IYAA 1GT6A 4GNKA 4X45A 3BXXA 4U7PB 5HF5A 3RJTA 5JLAA 2XUOA 3ESDA 4C0SA 1FP7A 5M34A 1KGDA 2JHFA 3CJRA 2O53A 2XKJE 3D9XA 3BILA 1AQNA 1B74A 1GARA 4LMAA 4TKMA 2WE8A 4NECA 5B58C 1ENYA 1VBMA 1WJGA 1Z2PX 2QZ4A 3BHJA 3Q7PA 1K27A 3KJFA 5M3BA 5JAHA 3S7ZA 2Y05A 4HRXA 3IUYA 3KPVA 4EARA 5BP7A 5IKXA 3W5AA 3BGVA 3RAPR 2CUNA 3RT9A 3JWIA 3EWSA 4KACA 1BNCA 4JJIA 1FU7A 1DC6A 1SUAA 1Z6GA 3MSXA 3SDSA 1BHQ1 2QN2A 3K0AA 3UQZA 1QRTA 2E1PA 2WHPA 1ZW6A 1VQ6Z 2I99A 3AUKA 1RI5A 2WPDA 2XT6A 3O94A 3QXGA 1FS6A 1GQRA 4GYWA 4M6WB 2JHPA 3FTEA 4N5MA 3ORFA 4LRYA 3HS3A 3ZIAA 2A84A 1PEKE 1VKOA 2JKZA 3SR3A 5JAUA 1XRLA 4L75A 1FPQA 2QM7A 2YJZA 3WWOA 1ZLYA 3M4OI 1C8VB 1H4TA 3A04A 1M34A 3RTCA 2JIZA 3RRJA 3X1DA 2QLBA 2GR9A 4HAYA 2YUIA 3R3WA 4HX5A 5E9WA 3W2HA 1XMVA 2YQ5A 1Q861 4MLZA 2FGKA 1SPBS 3HXPA 1FBNA 4AWBA 4FM9A 2CN1A 3AEYA 1O87A 4GP6A 1R8SA 2VO1A 2D06A 4MW9A 4AIRA 3OMXA 3QY0A 1OXKB 1T9DA 2JFOA 1G8PA 3D6AA 5CVVA 2RC6A 1XBTA 2IYXA 4S1WA 2FUKA 3INRA 3Q2OA 1G59A 1JU4A 3T41A 1N5IA 1SK9A 2N1MA 2QIOA 2XEDA 4G1UC 4KOAA 1E2DA 3DGEC 3SS7X 3ML1A 5AJWA 3EYAA 4L5CA 3EUEA 2EFCB 3BTOA 3D4OA 3OECA 3RKSA 4L1KA 2CV0A 4B9AA 4S0ZA 1GCAA 4A1OA 1WPGA 1M75A 2QQGA 2X0KA 4Y2GA 4X6LA 5JAZA 1ZIOA 3UMMA 2BFWA 1CR0A 2RAUA 3PXGA 1PI3A 4A3KI 2BE7A 3T1OA 2VAXA 1JKJA 2V54A 2DPGA 4HZIA 5IHXA 1VFNA 2JCSA 3CX8A 4PYIA 3ZCVA 1QF8A 2X0DA 5CPFA 2AOUB 1YBHA 2CHGA 3GVXA 3RDPA 4QJ4A 1P2TA 4DUYB 3GCXA 5DNDA 2FX3A 2V6FA 1IPFA 1D4ZA 4H1VA 3T9BA 3WNZA 3K0SA 2KS6A 2FK8A 5DGIA 4PTZA 1L1RA 1RAHA 2EHDA 1C7QA 3ZWDA 4D44A 3U2QA 3VH2A 4Z4CA 5FRDA 5JFOA 1YB5A 3BHIA 2RH4A 2VPIA 2XDQB 1E2FA 4N9WA 4AMGA 4W5TA 3IDZA 2TMKA 4OHCA 1WOYA 2DP4E 4Y2UA 1WKCA 3AWDA 1LSUA 1SWVA 5CG1A 1GV1A 5HIMA 2GX6A 4HHEA 1HEIA 1T91A 4FYPA 1TGYA 4CTOA 1KVTA 5FBLB 4IH9A 2IQ5A 3QHQA 3Q9UA 4WJKB 3U4HA 4YLYA 3CA8A 4ZCIA 1V95A 4PZCA 1QHFA 1I0LA 4AZ0A 1LD3A 3GTMS 3VOBA 4HB0A 4ALJA 3D5EA 4YC7A 5KNCA 3MN1A 1HZZC 1HMYA 2GEJA 4MA5A 2YHUA 3D7KA 4R41A 1LPSA 1T26A 1VCIA 2WOOA 3QPBA 3EAGA 4RY9A 1TXGA 1DCTA 1KKUA 2XNHA 3CPJB 4KRYA 3ZU2A 1JKIA 3AUJB 3COZA 2QEXZ 1EUZA 1Z6QA 2IRWA 2PKQO 3KG2A 4PG5A 3TKLA 3DF9A 4YT2A 3EVNA 3ZHZA 1EFRD 2B6HA 4MULA 2C20A 2WP0A 4XE5A 2XCUA 4QJIA 3W5UA 3EXHB 3PX2A 1B0UA 1TW3A 2J5RA 2VI5A 3VZPA 3DQPA 2PGLA 1M67A 1N6KA 1ZM2A 2J3KA 4NI5A 2XUFA 5ALOA 4YRAA 1IBKB 1B42A 1WCXA 2FW8A 3S28A 1JG7A 4ZRMA 2ZYWX 3F98A 3OO1A 4RSHA 3R7SA 5DE3A 1ZGCA 4IUBS 2YHAA 2VJQA 2L0XA 2YVKA 3EVBA 2FSUA 2RGGA 4FGUA 3HDQA 4RKQA 1ESEA 3K70B 4G4SO 1UBEA 3X43A 1PWZA 2I8CA 1PLJA 4JAVC 2R6ZA 2PX2A 1QSGA 1KI4A 2CLLB 4NB9A 3AHEA 1EJ6A 2AI1A 4JSYA 4M0FA 4R2JA 3WZLA 4WXHA 3CT4A 3I1YA 2XNKA 5LXTA 1E5LA 1XZJA 3AEUA 3RB8A 1KZHA 3K8OE 4WE3A 4KWIA 1M1XB 4QLOA 1W4CA 5HTKA 5JJ5A 1IBRA 4K8RB 3HM9A 3TB4A 4CEHB 1S4MA 4DSNA 2X8AA 2ARKA 1ZGGA 4QOIA 4HNUA 3FVRA 1QHGA 2C4MA 5CDSA 2EERA 3V4FA 1HE2A 2GHTA 1IL0A 2P5SA 5E7MA 5CLQA 5IMSA 2HSWA 2JANA 4IR7A 2PO7A 2FW1A 4IMPA 1S2OA 1WB4A 5KCMA 3D6TB 1HFWA 2GZMA 3MCAA 4MTLA 3SEZA 1Q7RA 2E7ZA 1AXRA 1HC7A 1RSZA 5CH8A 4X64B 4BV2A 1JHVA 2ORIA 4CM4B 3TDNA 5BSFA 3OIUA 5KBYA 4C20A 2XQIA 6REQA 1DWPA 3O9ZA 3I3OA 3UJHA 3LWBA 1Q7EA 1QGUA 1XQWA 5DU2A 3DR5A 1GSAA 3IULA 3EEFA 2G70A 2QTGA 2BMFA 1RWMA 3HA2A 3UMYA 1P0IA 3ZY4A 1MHPA 4KIUA 3SYTA 5FFMA 2V9PA 3OIDA 4MDHA 4WY5A 1NNLA 3DLCA 1NJGA 2JBAA 3ND6A 1JAZA 1D1SA 5JT1A 1BKYA 3PXDA 5AIAA 4C0QC 3MONA 1QDUA 3FNRA 1MZVA 1RAGA 1R7RA 3I9NA 3UJDA 4D9GA 1P72A 4U7JA 4B83A 2IIBA 5G0SA 5BSUA 2DHQA 4YNBA 4ZOAA 2B6NA 3LQYA 5DM70 3RGWS 3RRYA 2B69A 2ZIAA 1ETHA 1M8GA 2GBPA 3EC7A 3EXFB 1KMHA 1IUNA 1DRVA 2PUHA 3A11A 3KO8A 4HNAA 1XLWA 1HFEL 3VPBA 3WLQA 3BMCA 2Y1KA 3LT5A 3QU7A 1VZ3A 4HDMB 2NVBA 4W9RA 3UQYS 3AH8A 3HUUA 3WA7A 3V1MA 5HKKD 3DCJA 2JI7A 2ZAEB 5JFTA 3GLIB 4BATA 2DSTA 3QV2A 4ARVA 3RCBA 1I13A 2B0JA 4HQLA 4RK4A 4DWOA 4MZDA 2L2QA 2XKAA 3N58A 3K35A 4ZYTA 5DCLA 3BCSA 3GBSA 5LXTF 2WICA 4OSOA 3T99A 4GLBA 1LDEA 3EJWA 3ZWYA 1EX6A 3JPWA 5HUJA 5K6AC 1U3UA 2GS9A 3MS4A 5J5VA 2FOXA 1NDUA 4LECA 3TKAA 2O5CA 1FFEA 2VHYA 2B8NA 2WZQA 1DTEA 3AF4A 3NEYA 4U2KA 1ML8A 3OHSX 4MB2A 4NDNE 3M2PA 4O33A 2DWPA 1ZH1A 4YJGB 5ESRA 4K81B 1TPYA 1QHHA 3HB7A 5KKCA 3W7VA 2PMZA 3I53A 3DOOA 2DH5A 1J97A 1KY2A 1JTVA 1Q50A 4ZCPA 1OOEA 2SECE 5THQA 1AGPA 1BJRE 1NUSA 4KWTA 1L5VA 1GAEO 2CL7X 4MDYA 3TQCA 3A6FA 2OPBA 5FI0B 2OO5A 3EMDA 2YDYA 2FH5B 4HUTA 1OWNA 3GFTA 2QN9A 4C4RA 4LJLA 4KPGA 4LJ9A 3QPUA 5B2FA 2B92A 2IOHA 3OQ1A 3LXXA 4JZYA 4LKRA 2W6ID 1S6YA 4RHUA 3RYCA 4C0WA 2MSLA 4GM4A 3LLUA 2ZROA 4UNQA 2QBYA 4BXOB 1O6GA 3BWXA 1I3CA 1KJJA 1CF2O 2FW9A 4E6PA 2Z4RA 3M82A 2ZS8A 3CRMA 3CCV1 4A6XA 2VT6A 1EZ4A 4PX2A 1EXWA 4WZAB 4IQGA 4EWCA 4ZOLB 5C4MA 1JNXX 4I5IA 1KTIA 3RVSA 5FUMA 1J8FA 3HDGA 1I3OA 3Q3VA 1RRCA 3HCFA 1C4OA 5BR1A 5J2TA 3ZXYA 1PR0A 5LB2A 1SVIA 1S9HA 2VUTA 2WFMA 4PCAA 2CHEA 5KTSA 1FU8A 2JFQA 3IP7A 4GGPA 5IDXA 3HY4A 3IMGA 3C15C 2K2QB 2FX5A 2HSDA 2ZXUA 3VX3A 2H51A 1YJ91 2V7VA 4KO2S 2WOJA 3WYFA 4IOMA 2NU6B 1XPUA 2AYZA 1TKBA 3QF4A 4R8VA 3C14C 2AD1A 1SEPA 2HSZA 4OMFG 5BOSB 5ADHA 4LVNA 3V7YA 3GMDA 3QTLA 5EVJA 1KYZA 1F2TB 4ZVQA 4TQAA 1TJYA 1HURA 5K0ZA 5F9HA 2QF7A 5GZ1A 1VYVA 3EXG1 3K31A 4PLCA 1V6AA 4C05A 4JJGA 3WGTA 4PWYA 3V4PB 3WLRA 2ZYIA 1TFUA 1UQUA 3MMPA 3ZDEA 1ZM9A 5ENZA 4EHLA 3QG5A 5F23A 1TMKA 3MM4A 4MAAA 3MJCA 1GEEA 3PCRB 5B1IA 5TMBA 1OI2A 1XZ8A 5KU1A 1NMZA 4XR9A 2HBZA 4FMBB 1CFZA 3NM6B 2WILA 2I67A 2VIIA 4WVLA 1DC8A 1K8QA 1O77A 3WICA 4IF6A 2WVAA 3HDVA 1U8FO 4RA6B 1O9GA 3HFRA 3NU1A 4G85A 1H2FA 4ZKEA 3ZU6A 4GL4A 1H0KA 4HWRA 4HTFA 4Q03A 3Q8LA 4CQMB 2NO6A 3G17A 2GBIA 3EISA 3MCWA 4B3BA 4BRUA 4XCQA 3FUVA 2HRCA 1SHTX 4G8DA 4LMRA 3PRYA 3H7AA 4BE7B 4OXRA 4ARIA 3TD9A 2GCOB 3DE7X 3KCNA 5TLSA 1E32A 3EEQA 4Q6WA 1VB5A 4X1YA 5ARBA 2NQ2C 5EZYB 3H3FA 4MP8A 5DSZA 1M5TA 4GMDA 3F3KA 3ABSB 2SHKA 3KJGA 3QLUC 5DHRA 2BIFA 1B6RA 1IQUA 2JGMA 4H7EA 3TB6A 3NIDB 5CDTA 2RIRA 3NVAA 2PHZA 2V7TA 2OOYB 3EW9A 4R1QA 4A2WA 5KX5B 3RUPA 2JLQA 3IO5A 3R5TA 1G8YA 4HPWA 3SOZA 5F7JA 3QVOA 3UIEA 1BE1A 4G1VA 3LRXA 4B3XA 1CY4A 3H1BA 5DGDA 3AI7A 1A9RA 1M2OB 1Q84A 1YGPA 3L82B 5CU7A 5THKA 3C3BA 5J2TF 4LF9B 1R15A 1SM4A 4Q4HB 2AH5A 3JXEA 3JZMA 3PEUA 4IGEA 4KFTA 4TWIA 2Q29A 4IXDA 1MPXA 2DCMA 2VHVA 3A4VA 5DLYA 3U7JA 2CLDX 5B37A 1JP7A 2XOKA 2FZLA 4M1KA 4JEHA 1CNFA 4RF5A 4TT3A 1EKXA 3I42A 1PR5A 2GK6A 4R7ZA 3EQ8A 1Z6YA 2FFHA 5GONB 1J21A 4I1UA 2HB6A 1LLDA 2QVYX 4GP7A 2RIPA 4GF5A 4IY1A 1N1EA 4R98A 3UMVA 1ZMTA 4EY6A 2C9YA 4EHJA 4C0AC 4KZPA 4EEXA 4L8WB 2QM8A 2Q1SA 3WGGA 2PLAA 5CAEB 3TSWA 1GZ3A 4W82A 1AGYA 1A8SA 3EA4A 3G7SA 4TS3A 4PHFA 5CT4A 4M1OA 3SC3A 4OJTA 5EHGA 3CPWY 2CD7A 1Y5IA 3VOTA 3CCCA 4F11A 3PT5A 1RWPA 1G7SA 2WMDA 3COSA 4DLWA 2JCVA 3MTDA 3FNGA 3NT4A 3U19A 4EPVA 1R8YA 4Q93A 3TLKA 3NP7A 3KJXA 1CW2B 1C0LA 2DWCA 1HZZA 1OX6A 3Q10A 1S3IA 4HI0E 4QC2A 3V33A 1N32B 4DSUA 2OV4A 4I9GA 4OTZA 1FFCA 2C00A 2I4RA 3OZXA 1E96A 4OX9B 3HBLA 1CUVA 1Z6AA 4ZTBA 1IY2A 2Q5QA 4MI1A 4XDYA 1VPDA 3KD3A 2XTNA 4XPIA 3B2EA 4CKZA 4BKOA 3PITA 5KOYA 4UE3S 1NLYA 1T4CB 2YOGA 4H16A 1LDNA 5LSAA 4DJJA 4BTVA 4YAEA 2YRWA 1XMSA 4ZARA 1VYHA 2QYSA 3RFCA 1HNWB 1MO2A 2R8EA 4JL8A 2X6RA 4V1CB 4WK2B 2D7DA 1E1YA 3BA1A 3OCZA 2Y77A 3TAHA 2RKOA 2ZAMA 3MQ4A 1OIXA 2JA6I 3G2NA 1WV0A 4TS4A 1RADA 2O50A 2XIQA 3IIIA 4H6XA 4CIXA 4COKA 2FE1A 2X15A 1AOXA 1PVDA 2O23A 4IDAA 1UDCA 4W5RA 1OVMA 4PYOA 2J3MA 3CZAA 4Z99A 5JISA 4E12A 4ENSA 3V4VB 4C2AA 3T7RA 2C3MA 1S0UA 3CGWA 3P9NA 1X7YA 1UANA 1Z37A 1W49A 5MN6A 3DE6X 3V1UA 4H35A 5FA5A 4EY7A 1H22A 2XYRA 5KTYA 3COWA 5JJBA 1E2NA 3R5FA 3RSZA 1LI4A 4EA6A 3C16C 3ZKAA 5JFGA 3RTAA 2WFLB 3KPYA 1YQ9A 3OZRA 1LJ8A 3X0DA 3O5AA 3PU6A 16PKA 4EGFA 4KLCA 3RVQA 2YADA 1JHMA 2FUNB 2H57A 1E4EB 3IQEA 4WXEA 3SX4A 3ZU5A 5LNK1 2JD0A 1TF2A 4ZI2A 3HJHA 1XZEA 4AXXA 3CEAA 5JWOA 1GVHA 1KRXA 2GZRA 3O1IC 3LY8A 5F2OA 1QYIA 4O2AB 4AYXA 4OQEA 1SA0A 5PNTA 2OK7A 3OTHA 1UPBA 3HWRA 3P71T 4RKEA 3QVKA 1Z07A 5B7GA 1PV4A 2A5JA 1WB5A 3AIOA 4FCWA 2Q27A 4OJYA 4X7MA 4G84A 5H9WA 1K8A1 1TL7C 2FP4B 3IIMA 2PD4A 1FRVA 3WGZA 2Q1YA 3S27A 5AD1A 3U3ZA 3FTFA 4NYMR 3M6MD 2AT1A 3OPNA 3IVMA 1NMQA 5C1DA 1H2XA 4MCJA 4M55A 3LAWA 5EWLB 1MC5A 5K99A 1QQTA 5KWEA 3FQMA 3VKHA 1Q0ZA 4ECEA 1NQWA 4KTTE 3TQIA 3IUSA 3C4VA 1PYGA 4UM9D 5IX8A 5L3SA 1V47A 1E1MA 3E3OA 3Q2IA 3QVGA 4EO4A 2QVCA 4HC4A 1OYWA 3F73A 3NEAA 4JYMA 5D3ZA 5F7ZA 1RMTA 5LZ7A 2HADA 5CFQA 1MA3A 1HDZA 3E9MA 1R4NB 1I6LA 3UBMA 1YC5A 3ND9A 4CF7A 3S1AB 1RYBA 1AKNA 3IP6A 1ZRMA 2IS1A 1SHLA 2HTEA 4QTZA 2O8CA 4ICIA 4EB6A 2O5RA 1TTQB 3P5BA 3CLUD 3BWMA 4G0QA 1KA9H 2GPSA 1Z9BA 1VQ61 1E0DA 1V1RB 3FN4A 3QX8A 4K5QA 3KKEA 1PEYA 4BBRI 2QLNA 3S1NI 1EYZA 2NUAA 3HP4A 1TTHA 4PONA 3KS9A 1LK7A 5J58A 1JEOA 2YICA 1DKQA 3O2NA 5CLHA 4BDTA 3B70A 2ZRJA 4GBJA 1UWKA 1KSJA 4AZ3B 3DBRB 1T2NA 1SCDA 3UOWA 1BWRA 1KQFA 1L1EA 4JYZA 3E5RA 4KL8S 4A7PA 1BWQA 2DWUA 1QM5A 2FQ1A 2LE0A 3JQGB 2GZAA 3HH8A 3AQIA 1AG9A 3TL6A 2XNSA 5EYPB 2XLBA 3MZLB 1WHSB 4NIMA 4YAFA 3OM9A 2YZMA 3TXXA 5K6AA 1O4WA 2FN4A 2WSSA 3WMRA 4J7XA 1DRWA 4IHAA 3R6GA 2EWVA 2Q5FA 2JJ1D 1XTRA 1FDVA 2VUHB 1PL7A 4KQWA 1E4YA 4XWGA 5ALHA 3U9LA 2ZITA 1T0BA 2H2IA 1LLQA 3TXAA 5ES3A 3UAYA 4CDMA 1ZH0A 2E4WA 5HUHA 3ZH9B 4GEGA 5JD4A 3EWNA 3E3MA 4Q9HA 3EQ6A 3W2TA 3CO5A 2ACEA 4I4TB 4AJ9A 5C8VA 2XE6A 5GJBA 4G0XA 1DS6A 1FP6A 4XFKA 5CDHA 2J30A 2HV8A 4I2VA 4NR0A 3QOXA 5AJUA 1DX4A 1TVKA 5ALFA 1OV6A 1ZH6A 1M1K2 4HEA6 2M9MA 3RFTA 3ZDBA 2JBWA 3LBAA 3LIIA 1NW8A 4B6QA 3SKVA 1T25A 1EB8A 3H65A 3TOXA 2NVUB 3NDBB 4WK6A 5LOVB 3H9BA 4DBLE 4KHPB 2GZ3A 2PL9A 4ISBA 3K9WA 3T7IA 3AIKA 3DHEA 3D8NA 5KNCH 2E5LB 4WOJA 3TD2A 4UVIA 1IIBA 2AZDA 1SZJG 1GRCA 2BWJA 2H4FA 3G8YA 4NVRA 1IG0A 4HL6A 1LDMA 2EFYA 2OO7A 4MWZA 3U5TA 1F8FA 1NW5A 5CNMA 3SC2B 3KQSA 3CZ5A 1K9M2 1TUIA 2YHIA 4PW0A 5CLFA 2V4UA 4LRWA 3CJTA 4KQJA 2D1YA 2GPNA 1LBHA 1YS1X 1Y1VS 2AUTA 5EY5B 4DMFA 1Z4QA 4AKTA 3EXEA 3FLMA 3MZ0A 1ZI9A 2VRCD 1ND5A 1DXHA 4JUIA 4NEQA 3BGDA 2R7ZI 3NYRA 2VATA 3HRIA 4NRDA 2C4VA 2VNHA 3R7AA 3ZWQA 3RU7A 2BTEA 2BD0A 2QTAA 4FGLA 3KT3A 5CVCA 4YFVA 1MOPA 2X9LA 5THXA 5H3LA 2NZ8A 2QL9A 4C6TB 2ZSEA 3BMQB 5B30A 5KNDD 2JD1A 1R9GA 1J9ZA 3D7NA 5DIZA 3ZXSA 2JIRA 2NT4A 4FFLA 4KXNA 1U0NA 3JQ9C 1V71A 2ERYA 2PKQP 4O4HF 1HT3A 4PG6A 2J59A 5AK5A 4GZLA 4XSGA 1PDOA 5ICMA 3QLVC 4GPZA 4RKYA 2WAQA 3BS4A 3EGXA 1V25A 2C4TA 2FPKA 2J5BA 2BGKA 2O3SA 2PIAA 2WNHA 3QUAA 4FQ5A 1EEHA 4IDNA 2ONJA 1X7XA 7YASA 3VSEA 1R6XA 1L2TA 4I8DA 4RXTA 1URPA 1RP1A 3C48A 3VNAA 2P4QA 3RF7A 3RBVA 5AJYA 3CLRC 4IMJB 4WXMA 2ZUSA 3VZSA 1P45A 3CVVA 1ULHA 4IUYA 3A6PC 2V8IA 1MX1A 5AO9A 4YQFA 1TYEB 3RS7A 3DM9B 4QX6A 1U3WA 1IZZA 2QX6A 1BN7A 1NP6A 3OCYA 3QZUA 4GU5A 4RGVA 4UDYX 3W7AA 2NQ8A 3CE9A 4DA6A 1ABBA 4IP0A 3P1JA 1YS2X 1JH8A 1RR6A 4YO8A 1JLLB 2GBGA 2ZCUA 1UWLA 3B6IA 3R09A 3CCE1 4QYWA 2W9XA 4DWWA 2WKWA 2XNDD 1ZK2A 3L7JA 4OAOA 4DMUB 4EKYA 1V4BA 2HBQA 3W8EA 2P78A 3KE9A 4HATA 4AIIA 4ER3A 4NTZA 1CT9A 4WZZA 3RKUA 3TEJA 3VR4D 2FEAA 1RWVA 1ZOOA 4ITVA 4OK5A 1XZDA 1ZD1A 1SD2A 3A9UA 3AG6A 1Z25A 3PFGA 4MUIA 4P7KA 4TL6A 1P7WA 2FRVA 1AY0A 3QJ5A 2WVJA 4ISCA 3TM5A 2V45A 1YI1A 3EQ2A 3VXKA 1CQPA 1TUBB 3F90A 1XDDA 3BULA 3GWGA 4Z8YA 2JGRA 3QLUA 4DM3A 1JDZA 5I5EA 1ECJA 3BN3A 5LZ8A 3TTXA 4O2BF 4YAOA 2WDPA 5LBIA 4O0LA 3AY3A 4U8GA 4G37A 4HN2A 2AFHE 4Q4CA 3ZZTA 2R1VA 2PRSA 4MS1B 3AVVA 2IYQA 4NG5A 2CDBA 4UFPA 4U7DA 2PGIA 4L27A 1FTNA 4NYJQ 3TTSA 2Z9DA 3QKRB 3SE0A 3PF9A 3R4CA 3NKFA 1MT0A 4C14A 5C5DA 1SG9A 4NHEA 5C0OE 2HJWA 1RMYA 3DKPA 5A4JA 4LRQA 2Q9AA 2XYVA 5KNBA 1KIAA 4HDKB 3OIWA 5C1BA 1ICEA 4TLAA 4RTRA 4FKBA 2H1WA 3CF4A 4BB6A 1KAHA 2XUAA 3LFUA 4BB5A 2EWWA 4I1IA 3TJRA 4YCNA 4NF2A 1P4AA 2GO1A 3B6MA 4P1ZA 4YDQA 3PWTA 2E9HA 3LIPA 1B26A 1ZDMA 1YQUA 4JBHA 3WYEA 1NY6A 1CDZA 2OM6A 4JP1A 2FCAA 4DA7A 3F7TA 4G3XA 5DM2A 2DTDA 2C57A 2GARA 3BBPA 3TSAA 4AM8A 4UEWA 4IDFA 1RJ9A 4RWEA 5E3JA 3MTQA 1VA5A 4URWR 1JQ5A 4Q47A 2ZYGA 4NCNA 2VSOA 3O95A 5BW6B 1BWSA 2NXWA 5FUBA 3MG9A 4Y2XA 3HUTA 3T3HA 4EA9A 3ORSA 5HJ5A 3P9RA 3O4VA 2A9KA 1HYEA 3VTFA 5HF9A 1Y9DA 1PR2A 3G5MA 1CY1A 1KR2A 2CLCX 2YNMD 3DEAA 3GJSA 4LN1A 4DZTA 4QRDA 3QU4A 1HDEA 2NNLD 1PQWA 3JATA 4BEVA 3CG0A 5KWIA 3OPYA 1GAWA 3FF1A 2G6BA 1CR6A 1UXGA 2C58A 2GN8A 4GMKA 3ILSA 1IJEA 5IVDA 4QRHA 5ELXA 2DCUA 2VDMB 3KT0A 2CLIB 4Q5IA 2WWGA 3G79A 1X94A 3FMGA 2INGX 4X1KA 1KS2A 1QK3A 4TLDA 3IV9A 4BXXI 3EVAA 3LX6A 4UTOA 3G9UA 4QUKA 2YY7A 3FPHA 5BQPA 3TVDA 2O8EA 1XWIA 3DTVA 4IEFB 3W1VA 2H4JA 2ZAGA 2EG5A 1NPYA 3IILA 4FHEA 5AHXA 2B9VA 1I94B 1SCAA 1Z17A 2VPXA 2W6ZA 3K3PA 2BHRA 5DM4A 4Z3KA 1Q83A 4ND1A 3DEIA 4PVDA 1P9RA 5L7YA 1UZAA 2PX3A 5FQNA 1UC8A 1QFZA 5IM5A 4LZNA 3UK2A 3WG9A 4ANFA 3E9RA 1W8IA 2AFIA 2W2TA 2GFHA 1C9KA 3P9CA 8ADHA 2WZBA 3LHKA 2B7BA 1EUYA 4FYMA 4LHZA 3SIWA 4ZVPA 1N2FA 4EDHA 4GOOD 1A76A 4XFJA 1MP0A 1FQJA 2KJQA 5I7RA 3CR7A 3OW2Y 3AM5A 1MNAA 4F38A 5AK6A 3KXIA 1ZNYA 3GGGA 4KLZA 3S8MA 1FFDA 3G6WA 5AI5A 5AQ1A 4PHHA 1YRAA 5K45A 3MXTA 1OGYA 1EG7A 4X44A 3L49A 5A62A 1N34B 1CJCA 5FI3A 2E2JI 3KETA 1H05A 2FPPA 5DVZA 1ZD9A 3GLHE 3HEAA 1CY2A 2JB9A 4M21A 4R8RA 4ZD6A 3PHBE 2JVJA 1Z8NA 3SDZA 4EBBA 4O1HA 1RZ3A 3SPXA 1CS0B 2VHQA 2ZZKA 4O4LB 3SBEA 3NNNA 2WM8A 3BZUA 3KYBA 5D5QA 3D3KA 1Q0TA 2OB2A 4PYKA 1YDWA 3A9WA 4KR6A 2OORA 5LMNB 4ESEA 1QCDA 1X39A 4NU8X 4OHOA 4BNZA 2XHZA 3ESAA 2W04A 1VLHA 2O14A 4MB6A 5EZ6B 4I5GA 1YAJA 2FZWA 2GBLC 2BBSA 1I9GA 3EZFA 2NSLA 4DDWA 4YRSA 1E7MA 4H3SA 4WZBA 3E18A 1X1AA 3GTOI 4MHSA 3VSDA 4QTUA 3IRUA 2NW6A 5ITVA 2P91A 1EFTA 3HNPA 4L0QA 3V1TC 4YRKA 3WADA 5GJVC 3AI2A 1L4NA 4MI6A 3EFOA 3BK7A 3V2GA 4AUNA 4P84A 2GRJA 5EIOA 3SX2A 2HA2A 3BB3A 1J5XA 5FOWA 3WWYA 3D6WA 2GTIA 1JRLA 5FUYA 1UIRA 3V2HA 1UZNA 4UE6A 1SCIA 1Z75A 2Q1XA 3ONNA 4JBGA 4YPFA 2Q7DA 5IHPA 4Z9XA 2VAVA 2PEZA 1GZ4A 1K7XB 3E7FA 3EN0A 4N03A 3K6SB 4KWHA 3TSYA 2OGUA 3CD6Z 3PGVA 1JR6A 4NYJR 1RWWA 1SO8A 2EEPA 2IX9A 3D3NA 4RXMA 4Y67A 2J4FA 2HRQA 4U8HA 5JV5A 3QU2A 1I4OA 1J33A 1AKVA 2MINA 5TGDA 4BMSA 1KJ8A 2O0HA 3GD7A 3MWYW 4ARCA 1X9GA 4ZOEA 3NH4A 1DP4A 2PKWA 5CGZA 1FTGA 1HL7A 1EFPA 1WHTA 1ULUA 1LSJA 2QIPA 1QK4A 4TV8F 3SS8A 3QFTA 4XLLA 3GEHA 5JBIA 2WK1A 1JLRA 5KTTA 3AO0B 5E9AA 3WQRA 5BURA 5ILGA 5HW0A 1NQVA 1IUKA 5JC1A 4RTSA 3WY9A 4LHSA 3T7SA 5CEJA 3BC1A 3VMFA 2HD4A 1B8UA 4PGFA 4JP3A 4F04A 1TC2A 1KMIY 1ESDA 2PMEA 4DREA 1SU7A 1YFJA 1BD4A 1Y5RA 2JFZA 3F71A 4TOIA 3T5CA 2K5RA 3IIKA 2CNKA 5C8ZA 4GLJA 2RD2A 1QE3A 2IE8A 5G2OA 4Z4EA 1BVYF 2JLUA 1U8TA 4NX2A 1HE4A 1VG0B 3X1XA 4EJSB 4RPCA 5HQ3B 3G2PA 3I4NI 3LL4A 1DADA 1SVNA 4A3JI 2OM2A 2QL5A 3E58A 3CMMA 4XSVA 3V7UA 2IHNA 4BKUA 4NXMB 4XSHA 2GHIA 2IA5A 1I5OA 4IH1A 3KSMA 3F6PA 3PIDA 2R1TA 4CKWA 2XD9A 4UU7A 5TT1A 4Q3LA 2F90A 1XCLA 2QOEA 3VVBA 4IPTA 4DIMA 1KR5A 3D7LA 2GZ1A 2HWKA 2N0SA 2XUJA 4O8ZA 4LSZA 1HQYE 1N3LA 3DCIA 1B14A 6LDHA 2AEFA 2MWMA 3G0CA 4PLPA 2PK3A 4INAA 5JJIA 3Q9NA 4DCVA 1TWAI 3BH7A 3FMIA 4M1MA 4HEJA 4QUGA 3IAS1 4IJMA 2D5CA 3NDPA 5D1OB 4IIGA 3FDJA 5D51S 4OX9Y 2IS2A 1HETA 1II8A 1L8LA 1G38A 2O2SA 3C98A 2TMDA 3R3YA 3LGSA 2EQ5A 3G9ZA 1UFOA 3HE3A 4WHMA 3TZEA 5AM3A 1ID8A 1OX5A 1NLMA 2PFGA 3FSGD 3H7IA 4FW8A 2C7OA 3T3OA 4TSFD 4RDCA 5F52A 1YB6A 2PZBA 5P8WA 3SZLA 5KSWB 1PWYE 3D8BA 3G2OA 3KQOA 3CURA 1OKKA 4WNAA 2FMUA 4OXKA 4CU5A 4W7HA 4P3XA 2ZB4A 1U2SA 5K4AA 5T4FA 1ISHA 1IUPA 3A9SA 1QQ6A 4PZZA 1HWYA 2UYHA 1ZK1A 5CCXA 3K7AI 3CCQ1 1TM4E 1QZXA 4TXHA 4F2GA 1XG5A 1P1CA 3DL4A 3O3CA 2EGUA 2YWGA 521PA 5CCDA 4ZZ3A 5DTIA 4F8EA 3JQ9A 5BQ3A 1N7JA 3AC0A 1NVTA 1LTQA 4NOKA 2WTUA 2R8OA 3CCSZ 2HQSA 2HQRA 2F3SA 2G77B 1C8BA 4FW9A 3L79A 2FV8A 3FZGA 4LI3X 3DOCA 5EQFA 2Z4SA 3ZW8A 5EMNA 1U99A 3OLYA 5HXAA 4HXEB 2NXCA 2QDKA 5LB4A 3TSZA 4HGYA 3AR4A 1KMNA 3IP8A 4C22A 2D59A 1XU9A 2P2LA 4LCBA 4V3BA 4ZREA 5BWCA 3CCMZ 5CVEA 2IW3A 2C03A 2XMSA 1GGEA 4KXMA 5CT8A 3RADC 1CQJB 2AQIA 3VYUB 1LNSA 3G0IA 4MUEA 1H8HD 4FDLA 1E2PA 1HE3A 4XVQA 5G3ZA 3L0YA 2R3SA 1CP3A 1EVLA 2OLEA 5AUPB 1PNQA 1DJLA 1UUFA 3QE0A 5EI5A 2CGEA 1Y3HA 5FTWA 3NCTA 5EAIA 5JU6A 4JA2A 1FUUA 5ALNA 2F3QA 3ADCA 2W6QA 5CLGA 1QUEA 1QYWA 1Y9AA 1UBSB 2IZ6A 3VV2A 1AVTA 1DEOA 1RRPA 3ASVA 3UFXA 3HN6A 4KRXA 3USCS 1GZDA 4S24A 5FIUA 3NHAA 1MQ9A 2YS7A 1U3DA 1ZD4A 4I0WB 4KV7A 4B2LA 5IDWA 4RVFA 2VSFA 2W2KB 4EENA 1RRKA 2BI7A 2XE7A 3KEMA 4FZ3A 3MF4A 3CB2A 4JDPA 5KYUA 4BEJA 3K1TA 1YMQA 4I66A 4V2UA 2QRUA 4BIMA 3VZCA 3V4LA 4M0KA 2R7KA 5FPHA 4MIEA 4QYSA 4I36A 4PC6A 4DYHA 1A8IA 2P2DA 3JQRA 1E2IA 2NO1A 4PM4A 2CNNA 2D2VA 3HKEA 1MFZA 5NULA 5KJFA 1QANA 4M9SA 3B36A 5DEOA 4BO7A 3QE9Y 3ZTYA 1PIWA 3E5MA 1SUBA 2HMTA 3L5OA 4ILKA 1H2ZA 4MUKA 2B3TA 3ZZMA 2RCYA 3G02A 3LF1A 2JGIA 5IZCC 1MBZA 5KVVA 1KDTA 1G20E 5EJEA 3R9XB 1E2JA 4JB0A 4BAGA 4LSGA 1LLCA 2QB5A 4XXHA 2CZGA 3VZQA 1YZGA 3VDRA 3ZWKA 2AK2A 5FYDA 5ECWA 4DTCA 4N5NA 3VTAA 2B4TO 3LM8A 4Q7MB 5EZ5A 3TPFA 3IOMA 1BW9A 4Z7OB 4LFCB 4UXJA 1QE0A 5F77A 5IT5A 5KYWB 4G0NA 4K87A 3VVCA 3LBYA 4MYCA 4BE9A 4F97A 3QXJA 2Q5CA 1GA1A 1LW6E 1TT7A 3QRWA 4LX0A 4J1NA 4US1R 1Q2UA 2ZFUA 3GIDA 3KHKA 2BISA 4AULA 3BWVA 1D0SA 4I6JA 4ZQEA 2VUIB 3ZWXA 4DDHA 2BEWA 3HJTA 2GAIA 3CZMA 1T9BA 1VBKA 3BORA 3HU5A 4MUMA 4RO0A 4LS3A 4D9MA 5BVGA 2ZK7A 3WB2A 1JIQA 1EDZA 4YX9A 3M5DA 1QONA 1YB1A 4FBLA 2IZZA 4V24A 1XEXB 4NULA 1SQFA 1G64A 4M1ZA 1DTSA 1RJEA 4RHYA 1S2IA 2PS0A 3LF2A 1IWPB 1HDXA 2FCRA 3NG1A 5FAXA 2YCLA 2R0QC 3DH0A 3N28A 4EKNB 1Y4ZA 4F6RA 2BKVA 5AVZA 4U39A 3N2LA 3Q6NA 5HCIA 5JSUA 3SP1A 1QU3A 3ADKA 5IJ0B 1RO2A 1BRTA 3F5DA 3PTAA 4MR9A 4DRXB 3IV7A 2X5XA 2ZBEA 2BZGA 3CZ9A 3LVRE 5CXSA 1RPJA 2DKFA 3U0BA 5CM2M 3PWZA 2Q28A 1R6TA 2F9FA 1GG2A 1VRCA 1EX1A 2PSFA 2FEOA 4L3OA 5D5HA 3ZXIA 1M5RA 1X14A 2YU9I 1CFJA 3MMNA 3N1UA 2Q2QA 3CKKA 4HAXA 4PSAA 5EJ6A 2G17A 4F12A 3TF5A 1RYNA 3FPFA 3ICWA 2H08A 3ZHCA 1H8ED 5E4FA 4QQFA 2DFPA 3UICA 2VTBB 3RAFC 2RHMA 3STVA 4PX9A 4RVOA 2ZJ4A 4DAOA 2Y1XA 4DG9A 1CUEA 1CS4C 3M9WA 4BP8A 1ILEA 5DNCA 5A5DA 1OWOA 4PAGA 4TKUB 3EGOA 1L4EA 1UBFA 2ZYTX 4M76B 3W9SA 3UGTA 1AO3A 2RK4A 1VE6A 1WOMA 2WINI 3T1HB 3OCJA 2ZCVA 1QR6A 2C7PA 1RFGE 2V8OA 2GPTA 1JQDA 4ZZIA 2AX4A 1SCKA 2Z04A 3MINB 4GM0A 4EMUA 4EUNA 1L5MA 4L7QA 1OH6A 2E4XA 2HA3A 3WIDA 2OP0A 4JBNA 2X9QA 2X2OA 1NYQA 3AINA 2V6BA 4A23A 4H4EA 4CL0A 1C14A 5AP9A 4AMYA 1ZITA 3ABRB 5A0FA 1E9RA 5F35A 5H9VA 5JRZA 1F12A 2X1LA 5IBQA 4D0RA 1XMQB 1LLUA 4E5PA 1HTWA 1PW5A 2H1CA 1GL7A 1QLJA 3OOHA 5ED0A 4L51A 5DWQA 5LU8A 3AL2A 3PNMA 1NF9A 2QUAA 3A2MA 2WU3A 2K3RA 5E8JA 5DDIP 3I2JA 5IJXA 3TDMA 1KL7A 5I7OA 1ECCA 5EVCA 4B2IA 1DJMA 2Q8NA 5TMPA 1XFDA 1IY8A 2DQ4A 1GU1A 1BMDA 1UKYA 3AI3A 4ATNA 2GERA 4D43A 2R6AA 3IT1A 3LUAA 2Q4BA 5DBGA 5EIWA 5EP4A 3HTXA 3CVJA 3O4HA 4IX1A 2FN7A 4GMGA 1SELA 2GBLA 3JCZA 3ZQ4A 2RG7A 1VDZA 1W88B 3AU9A 5GAJA 3AVUA 1ND6A 2X3UA 4Q9JA 5JSZA 5EC8A 3D43A 1G66A 3FPKA 1E6MA 4E1AA 1MB2A 1KKMA 1T36B 5HCNA 1YCFA 1AKEA 2AC7A 3PQ7A 2I76A 4TPKA 5CCEA 3HWX1 2F1OA 4X62B 2VBFA 3AFHA 3GI1A 1SXJA 1HRDA 3OG9A 5SYNA 1JEYA 4CIDA 5LUBA 1MMFB 2CNWA 4XUDA 2AHOA 4OA5A 4PG4A 1UOOA 3JD0A 3K72B 2I1LA 1DAOA 4GVPA 4M0UA 4XTCS 3A4LA 5FNVB 3SD7A 1NZJA 1YJNZ 4MYHA 3S44A 3UB4A 2NP7A 1LWOA 4OP3A 4A2QA 5KYXA 1C3EA 1L4KA 1DZIA 4JOQA 4OJQA 4EM6A 1NKTA 5LMCA 1DQPA 4V0RA 3THWB 1DDOA 1YNOA 1ZD8A 2V7QA 3K2QA 3IQIX 5DISB 3TLCA 2HPZA 3Q5DA 4B7AA 3RFVA 1VQLZ 2Q3EA 3ED5A 4JJ4A 4MW5A 5E6UB 3L7CA 3U7HB 1KDZA 1KSFX 4MTCA 1FS4A 4UVGA 3A6HA 2J3HA 1KZ9A 3DONA 3G9QA 3AKCA 4X3OA 5FWNA 1RE1A 1L7XA 1USPB 8MHTA 3G13A 3NYIA 4UM8B 3AXTA 2YYSA 3ESXA 4LXXA 4XWWA 5F9MA 1RYHA 1Q17A 1ZO8A 2QJOA 1ZWKA 4FFBB 4WECA 3ET5A 5JZ9A 3ILYA 5KDDA 4QQ8A 3RRNA 1OLXA 1C5KA 2YOFA 2Q62A 1YE8A 4AJHA 3MWDB 1E58A 3AVOA 3JAKB 2ZPAA 3VPDA 3CONA 3IT0A 1EJ0A 1YITZ 4FR0A 4GYKA 4KQIA 2EAUA 4PHGA 3WDKA 5JATA 5G40A 3SVLA 2A7XA 5JZBA 3GDFA 4N6OA 2W2MA 3WDMA 1IJKA 1DKMA 5FI1B 3RUAA 3S2SA 1KZ6A 1P1IA 3MCVA 1J1ZA 5EHIA 4OQMA 4ZV9A 4LYDA 3CWZA 3W6ZA 4MV7A 2Y2UA 2IHKA 4RAQA 3LZCA 2H7VA 1VG8A 5JWRA 3QFRA 4NBWA 1TVEA 2Z5LA 2BFNA 5B7PA 3CLKA 1N2BA 1Y82A 2JARA 1ZIPA 2G72A 3H84A 4QIHA 1C0EA 4QU8A 4DILA 1F2UA 1K08A 2F67A 3DDWA 4INJA 1W0JD 2VYND 4FNOA 4ZP1A 3WXBA 1MO4A 3F4BA 2H63A 3RC3A 1E9AA 4BNVA 5FH9A 3K71B 4J2OA 4PE5B 1NFRA 1PT6A 1SD1A 1T10A 1V41E 2RGWA 3GRVA 4FE4A 3PQEA 1RXIA 2GJ4A 3JR7A 2WT8A 4MAFA 2G9NA 4BNMA 1WP9A 4MKXA 1Z29A 4U5QA 2REQB 2C2XA 2PKCA 3WL3A 4M7PA 3GJ3A 4OF4A 5A2Qf 2MR6A 4E51A 3ZKWB 3ZWPA 4KPUA 3L01A 1U7HA 2YINC 1UAYA 5GQSA 2QU8A 5LLTA 4S0XA 2VA9A 3L0OA 3U7GA 1JDJA 3GEMA 1H5QA 2HV9A 4C2UA 4WFIA 1NNSA 1WY5A 1T9AA 3O84A 4YRBA 5K51A 3HYTA 4OATA 1XXHE 2OYRA 1EUCB 4BMVA 1F60A 2K5UA 1CNMA 2ICAA 1PYOA 5A0TA 1LKZA 1TNDA 4PFSA 2V7WA 4TMFA 4TN5A 1NLZA 4WERA 5CLIA 3PHJA 4WV3A 1WZ2A 1WA5A 2FG6C 1E0JA 2DYKA 1KJQA 3HDHA 3KYCB 1KC3A 1P0CA 3GB9A 1JV2B 3C97A 3DCYA 3FIUA 4IG4A 5C3EI 2FUCA 5A1JA 1CVRA 2J45A 2QL6A 3ITDA 5E7JA 1GKYA 1MF7A 1X15A 1XZQA 3BZWA 4TMKA 2HUPA 3KQWA 3Q3IA 1Q0RA 2VLBA 4LCJA 1H9AA 3OVMA 2ZUCA 2PVSA 3A0RB 4LEIA 5FULA 1W2HA 2YBDA 5JCJA 1G5PA 2O3QA 5BOVA 4ZHQB 1F7VA 2NU8A 1W7AA 5B7QA 1KP3A 4OQ4A 1G8KA 1C3OA 4G24A 3E2MA 3AUUA 3B6ZA 3DD5A 1KI6A 3SSAA 4ZEXA 3DDOA 2Z95A 4GR9A 4NOZA 1D5CA 4XYGA 4B82A 1C3JA 2BSAA 1YCGA 2H9AA 2RGDA 1WMBA 5TS3A 3J81b 3K70D 3C3XA 3DNFA 3FNHA 2XUKA 2RGBA 5DHFA 5AW1A 3CMAZ 4S1PA 4JYBA 4CKXA 2ZXFA 4P3NA 4ERXA 5E2IA 3B5IA 4RTOA 4HWOA 3QE2A 1SB9A 4TWRA 2CYAA 4FOTA 3UXEA 4JODA 4QTTB 1H5UA 4B4KA 1DXOA 3DE4X 3TBHA 1ONOA 2REOA 1J49A 2IS4A 1U2GC 2BGNA 2F64A 3HYLA 2CUZA 3T5TA 1BKDR 1DQZA 2RIQA 3GNQA 1FA9A 4OREX 2B8EA 1KAEA 1RKVA 2M48A 3G82C 2GYVA 1U7WA 5DYWA 3UBTA 4GMFA 2BGLA 3LK7A 4JNKA 5KQGA 4MRIA 1ONNA 2ZJAA 2XVMA 2G0NA 2FG7C 3IJEB 4YCBA 2PGAA 4GGOA 2VJMB 1UC4B 5EJ5A 2O7SA 4IZOA 3EY4A 3CH6A 4IZHA 5FWAA 2QNRA 4EW6A 1U0JA 1U2TA 1DMRA 1F2VA 2BCGY 3CRNA 3ETEA 3THXA 3N2KB 4KR3A 2F43A 1MABA 4ZN6A 2Q3BA 4O59O 1KYQA 2VNJA 1NZFA 2QA41 4JBYA 3VO1A 1C1XB 2RPRA 5A6SA 2ZRKA 1TADA 1BVRA 4E5VA 1FLVA 1H1DA 1VLQA 2GEVA 3F6RA 3IPYA 3M5WA 3TZHA 4MQ5A 1H0RA 4X20B 4ZQFA 3B5EA 3L3BA 1GRVA 1XMIA 3H2JA 1I6KA 3LQ1A 4LBYA 4TVBA 3VYTB 1R0ZA 4ZCTA 3HU3A 4CYMA 3O1LA 1NN1A 2VUMI 1UBCA 1M1YE 2XGSA 3K1AB 3NTUA 3OEHA 4HS9A 4HQRA 3EDMA 4Q05A 2NAPA 1HZJA 3LQ2A 2XY4A 2H59A 3QELB 1IY1A 3I1FA 3WK7A 1KERA 4HTAA 3LLCA 3EWIA 3BSWA 1IU9A 3SNKA 1P9NA 1Z8HA 4RK0A 3GTMI 4AJ4A 3TLBA 2ZI6A 2OZLB 1RHQA 2DE0X 3D31A 4MKFA 1XMOB 4BBZA 1Q1BA 1BZYA 1LQTA 4K3UA 4NH1C 1Y7TA 4ZOBA 5A5EA 1JEJA 1Q74A 3P26A 2IEBA 1E9VA 3TKYA 3MK31 4LHVA 3WDSA 2J33A 3X2EA 4JLUA 3RU3A 3U81A 4BCCA 3GP3A 4Q7QA 5J2UF 3VUFA 1RI1A 2PS3A 2P68A 3TZKA 3E7PA 1NUQA 4TTPA 1G0OA 1ZUIA 2AVDA 3I2KA 1FRNA 3HBNA 3V8QA 4QAJA 3KL2A 3K5IA 4G09A 4PVCA 2DQYA 2C8LA 3M33A 4OH1A 4C3OB 3TQQA 1TYCA 4K2HA 4A0SA 1YK0A 2YN2A 3KB1A 4XZ3A 5HZGA 1BH2A 1Q15A 4XWOA 5DHSA 1ICIA 1TEXA 4HH4A 2W8BA 4GMXA 1VQKZ 4B3TB 1NBME 2E0IA 4NCBA 3WOHA 4HDQB 5TJ9A 4RTLA 2FP3A 4HX9A 1AKUA 3AF0A 1Q3TA 4K6KA 4RIHA 3TSOA 4RTKA 4DIUA 1HDOA 1EAMA 3IBFA 2GTHA 1RD4A 1FP2A 2HIGA 1QK5A 1XLUA 4JLWA 3VX4A 4FEEA 4IIYA 1Z34A 4LRTB 4QOJA 5DXFA 1YZNA 1N2ZA 5DN6D 1M2JA 1CYDA 1BE8A 3BF8A 1SVMA 3DHVA 3QWFA 1OU0A 4H08A 3D3WA 4J0CA 4X8MA 5KSPA 2LZ0A 3DE1X 4JVNA 4C3VA 2JCBA 2FMFA 4JU8A 2F3UA 4PR3A 4MV5A 3NIFB 4RE6A 4DADA 5I8ZA 3ZK8A 3THYB 2GVZC 4UCXA 1PWHA 3C3JA 3RIGA 1IG3A 3SXPA 1ULAA 4P54A 3A37A 5EKUA 5GJCA 3SCZA 4ARAA 5K01A 2OCXA 3NV9A 3QFHA 5A7HA 3WK5A 4FC7A 2J0UB 1KEZA 1H0SA 2Q1WA 3AJDA 2BKXA 4Y7DA 1FFYA 2F62A 4Y2JA 3WHIA 4PSVA 3ROXA 5BNWA 2DPHA 2E2WA 4U3JB 1J8QA 2H07A 4FGSA 2AJBA 4E5KA 3VKUA 3DC7A 5ITZA 1XN4A 4BLWA 4E3WA 2X6QA 1JHXA 4ZAZA 3T9EA 1L8OA 3GG2A 4D4JA 3BWCA 3EWAA 7AT1A 3KVNA 3EZ9A 3T1QA 2PUBA 2PUGA 1ULBA 3IJPA 4UKDA 1TB4A 1L7EA 3ELBA 2CZCA 3CLTD 1A9TA 1UBMS 3LNTA 1OY1A 2PXCA 3VQTA 1G2PA 2ZIGA 3RJ9A 4LWPA 3TMYA 2XMCA 2BI8A 3V8MA 2N75A 3D8SA 4RETA 3M3PA 3JU3A 5DO9A 1B16A 1GZHB 1N4DA 2CVHA 2IZ0A 1QYPA 2KMLA 2RAPA 2FDXA 2Y1FA 1QFYA 3BDIA 4HDRA 4XW2A 4GZ3A 1B2LA 1G9XA 1TLTA 2I55A 4DW8A 3WAKA 1W5AA 3ETDA 1I32A 2VZLA 3F4KA 2OUKA 1B7GO 4EITA 2C5AA 2IDKA 2COEA 4NBNA 3OU6A 3NYQA 4ZT4A 3BXGA 1NUPA 2LCFA 4HAOA 1DT3A 3A6GA 2QP9X 3I92A 5DLEA 5JSQA 1PJLA 3I4MI 4CCWA 4A16A 3EASA 2H7XA 3R77A 1YQEA 2JLYA 3JQPA 5ADVA 1SC3A 1V3TA 4FZ5A 4I46A 1ZI8A 3R40A 2FFRA 1RHUA 1GSIA 3K9GA 5TVKA 2O6LA 1WU8A 2VXCA 2XOEA 4REQA 4YCAA 4B46A 3I76A 4JSRA 5EE0A 1PZFA 2KW5A 4YPVA 4KXUA 1IZ7A 4BNTA 2EU8A 2V58A 3MEQA 4X95A 5DTEA 2R751 3CTPA 4B6GA 4CIWA 3JWGA 4MPRA 3N2GA 1C0KA 1SUDA 2G06A 2WHXA 3LUHA 4GX1A 3CPSA 1FS5A 2DUMA 2XGMA 4K03A 2WWRA 2I3ZA 2HPAA 4XA8A 5CBPA 1YZ3A 1W5FA 1JNYA 2Y0EA 1AZSC 4IL5A 5CFNA 3I3SR 5JJCA 4U0JA 2UUBB 2ZYSA 3RBAA 3B6KA 2HXSA 4DT1A 1VA4A 3LQFA 1Y9EA 3E22A 3SXUA 3X2SA 3G23A 1U7PA 2Z3WA 4DE5A 4KLRA 5CJJA 2C7RA 2ZIXA 1BS1A 2OQVA 3NZEA 2QP3A 4YS6A 1Q7CA 2A88A 2C07A 5EKDA 2QMUA 4NS4A 2AIRA 2C42A 2IU3A 3BM5A 1XLTC 3C6MA 3LUPA 4LXHA 2VP2A 2WB4A 4UAVA 1Z4KA 6ADHA 1PQUA 3OAAA 3L1HA 2OXTA 2ZM5A 5KYKA 1U04A 3KLNA 4A3CI 4FBGA 4DGSA 3DVLA 1A69A 5IAOA 3H5VA 4W9MC 1NX9A 3DZGA 1SB8A 1EA5A 3KSRA 4LXGA 1DSSG 4ODIA 5HQJA 2D5AA 3GLIE 1QWSA 2VXBA 3GRKA 1PE0A 2HI0A 3EXIA 2IYEA 4JLVA 5FWXA 1ZJ4A 3MFYA 1N2CA 5I9TA 4D80A 4FMDB 1JBQA 3KYIB 4MR7A 1KI8A 4GX0A 1U9IC 2W2PA 5LA6B 1WUHS 1XK6A 2FVYA 2P5TB 4MLPA 5KJ1A 4OBWA 3QIVA 2AOWA 1VMAA 2CE7A 2QQEA 3TTWA 3W90A 4NCAA 5DB4A 3KQNA 4F4CA 4AUMA 1ADYA 2AN1A 2PX8A 3DR3A 3K4PA 4FYIA 4HMOA 1NVVR 4M83A 2ATEA 3BIJA 3V7NA 3S81A 4DQVA 3T95A 1MJ5A 2CXTA 4MWSA 5ALZA 1Z5VA 3PRHA 2IZ1A 4HDOB 4EG4A 3IXQA 4LQCA 4OUDB 1GADO 4DBLC 5JLJA 5M7EA 1KPIA 5L7WA 3MPOA 4JL6A 2HF1A 4P4LA 3GVCA 3G8DA 1SKQA 4L2IB 2H3EA 4N7JA 1KYXA 2O2CA 1O5TA 1EXMA 2Z9BA 1EK1A 1DJOA 1AN0A 1B1AA 2A57A 2VJKA 2JEOA 3RYIA 4QREA 3MJVA 3BD6A 3ESQA 4W5OA 3K9CA 2XB8A 4HEHA 2H1VA 3SF8A 1CSEE 3DG9A 5AHRA 2FSHA 1JR3E 1N5KA 2GYUA 2PA0A 3PHHA 4Q3AA 2FGJA 1AO0A 2XWBF 3N6RA 3C1TA 3M9XA 3GZNB 4B8WA 4HWTA 5LMZA 1NX6A 3RT1A 2P79A 1RPNA 2ERCA 1FLNA 1IUOA 2J67A 4IQFA 1T1RA 4BBSI 5L6LB 1TJNA 3CCUZ 1K8ZB 3E3AA 1XJQA 2ONCA 3DF7A 1U6IA 3G49A 3GH3A 1E3IA 1N0UA 1R9NA 2BV3A 4POAA 1NY5A 1ZH2A 4KDFA 4ACBA 5DNWA 3KT6A 3KV1A 3VJRA 2DT5A 3H4VA 4E5UA 4L3VA 1TO1E 5H4GA 3P0HA 1JJ7A 3INGA 2IZOA 2BFBB 4OOEA 1SQ6A 4WZAE 4ZALA 4XJSA 2AQHA 4LZAA 1D09A 2XUDA 4ETNA 1FYFA 1G3RA 3ZBQA 4HGOA 4QDTA 2PQMA 1QOPB 2XZTA 4OHRA 1PSDA 2QSUA 4PPYA 4UEOA 3FG9A 3VVMA 2GBFA 2IHBA 1J09A 1DI0A 2B5OA 3SIXA 1OIVA 3MCUA 4K6GA 4E4TA 2JRLA 5LYYA 1FSPA 1I24A 2QUHA 2F8LA 1HL3A 2V0NA 4R1OA 4PIPA 3GLSA 3MT7A 2BMWA 1NJ1A 5K3BA 4BB0A 2RHWA 2G2KA 4Z3DA 5AT1A 2G9QA 1EI9A 1M2KA 1IHOA 4GWGA 2OAP1 3QVWA 1K6EA 4CKBA 2XXAA 1ZL2A 3IL2A 3A2KA 1GNRA 2D54A 4RYLA 3QSYA 3CSSA 3WB0A 1E3TA 1PJBA 2IW1A 4FILA 4B74A 4LJ5A 1UFRA 2DBZA 4BQFA 4L78A 4TMZA 3DKRA 2VDRB 4WBXC 5D85A 1U2GA 2Q3LA 4UC0A 2ORVA 1N8R2 1JDVA 3EH2A 4QPJC 3PIRA 4RDXA 5KJCA 5DBEX 1JI0A 2BHNA 5F4ZA 1KDVA 1XCJA 3WAGA 3W34A 1E1CB 2QRZA 4YQEA 3ZCTA 3KUCA 3BEOA 2HCBA 4D81A 5CXUA 4G6ZA 4TLLB 2HWUA 3IMCA 5UKDA 4WLVA 4E07A 4FYVA 2R66A 3F5FA 1NJSA 3A14A 3FSEA 4B81A 3IRVA 4AECA 1WZIA 1NXWA 4XUEA 1Z33A 1W2BZ 3TLGA 3QMPA 1ZYUA 1UBUS 4IVRA 4GKJB 4RMNA 2V8BA 3IHTA 4FNGA 1VQ8Z 4NFRA 1LDYA 1PV2A 2YYAA 4D4LA 3N0WA 3ZNQA 2RI0A 4R1NA 2DR2A 4LOAA 4GC9A 4JFRA 1ATIA 1Q821 1RABA 1MDFA 2X1HA 4GI3A 4GW3A 5D1PA 5JANA 1AQUA 1NVEA 3IAM6 3ZJVA 3ZZ0A 2QJFA 1TU4A 2OK8A 2O1XA 2OQ2A 2GBCA 3U4CA 3WLOA 1U0TA 1Z2CA 5CITA 4LZOA 3BIOA 4V0QA 5KMGA 5FEUA 1ZKMA 3SF0A 1KC82 3TGWA 5G4LA 4AXBA 4CPDA 1MG0A 2CMHA 4JMPA 1O94D 1YJN1 1TMYA 5EWJA 5ADWA 2FK7A 2OHHA 3ADOA 1KPHA 4YMLA 5K8LA 2HYDA