4S1TA

Crystal structure of the mutant i26a/n52a of the endoribonuclease from human coronavirus 229e
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
347
structure length
342
Chain Sequence
SGLENIAFNVVNKGSFVGADGELPVAASGDKVFVRDGNTDNLVFVNKTSLPTAIAFELFAKRKVGLTPPLSILKNLGVVATYKFVLWDYEAERPLTSFTKSVCGYTDFAEDVCTCYDNSIQGSYERFTLSTNAVLFSATAVKTGGKSLPAIKLNFGMLNGNAIATVNIKNINWFVYVRKDGKPVDHYDGFYTQGRNLQDFLPRSTMEEDFLNMDIGVFIQKYGLEDFNFEHVVYGDVSKTTLGGLHLLISQVRLSKMGILKAEEFVAASDITLKCCTVTYLNDPSSKTVCTYMDLLLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFYPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229E
rcsb
source organism Human coronavirus 229e
molecule tags Hydrolase
molecule keywords Uridylate-specific endoribonuclease
total genus 86
structure length 342
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4s1tA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s1tA02
2H85A 4RS4A 2GTHA 4S1TA 2RHBA 2OZKA 2GTIA
chains in the Genus database with same CATH superfamily
1OH7A 3U4MA 1V11A 5DWVA 3FB1A 3ISVA 1V7CA 3G4S1 1YFLA 2VHYA 1J2YA 2JFFA 4NU8X 1GLVA 1NZDA 5C31A 4QUDA 3C3CA 1AV6A 1OTYA 1K5GA 4XGNA 5A5GA 4BLSA 5IZ4A 1BW9B 4CIAA 1VYUA 2IYRA 1OWOA 3M5DA 4CTMA 5IN4A 1FTQA 2Q51A 2JS4A 4OSPA 2IWHA 3SM3A 4A7PA 2J07A 2I3ZA 1TPZA 3PXAA 1OY1A 2HSJA 3INRA 1LLUA 2H63A 4AZVA 1U02A 5DNDA 1R6TA 2OP0A 4RNCA 3UXMA 2C4HA 4HEJA 4MJ3A 2Q28A 3WLFA 4HXEB 5HUJA 4CXMA 3AP1A 2AFIB 3HFGA 2QMZA 4IQGA 2GM9A 4NICA 4BDTA 3SHWA 2DC1A 1C0PA 3OMWA 3RC8A 2ZETA 3VHXB 3PJDA 4D0GA 5BWBA 5LMNB 3PC2A 4CM8B 1SOUA 3IBTA 1W0JD 4B8WA 4CKWB 1E2UA 1H65A 1K5PA 2H9IA 3HU5A 5DWQA 1P1KA 2Z3ZA 5C1IA 4XDGA 4DGSA 4G26A 5LD2B 2JARA 1E4OA 2G5GX 1QG4A 2BISA 3B3FA 4IDDA 4U2FA 4LE2A 1ULUA 4NABA 5TVGA 4WJZA 3DS8A 2WYVA 2VCHA 3I2KA 3T7RA 4OA5A 4JIMA 5AJTA 5AW2A 2QX6A 5AN9F 1E2FA 3BZUA 3SGLA 4F56A 2H1HA 3MOSA 1N8NA 2P7IA 4BNKA 5IBQA 4C7KA 4UU1A 3CLSC 1BMDA 3U3ZA 4AJLA 4ENPA 3K2IA 4EMTA 1JXMA 3CO5A 3RSHA 2WTUA 1XTPA 3DW3X 1RHKA 4J16C 2XIQA 1GKKA 1DELA 4FXPA 3AXTA 1G2OA 2ESRA 2NSLA 2Q1TA 5KB3A 1G1AA 1GGJA 1R5OA 4XIGS 1J99A 2B2CA 3RZDI 2H7CA 2HA0A 3DLAA 4FZRA 1NVMB 3ZV7A 1QG6A 3F0TA 3A2LA 3LDHA 3EFHA 2V7WA 3G9QA 4BUCA 1W47A 3THYA 2AFIE 2QKDA 2JEZA 3SNHA 1TQ4A 1KIMA 4IEIA 2DHDA 5E1BA 2IPAB 2ZTLA 3EEQA 2VF5X 2VJLA 3MONA 1Z02A 3RU9A 3W9BA 3DMYA 2I7VA 3NBYC 5KWIA 1I9CA 2FLVA 3LUDA 1RCUA 2HDNB 1NBEA 1I1NA 2VTKA 2W6JD 5E7MA 3ZE6A 2OGSA 5CFQA 3AVPA 4G8BA 4OHBA 3GKQA 1HE5A 1N7IA 1NAHA 3HJNA 4NENA 4U02A 2YBEA 2ZRQA 3ANNA 1P2BA 1E4YA 3EDRA 1ZB9A 3I9V6 2WIKA 1X94A 5FB3A 4RO0A 2AQ8A 1IZ7A 5F5XA 1WOYA 1YDHA 3N07A 621PA 5DGHA 1MQSA 3BDAA 4MCJA 3W7BA 4DLKA 3IT1A 4O5AA 2QZPA 3CLTC 2VOEA 4EGJA 3C6QA 3TM5A 4N7BA 3LP8A 5ENZA 1I0LA 4F45A 1JLLA 1PKEA 4LA4A 2QJOA 3TMAA 3LMKA 1G4AE 2GEJA 2CLKB 4CLRB 2HN9A 1KSHA 1PAUA 4FFWA 1MOQA 2O1XA 1DIBA 2Z2KA 4IFBA 4LZOA 3JALA 5D85A 2PJDA 2P3LA 1V1JA 3BK2A 4ROTA 1R64A 4J8PA 1SA0A 1Y1PA 2KW5A 1QJCA 2XNKA 3AR4A 2MSWA 2PD6A 1G20A 1Z6PA 2D13A 2PXAA 2G2KA 3PL5A 1RQ2A 2H2DA 2YN0A 4PO1A 4BRUA 5KTMA 1PJSA 3DKRA 4FINA 4TQUS 5F7ZA 1VM6A 1JIJA 1RFLA 5GY7A 2MCFA 3ST7A 3GA7A 1VKNA 4NE7A 3ROTA 4KR7A 2ZFUA 3VH1A 3BDIA 3FCAA 1UC4B 1FXSA 4S24A 4ZREA 1SC9A 3GWZA 3SR0A 1UBOS 2V7TA 4X71A 5IVKA 2I4RA 3D3KA 3SKVA 4DRXA 2JGKA 5DWDA 2BC9A 3BKWA 3D6MA 3K5WA 2Z98A 3C7AA 2BN4A 2V55B 2O9JA 3DFFA 4O1HA 2AXNA 4R5HA 3WB2A 4K1XA 4TKVB 4YLEA 3W2TA 4LFCB 1NMSA 2OLEA 2NQ8A 2Z8YA 3LLSA 4G07A 2ZTUA 4P38A 3VAYA 4PHGA 1ZYUA 1JPNA 4W5OA 3TRJA 4FHDA 3EXIB 4IGKA 4J0EA 2FXIA 4X20B 4QG3A 4JJ6A 4I99A 4ATNA 4CJXA 4OUDB 1N4DA 3HO6A 5ITSA 2VNIA 2HJGA 5D6NA 1N0HA 4BVEA 2GERA 5B4UA 1GAXA 3DL7A 2MSEB 4HMPA 1XI2A 2BE7A 1KWGA 3QOXA 1Z17A 2EV9A 2H17A 3EXHA 4M8NE 2B4RO 3V00A 1RO2A 1KFJB 1GUZA 1N2BA 1SZCA 3L3BA 4M1EA 3TJRA 3ZGLA 4FFNA 1YJ9Z 3T7AA 3RDPA 3IJPA 1BMFA 2R9VA 2QVXX 4RJIA 1NXTA 1SC6A 5FQNA 5AVTA 4FGKA 2WD7A 4HUJA 4RYDA 2VP0A 3IXQA 4ISBA 5AM5A 1QYCA 3JR7A 1XNJA 2DJIA 2JC3A 3Q3CA 3L0DA 3B78A 4IZOA 1NW5A 3ENZA 2BFBB 4Y9RA 4HDSB 5B3JC 2C2BA 4ZAFA 4AQYB 1JQLB 3JQRA 6AT1A 3J81b 1XZJA 4HZUA 1MNAA 2ZS9A 3G2JA 5I9LA 1KC82 1G0OA 2ZI4A 3I9V1 1NZFA 3ABRB 4RIGA 4MEJA 3F6BX 5LQRA 1E3MA 1QFXA 4WN3A 1T1EA 2RJ3A 3BE6A 1OZ0A 3I2IA 2QU7A 4Q1CA 1D2EA 4R7TA 1GPAA 3Q7TA 4JQZA 1WHTB 4U2KA 1KDZA 2QUZA 2HKIA 2XVMA 4GSLA 2H0RA 4O4HF 4RKRA 4UUBA 2PN1A 3DLTA 4BQQA 2PJZA 2ZYDA 3UHPA 1NJI2 2VSYA 2ZRPA 4FD2A 2O05A 3ICEA 1X3ZA 3R5XA 3JY6A 1K8XB 1RACA 1T0PA 1VSVA 2PTGA 2PX5A 3AINA 4OMDA 4RHUA 5LR6A 4Y18A 5IAGA 5AUPB 3KUUA 1T5IA 1Q812 1KWKA 2JD2A 1QHHB 1SULA 1SKUA 1N33B 1RFGE 5C37A 1QQBA 4LF6B 4AW9A 2QMHA 3T9BA 3WYEA 4A3LI 4GR4A 1R6UA 1ZLXA 5CLIA 1X1BA 3KQQA 4C3ZA 1MOSA 3N6VA 3EG9A 1E94E 4IKEA 3STHA 2VJPA 1PFYA 2H1CA 2Q27A 3D4PA 4TUYF 5A3RA 4JB8A 4NECA 5ALMA 4JJZA 4HNQA 3GBVA 5HKKD 2QVZX 3SYRA 3CC21 2QNIA 4WNYA 3PXBA 2C9BA 5J2UB 4OK3A 3CY6A 3NHLA 5MFPA 4XB6B 3AL0C 4ENVA 1NQWA 2IBMA 4JOQA 4KJZA 1PZMA 1XRPA 3HVHA 5E38A 2DPXA 2FPMA 4J7CA 1VYHA 3AWIA 3FLMA 4Q6BA 5BSVA 5EIEA 2VNAA 4WKBA 2DEUA 4CRWB 1RYYA 5A04A 1CUBA 3RARA 3HFJA 2J6BA 3C5HA 2D5LA 2ID9A 4IGEA 5G41A 4ISCA 3LHFA 2AJ8A 4NCHA 3EIXA 3E22A 4CCYB 3JVIA 3TQFA 2PMFA 4L73A 1QVFZ 4HB3A 4BQSA 4HEHA 4KRXA 5D1OA 2B5VA 1JJBA 4F97A 4EPTA 2Y1KA 4W82A 5LZ7A 4YJFB 1ZP6A 2Z4TA 4ZOEA 2C1EA 1XLUA 1ENYA 4UVGA 1HFEL 1QG0A 2H4JA 3CCSZ 3G2NA 1EUCA 1E62A 3MWFA 1YZ3A 2OBLA 4DIOA 2AOUA 4RACA 3O2JA 2F64A 1P9NA 1JSLA 2D0DA 2WSLA 1LRLA 3EZYA 3NKVA 3AFGA 4LHZA 4N18A 1WXWA 2MSCB 4UE6A 3T5PA 9MHTA 5TMEA 2RIQA 1WWKA 3AIIA 3NIFB 3OOHA 4C07A 4DLVA 3IGFA 4EUEA 1VIMA 2GAJA 3OAAA 4CYMA 1HDRA 2NVOA 3SVZA 4V1CB 1U0FA 4UARA 2FJ0A 3G13A 1SD2A 2VUSA 1B0UA 1D2GA 2RGRA 1T43A 1TL7C 2C4NA 2IYFA 4HB2A 3UCFA 3C98A 1SFOI 2OCXA 5AHOA 5CK5A 5F9FA 2BSAA 1PV2A 4B45A 4V0QA 5FV7A 1ZI9A 5IC5A 4R1MA 4CIXA 1LB1B 5IXJA 3W5DA 2E9SA 1O94C 2FPXA 1YI1A 1JLRA 3OIWA 4X93A 4XGKA 2O6LA 4ZVKA 2CFCA 4W8GA 2ERYA 4F72A 5LD2C 1WG8A 4UM5A 1DX6A 3IXLA 5A4DA 1AQLA 5HVNA 1F8FA 3O4IA 2ZYSA 4EIWA 4IIDA 1NMEA 4NJEB 3CNLA 3DMFA 4COKA 4H35A 3O90A 5ALJA 2J1LA 2X58A 1KZ6A 4MYCA 1XHLA 5F3RA 2XA1A 4DADA 1SQGA 3OPXA 1EFUA 2JVKA 4NMXB 5A0VA 4RD2A 3GZTB 7ABPA 1WRBA 3FKII 3R40A 4R6XA 4YALA 3L0BA 1J8YF 4YROA 5JC8A 5FLMI 1RI2A 2ZROA 3QGMA 4RZ3A 4ZAYA 5KNBA 2P9FA 1NFFA 1V2GA 4EKYA 3ABOB 2HD4A 3O8LA 1AQIA 1E2NA 3WLLA 1UP6A 4D25A 3VHQA 1QE3A 2DR0A 5FBWB 3GIDA 5CVUA 1AV7A 3KR0A 2J5KA 3KAQA 2KM1A 3LL4A 1Z7GA 4R81A 4W63A 2XADA 4EHLA 2K5UA 2Q6IA 3BD7A 4POAA 5KSWB 1OGYA 2AKLA 1ZQ9A 4LHXA 1NE2A 4J2TA 3G8CA 2FPPA 3DOUA 3TSWA 1M2HA 3SKXA 4ND1A 1NASA 4BQFA 5CBPA 1DFHA 5DRYA 1UXOA 3JTEA 1WBJB 4OHPA 1H3NA 4ZRMA 1SM4A 5A0FA 3T99A 4TVSA 1XU7A 4GQBA 3L43A 2Q07A 5UKDA 3HS3A 3R41A 5AO9A 4EDFA 3G59A 2HADA 1OQAA 1U7HA 1FDOA 1VI2A 2W2QA 5IAEA 2A9VA 2WINI 3B1WA 3I5AA 5BSTA 4C6SA 4S1TA 1TMKA 4N5DA 5KMGB 4RY9A 4LVCA 4MUBA 3PQ4A 4KWEA 4ERNA 4WLFA 4QARA 1UMKA 3M34A 2QD2A 3ZK8A 2VFAA 1FL9A 5A6VA 1H2XA 4RX1A 5KNCH 4I1IA 2O7RA 2D7DA 1YRLA 5I4BA 2OTJZ 1RXYA 2D7JA 4YRDA 1FP2A 2BKEA 3NT5A 2D2IA 3L7YA 1M1NA 2AHRA 2O8VA 1V8BA 1DWUA 1U7XA 1DUSA 3BWDD 3ZQ6A 4INOA 4AN0A 2I6SA 1BEUB 3JASB 1JKXA 1QCCA 1U8TA 4N76A 4HQ0A 3EFOA 1UJBA 2EERA 3EY9A 2D8MA 1GKLA 3OE7D 4HOYA 5T7BA 4IHJB 2FWAA 4GP6A 2ONCA 2OO5A 2ZSBA 3IT0A 1XU4A 2WD7B 5H59A 4BYGA 5IH3A 3R3SA 1ZD1A 3U3KA 4CLEA 2ZULA 4N8EA 3GCFA 3COZA 2AB0A 2JZCA 3KQUA 2FWNA 1K0UA 1PZXA 2V7GA 4GYYA 4B4DA 1Y6FA 5DO9A 1Z38A 1LI4A 1M1NB 3AEQA 4Q1AA 2FGJA 1BNCA 4MROA 2VUGA 2OQVA 1V8PA 5A2QA 1TYZA 2HRCA 5FOWA 2OG2A 3LKZA 1W7AA 3JYPA 5EINA 3LX4A 1C1DA 1S721 2BGMA 4LHSA 5IVIA 1AK1A 2OHXA 3ROFA 3SS9X 1TZJA 3UUFA 1NF8A 5K6AC 2XJ4A 3GTOI 3GAZA 4QA9A 1SZJG 3U61B 5JMOA 2QNRA 4JAVC 4E5UA 1WUYA 3EF1A 1HMPA 2FFAA 2IYQA 1JB1A 2X6QA 4BAGA 5ICSA 2GESA 4ZP1A 3VMMA 3AUFA 5BNIA 2ZBRA 3BORA 1E3IA 1YS6A 2WZBA 3A2MA 3SC4A 3ICCA 5BN1A 3UYKA 2WQ6A 1Z74A 1U0NA 1G55A 2RONA 2HF2A 4B6EA 4YAIA 5IKXA 1AQYA 3KUKA 2VC2B 3NAGA 4XR4A 4IL5A 3UGTA 1J20A 3HKCA 2YWBA 3FWPA 1XQ6A 3GVXA 3T7KA 1WPRA 3EDOA 2JD1A 3ONDA 4LCBA 1G3MA 1KO1A 1VKRA 1P9RA 1SK9A 3MHTA 4ZVSA 1YZYA 4J49A 2ORVA 3D2BA 1IZZA 2RGGA 3ROQA 4MD7A 1XDZA 5A4FS 3FVRA 2JJMA 2C4VA 3NONA 2CXQA 1P2GA 3ZWMA 1ZD4A 4DMGA 3HXOA 2P0EA 3BIFA 1IB0A 4WK0B 4NI5A 3ROPA 2JFQA 2DPMA 1WW3A 3CX8A 5KWJA 4FQ7A 5GIOE 1EGAA 4HDKA 3HXKA 1XXHA 4JMPA 2JH8A 1UQTA 4HH1A 4Q39A 4Z1MA 4ZKDA 1E2GA 1TFUA 1DBRA 2PM9A 1QB7A 3CRQA 3T4XA 3VR2D 5EWMA 4DLAA 3ACCA 4D9IA 3KYIB 4YAJA 1QANA 3RS2A 3ER9A 1POXA 1UDRA 1GZUA 1TM2A 1E5QA 1N5KA 2WU0A 3UPTA 4MZDA 1V37A 4LZAA 5CFNA 4KAFA 1RWNA 2YHBA 3GHHA 3ETEA 3IDQA 1GLGA 5E9QA 5KNBH 2PTHA 4IIVA 4RQTA 4HYQA 1XDBA 1GTRA 6ABPA 2QM7A 3UV7A 4OBXA 4IO1A 5GV8A 3IFUA 2BFOA 2H16A 2BJWA 2H9YA 1G8JA 2O3TA 1MFPA 2DTXA 2F3SA 2D2XA 4JEMA 4D26A 2HK7A 3FHJA 4MQLA 3IV9A 4F96A 2ZRJA 2X2EA 2FZEA 1TQHA 2EJWA 4DLNA 4KMSA 3ND7A 2Q50A 4POOA 1RLMA 3NTUA 3HEMA 4HQ6A 2R8YA 1D2HA 3HA5A 4ZVNA 4BNZA 3ADDA 1KFCB 1JAZA 2BELA 2G07A 2VL7A 3A4IA 4ZU1X 4KSCA 5FUXA 1M2NA 1ODSA 3RT9A 5JAMA 1M3SA 3N8IA 4BO1A 1UCFA 1UOEA 4JQSA 4CKEB 4Q82A 3AF4A 2P5YA 2J09A 4RQUA 3C3MA 1AM4D 1KFKB 2EX4A 2EGUA 2A5JA 2H07A 3D8UA 5BOVA 5AW5A 4BKQA 5DXFA 4KITB 4H6WA 5BW8A 4N41A 1SQ6A 3A4LA 3GUVA 3JWPA 3K2QA 4X1YA 5EUCA 3EEDA 1BXGB 4C5AA 4URHA 3VPDA 5AVJA 2BHLA 2OYCA 2PUFA 3E9EA 4YJGA 4U6QA 1CJUC 5FAKA 2J45A 3CMEZ 3PGLA 2NO9A 4G4IA 2RB4A 1T6BY 3E4DA 3PC4A 4FUTA 4RVNA 4A2PA 3S1SA 2P4HX 3QBEA 4CM8A 4CT5A 1XCMA 2G77B 1O8BA 3KU4A 3P4UA 4Q3LA 4XWAA 2IXEA 4A4DA 4TROA 3ZZTA 2DQYA 2Y0PA 4H6XA 4ARIA 5EEGA 3W5UA 1ADYA 1OOEA 2SKEA 4MA5A 5NLLA 1WF3A 5DBEX 3GFVA 5IT4A 4HG2A 4K2AA 2M98A 3O1IC 5IAJA 4KW7A 1DWPA 3L7CA 5SYNA 4UHBA 4OFZA 1OH5A 3CNHA 4X95A 2VO1A 3FTFA 1ZJ6A 4N65A 3KWLA 1TGYA 3FMFA 5L8VA 4YCSA 1NT4A 3V46A 4A23A 3BJMA 3K0SA 4AECA 4OGLA 1P3DA 1RXCA 2EJTA 4Q9HA 4UBMA 5HRCA 4JLDA 1PVOA 1G8KA 1OBOA 5EHQA 2GEBA 5A0TA 1VGRA 3CH4B 3CCQ1 3G17A 2OK8A 5DNVA 4F04A 4Y2RA 3DF7A 3P9QA 1FYWA 2VP9A 4AZ0B 5AKYA 4JBHA 4YV0A 5M5BA 1YS7A 4YUXA 4H2DA 1L4UA 2OCGA 1PU2A 1FFXB 2CW5A 3BQMB 1HL3A 4DQUA 2ZBUA 2PA0A 4EO9A 3EDMA 4D3ZA 3OF5A 5FTNA 1LF0A 1PYGA 4ZHQB 5B6JA 4E4TA 3TKLA 4LYAA 5THXA 3GGDA 4JJKA 2WOJA 3EGDB 2QDXA 3R4VA 3R6TA 2IOYA 3UAZA 3P9RA 4IF6A 3NKLA 2PNJA 3RODA 2O4CA 1PQUA 1WXFA 2W9XA 4TV8F 5BT8A 3VR3D 1T8WA 1OJ7A 3SN6A 2A1TR 3BL8A 3SE0A 1JKMA 1WEKA 3M3HA 2QTRA 4EMSA 3ESDA 3UOWA 4J75A 3KO8A 3F98A 5CDFA 1P5JA 3IKMB 1NZJA 1UK8A 4HNAA 1EGHA 4O2LA 3NOOA 4LC0A 2QMOA 2XVZA 2Z8XA 3BSFA 3EIWA 4HRYA 2ZR9A 1KQ3A 2YRWA 4J91A 3WK5A 4EHFA 4N7JA 1RAIA 1VI5A 4GBJA 2X22A 2NT3A 4CMIA 1BKSB 2X5NA 2WU1A 4YV7A 1DI0A 4I3HA 4I5GA 3E8MA 4NK4A 5A4KA 4ECAA 2EJCA 3PHCA 3PYXA 1JG4A 3IALA 5HCUA 3QH4A 5JDCA 1BFUA 1BWQA 1OA1A 2PO7A 4EA8A 2CYAA 2LWIA 4MV0A 2EP8A 3LBYA 5AKLA 2UZ1B 2AXEA 3KLBA 3OLXA 3SBEA 4BVJA 1K98A 3KKMA 7AT1A 1Q2UA 3SYLA 3EXHC 3NX4A 3WKEA 1OKKD 3RIMA 1XC7A 5CG1A 1D0VA 1RWKA 4X3OA 4RGVA 4QYIA 3ZWYA 3SYMA 1HNWB 4AS1A 2W6PA 3NHUA 4GP7A 3MBOA 1U63A 1Z8NA 3AI3A 4CLOA 3QM1A 3IA2A 3JATB 4LZJA 4OBWA 1T6ZA 3KBOA 1XHEA 4YI5A 1IM8A 3V2UA 4EYKA 2PL1A 2GJKA 4GLOA 4URWR 1N0VC 3C3XA 1P9WA 2AE1A 2NZ2A 4FQ5A 4P5EA 4U2EA 1B74A 2X0FA 4D9EA 4S04A 4XJVA 2V7XA 3R3HA 4TLEA 3LYUA 4WCVA 4ZT5A 1CZHA 2R0QC 3KIHA 3VX3A 3KVVA 4MDHA 4LWZA 1W4ZA 4HJRA 5HP4A 3REQB 2B2XA 4JT2A 4GVLA 3PHHA 2R4QA 3R1IA 2ZWAA 3K9LA 1ML8A 3JZFA 5E1DA 3UC9A 1RQGA 1RP7A 5HCNA 3SVTA 1C9KA 4GMXA 3IMFA 1RC1A 2CF6A 2WZCA 1B2LA 4TXNA 4X8HA 3GJRA 5TRTA 3W5IA 1QCYA 4M9CA 4MYTA 5HDQA 2HU7A 1TUIA 2DP4E 1L5QA 2OXFA 2ZWIA 2WF9A 3HC7A 4EVSA 1TRHA 1I30A 1OLXA 3HYSA 3PPXA 1KP3A 1SBIA 1XA0A 2ZPUA 1HKUA 4Q3BA 4MV7A 1PR1A 1MW9X 3COVA 1TQ8A 3UH0A 4BRZA 4LQLA 3L0SA 4FYXA 3CUWA 1Q12A 3IJRA 3W9UA 4E11A 2GHTA 2R6ZA 3R44A 4O4IA 3QPWA 4ABYA 4MPRA 4R1QA 2XUZA 4R71A 2RGBA 2GO7A 1A2OA 3L6RA 4MSUA 2IW3A 3H9BA 1N9KA 1SHLA 3E48A 1L7XA 5K3FA 3ORFA 2WWXA 1KYIA 4PGGA 4XGRA 3PE3A 3ZDXB 1YQTA 4MUAA 3T7JA 1ISJA 1HQKA 1Y0BA 4HRVA 1TAHA 4LQDA 2QTNA 2VAMA 3ED5A 3UMYA 5C4JI 3Q8MA 1SPXA 4GRAA 1IXSB 4R8KA 3NV9A 4B0OA 4AUEA 1GSAA 1H4TA 1N6HA 1RXSA 3I5XA 3R75A 3G5UA 5THKA 2WWWA 5DCYA 1DDGA 4C0XA 3MB5A 1O7JA 3MTBA 2A78A 4XIJA 4JBIA 1Q57A 3HI6A 3G2HA 1U8EA 2XNJA 4I9FA 1XX6A 1BYUA 3V1TC 3HSKA 4Q9KA 2G4LA 1U98A 4Q37A 4D82A 4K6GA 2JGDA 3F5MA 1RHUA 3T7IA 3IUPA 3JQFA 2YYZA 3TOXA 3DOHA 3AF2A 4PG8A 3IQXA 2GZMA 3TYXA 2DBZA 3HOYI 2EFCB 4H4EA 4N7MA 2Q7DA 1C7EA 1QLHA 2G09A 2JK1A 4PCAA 3KG2A 3I2GA 2PL3A 1X1EA 4JGBA 4NSNA 4P4GA 4R2HA 4ZODA 5AVOA 3U7HB 2RARA 3HJUA 1SVIA 4YHBA 4W5QA 2P41A 1T9ZA 1C9EA 4EFDA 3O7MA 1IHOA 3JWJA 2QN1A 5KTKA 4O5OA 3WG9A 5FLXf 3CXCZ 1K8A1 1F8GA 4XR9A 4D8XA 5JYDA 3VHXA 1MAUA 1VJGA 1J5XA 4YK7A 2QRLA 1IVNA 2XV1A 3KKQA 4KV9A 5F23A 4KXLA 1SVMA 1MG5A 1OVMA 2X76A 3ABQB 4TLDA 3UB4A 1J06A 4B2LA 3S2FA 4CM9D 5J43A 3EVGA 1HPLA 1XDSA 2FN9A 2YJ4A 3R5FA 3ADCA 4EYSA 1WXHA 3K15A 4H15A 1M8KA 3OCJA 3IQWA 5A03A 3UMCA 4L3OA 3V2GA 2XXAB 2HYIC 1Z3IX 4JXZA 2XODA 2X1LA 3JQAB 2XB8A 3T12A 3G711 3RJ9A 1SVKA 3TZ6A 1DBIA 2GNOA 3OWHA 1I7DA 1JILA 1NNEA 3LTNC 4BPBA 4JLPA 1PS0A 4HWGA 3G9TA 1FLDA 2E3JA 1U31A 1RVDA 3QWBA 1GGHA 2F90A 3ASYA 3E53A 2Q6VA 4D44A 1RLJA 3IIJA 1FQOA 1JALA 4NFYA 2G63A 3RGWS 1JMKC 1WA5A 2RHOA 3ZHTA 1C29B 1R4MA 4QUIA 1I4EB 1Q0LA 1EUYA 3H11B 4DWWA 1NUQA 2WWIA 2H57A 1M8GA 5I3CA 3H5VA 4M1TA 4JQYA 3NDBB 1QPZA 4OI1A 3AUAA 1SVUA 1LKZA 2B94A 2WTAA 3A3OA 5AXBA 3J7AC 4JZKA 4RV4A 3QEJA 5IKEA 4A3CI 4M0PA 5JEDA 2FZVA 4C76A 1JECA 3P4XA 2G83A 1IJEA 3OZFA 4YMLA 3D1JA 2QDKA 2ERXA 4F3RA 1EQ2A 1KGSA 2WTXA 4FGUA 4XASA 3SZLA 3U4QB 2AJCA 4IQFA 4XPZA 1MGOA 4MNTA 3MUEA 4CLDA 5T3UA 1D0SA 2QX8A 3H1FA 5ESRA 1CZRA 2ZBGA 3BGVA 3KZNA 5F5LA 4TYNA 1CP2A 4A16A 1J9ZA 2O1WA 3NYRA 4QUJA 5LU9A 1KGDA 3QW4B 1N32B 1TAGA 2HRDA 1P2SA 3KYDA 2K2WA 4P31A 1KQPA 1XLVA 2H5EA 3H2IA 4EFLA 1HQDA 4WDQA 1YJ91 1A9QA 4PXYA 2H1SA 1VJTA 5ENDA 3JQ7B 4RGBA 1I3MA 2GBGA 3V8EA 4XFKA 3ZCTA 2WE8A 4JH0A 1KORA 3O7WA 5HDBB 5KJ1A 2DUWA 2IT1A 2R8PA 2R6GA 1SNYA 1VPLA 3ANYB 4BJ5A 2FOXA 2WRZA 2XMSA 1WMBA 1Y1VI 5IABA 2OXTA 4G84A 4A0RA 1XZFA 2J3HA 1VQOZ 1L4EA 5DF1A 2CLFB 1KYWA 2O8EA 3K6KA 3LI2A 4MJXA 3CVYA 1XCBA 3L46A 1T29A 2JHAA 4PNZA 4JXXA 4PAOA 5C7YA 3L7LA 4K9MA 1NW9B 2FDRA 2HA3A 3HP7A 3HOWI 1L4HA 1I7PA 1CNMA 2ZANA 1CUFA 1T15A 2RJNA 1K86A 2VNSA 4XARA 4M86A 3P26A 3WKDA 5I7HA 3EUAA 1Z7EA 4BCCA 2R68A 2ZJFA 3T1HB 2BTQB 4X54A 3IQDB 5AIBA 2PKRA 4KQEA 2ZIGA 3DLCA 3TBKA 1IY9A 2Z57A 4KX3A 2JI8A 3ZW8A 1OHHA 4MLDA 4BEJA 4XSVA 5LMUB 4RF2A 3O8CA 2COUA 3SYNA 2RIRA 1HURA 2Q4DA 3BQ9A 4IF4A 3SC6A 2R62A 4NQZA 3GXOA 2AJBA 1UM9A 4RTRA 3J81k 4AYWA 2WVAA 2HF9A 3TUIC 1BCRA 5EGNA 2IFTA 1NYQA 1Y4UA 4WASA 1VHQA 3RF7A 1M74A 4WECA 4ARVA 2EBHX 1OLXB 1NI3A 2PMZA 3ORYA 5ALFA 1W76A 2B4KA 2D2FA 4H16A 3SWWA 1MLDA 3HHEA 4G37A 4HSEA 2XD9A 3RAJA 3E1GA 1CNFA 1DBSA 5JYCA 5KYWB 4JLNA 1CD5A 1ATZA 4J90A 1RRCA 5IYZA 3DZHA 4EEZA 1YJ8A 4CQMD 1C3OB 1HH4A 3P5BA 4WE3A 1V4VA 1MJFA 4WBNF 1K5DA 3SF0A 2OO5C 2CK3A 2IITA 4RSGA 3BRWA 5F2EA 4LY0A 4P7BA 4XVUA 3CZ9A 1UDWA 5KO2A 3EYAA 3MLBA 4FHFA 2RGNC 3NAZA 5AR1A 4QXRA 3VR6A 2IEGA 2ZRDA 4KFSA 1NJI1 2O2SA 1G8FA 5AUOB 1NY6A 1X9IA 1MQ9A 2O0KA 1C7QA 1CDOA 2IHTA 4KIWA 4OQ4A 1XP8A 2RH9B 1Y4AE 1IUKA 1RHJA 2SNIE 2ADMA 3ZY3A 2I6QA 4F1KA 2P4SA 2AH5A 5BWCA 2V0CA 3O4GA 5HNKA 4PAMA 1KQSY 1L1RA 3FPLA 3T3DA 1AZSC 4EJ2A 1RP1A 2AUMA 2A9QA 4WCFB 2XT9A 5D3ZA 4E6EA 1JG1A 5AW9A 3G6WA 3TTWA 1VLQA 1NBME 3Q2KA 3QLEA 1GNRA 5PNTA 3SLKA 1LBEA 1M34B 1AZLA 2ECQA 2OOKA 2UZ1A 3VAAA 5JYEA 4OX9B 3G1WA 3T8YA 1UIRA 2BFWA 1CIVA 5ERYA 5AOBA 4KFUA 4MR9A 1JT2A 2ROQA 4ZT4A 4YNBA 1E1LA 1Y8RA 3U3RA 4ZT3A 2EKPA 4IY1A 4YRLA 5HIIA 3IOYA 1QIIA 4BNNA 2F55A 1AUOA 2JFGA 2PKQP 3ENNA 2JR6A 3HP1A 1C8BA 5JSFA 3A6ZA 3CC8A 1RJDA 3PUIA 5CFMA 3IQIX 3ZNPA 1KQFA 1KRXA 4FMCF 1ESDA 4DV7B 1YA8A 2ASEA 4I46A 4BX3A 3HJRA 3NP9A 4X61A 3WNDA 1E32A 2I2XB 5I9IA 5EVCA 4IXMA 4FJ1A 2VPIA 4Q4JA 4UQOA 3SFVA 5JBIA 2BDEA 2B1QA 1UPAA 1EDEA 2OMKA 3TX2A 2V58A 1WABA 4PVCA 5CH5A 3AYZB 2KBFA 2XUHA 1QGUB 1RMQA 5D1PA 2QLJA 3OZGA 1U9IA 4H1VA 1TU3A 2AFHB 1A9TA 3FLBA 4JP8A 4K7JA 3T6KA 2XE8A 1BS2A 3FDZA 1FP6A 3B3JA 1D5CA 3AJDA 1GEGA 3PICA 4UZEA 1NW8A 1ADBA 1L7MA 1WY5A 3QVWA 1NQ5A 5F2KA 3ZLTA 4ZHQA 2PBRA 2I9PA 1LPSA 3CN7A 1NXOA 1JIVA 2B1RA 4PRLA 1CZNA 1OAAA 5EMLA 3U56A 4RGQA 4OJTA 3ZY6A 2O3SA 2HBYA 4C4RA 1YQWA 1CULC 1WXGA 2QQGA 3IC5A 3LO5A 1KJIA 2B8NA 3H2JA 3WRYC 2P6OA 4JJFA 3ON5A 4QEKA 1DHTA 2XTZA 2V8IA 1D2RA 3ZY2A 1VYTA 2IHZA 4U7GA 2JA7I 5HWSA 2BMWA 5IANA 4Z4EA 5AM3A 1L7EA 2ZRAA 2OFOA 5KSZA 5K0TA 1IG0A 4Z4QA 4DVJA 1SVLA 5L51A 3RVLA 5CIYA 2V6GA 1XMSA 3FOBA 1JKFA 2GF9A 3ITKA 3VH3A 3BE4A 1XFAA 1H2ZA 3UATA 4ETIA 3PEVA 3A9TA 4AIRA 4EM6A 1Y3IA 3I6BA 1D1TA 2Q9UA 3N28A 4WVFA 4PN3A 2H18A 4INPA 5E1OA 5I45A 1ZAYA 1BE8A 4TRMA 1CY1A 3EA0A 5KYWA 1DXQA 1S01A 3GK3A 2P3OA 4KN9S 1DOZA 3HRHA 4ZVOA 1MFZA 5IJXA 3UHFA 4B6QA 3EY4A 5DH9A 1ADJA 2II6A 1CVIA 1WXEA 1M1UA 1XSEA 3PVZA 3I4MI 2ZVJA 4K1LA 4TS1A 3UWPA 3EUEA 4JBXA 5G3ZA 5B1YA 5LZ4A 4Q7EA 1E2MA 1O3YA 1ZN8A 3OZ7A 4H3KB 3KT6A 1SBTA 3V5NA 1T2CA 2ZE5A 5I7EA 3VNRA 5EMNA 3SZ3A 1PQWA 2ZRHA 3ZGVA 1N2ZA 2D62A 2G3YA 2FWIA 1ECGA 2P6PA 2WAYA 3W4KA 4DXAA 3IQEA 5BSGA 4JYMA 3DM5A 5IU6A 2VDPB 1PW7A 4L95C 4Q5IA 1P6UA 2WYWA 3FZNA 3QHQA 1AKWA 1AXRA 1Y80A 4CM6A 1NLUA 4NTZA 4EWLA 4UNRA 1G6OA 3K05A 3EF3A 5LM3A 5K0ZA 5CB8A 1I13A 4PZEA 1VCIA 4QJIA 3HGQA 4ILEA 4RY8A 2Z3WA 3CPJB 4LAFA 4KE6A 4E88A 4X6YA 4DPMA 2PWZA 4EZBA 1EVKA 3EARA 1UXHA 3E0XA 1YMVA 3JD1A 4XWWA 2PLAA 1DKMA 1VPDA 3ECSA 3IAXA 4ZZ3A 4B3RB 4JXKA 5K0GA 3O82A 3BWEA 5ABPA 3HL0A 4GPEA 4JVOA 3CCU1 3T5TA 1GKIA 1IIBA 1H2AS 3WLAA 1RM5A 3DMDA 5CDFE 5A06A 3BGOS 3O3OB 2F4VB 1FJHA 1TTPB 3AUYA 5G4LA 5ES3A 1LDNA 1I36A 5CYOA 1C9MA 3CLUC 2QTVB 4O3MA 3L8CA 3TLCA 4KNYA 1C7ZA 4HBZA 2P0YA 2RH5A 2BAGA 1JSXA 1M8FA 2EJBA 3LPNA 4E31A 3U3XA 1A7AA 3CVWA 4EWCA 4ZZIA 4W7SA 3DUFB 4L22A 4BX8A 4PN7A 3U5TA 1G5IA 3GJSA 2C2OA 4GKVA 1X1TA 4OKNA 5LXTF 3SZGA 2WW8A 4GM1A 3DXYA 3OQHA 4YDQA 1N2SA 3ELDA 3GNSA 3OUZA 3FHTA 1UFQA 5HK8A 3BMOA 5CNJA 1QF6A 1MJNA 4GLLA 1SG9A 1LNSA 2ZKIA 4H59A 1GUDA 2G82A 2ZRFA 3IAAA 1KEWA 3GCDA 3TK1A 4OG2A 3I30X 3PNBA 4QUGA 1U5CA 4KDEA 4XD7D 4E30A 1F14A 3QEBZ 1J8FA 1FXUA 2A2ZA 3DWEX 1UZNA 3RLFA 2QOEA 3ZE2B 3PDWA 4LYDA 4BV9A 1XQ9A 3CRRA 3C85A 3FYUC 1ZJ5A 5DHUA 3FQQA 1U0GA 1DG9A 3CR3C 1Z62A 4EUKA 3BJIC 3DFKA 1R88A 1ORHA 1W5SA 4MUMA 5YASA 1NNLA 4BIMA 1DKRA 5AVRA 2Z6VA 4D41A 3GMTA 5A5EA 3VOTA 3MT7A 4OHFA 2WM9B 1G0NA 2H59A 4FGZA 5JE8A 3KZXA 3LXRA 5CAEA 3HBFA 3DCJA 3R0JA 4YBZA 1E0DA 2CXNA 2VZ0A 3JQGB 5DBOA 4EW2A 2C78A 3AX6A 3NAMA 1ONNA 1TDJA 1V96A 2IEZA 4G5YA 4IDAA 4LBVA 3QVTA 4Z2YA 3SHQA 4C6HA 5LJIA 4RTJA 3NHJA 3GPCA 3K09C 3LPCA 1GM5A 1DIOB 2HXGA 2I4IA 3JV7A 4YXFA 3RKRA 5BRJA 1B3RA 2I8CA 3BJRA 3MINA 4D4IA 2MR5A 2OECA 1L4GA 1ZIXA 2OWEA 1G21B 4N6GA 4LYYA 5D86A 4C9BA 4YRSA 1C0KA 3JASA 2VDJA 1BJRE 3COJA 3VUEA 5ARDA 2VDKB 5CIQA 3NKFA 4EG7A 1AUVA 1A7KA 3D6UA 1BJTA 4Z7JA 4MDFA 1MC4A 3R6WA 3KQLA 2Q6LA 1HYQA 3GX1A 3D6NB 1YE8A 3H97A 5BXQC 5L7YA 1CX9B 5TMDA 3U31A 5K20A 1SWWA 2HK8A 2ZU0C 2AKYA 5FI5A 1H69A 1ZZEA 4F5DA 2JGNA 4LI0A 3VPHA 2EZ4A 3E3AA 1R7RA 3LPMA 2CN1A 4G8CA 1VLAA 3WHIA 5MDHA 3EZLA 1ISGA 3HR7A 4YYZA 5FWNA 4UBJA 4JB0A 1QRRA 2AEEA 2ZRLA 3I5MA 4PAWA 2HLNA 5GAJA 4ZDIA 1ZGCA 3ZU2A 4W5RA 1A5AB 1USWA 2FSUA 2ICAA 5GIPE 2YWRA 4JUAA 5BQ5A 2N46A 1NOKA 2OBMA 3R76A 4AMUA 4CODB 3WRXA 3IQZA 5AM1A 2V45A 2PZLA 4LUCA 3JRNA 2LIYA 4KX5A 5ERGB 5J4LA 4WZAE 4QPZA 3P0RA 2IYEA 3FKSD 2BV3A 3TZKA 4ZO9A 3KT3A 5I8PA 5I7UA 2BR5A 1XMPA 1CYDA 2BW0A 3M9XA 5M3BA 1YC5A 2BP7A 4CUKA 5G02A 1T2NA 1PDVA 4E5MA 3OG9A 3WWYA 1YOVB 3DBHB 1K9VF 4Q1EA 3NBMA 2I55A 1R6XA 2YJZA 4UDXX 3DMGA 4MCHA 1W5TA 2ZREA 3AKYA 2BEKA 5IFKA 3CPWZ 5CM2M 1E1CA 1PTJC 2QTVA 3CCS1 4C3UA 3OI7A 3II6X 3TVTA 1R4NB 4LRYA 3NJ4A 4NV0A 3DDOA 1RPAA 1VCHA 4JI3B 2QSJA 1UPXA 1QNLA 4MAAA 1PVVA 3LLUA 1U2RA 3BCSA 4KDRA 1CJTC 1YCFA 1UOOA 1DP4A 2HEGA 2QRUA 5AXAA 3ZNNA 1OX6A 1R5JA 2OQ2A 3LKDA 5EPEA 4UJ3A 2Q9CA 4CHTA 3RKUA 1VLZA 1QS0B 2DT5A 1PEKE 1ZH4A 1XLTC 2ONZA 3RUCA 1UZUA 3MQ4A 2GN8A 2DETA 3JQBA 3DNMA 1NVXQ 4DQYB 1QR2A 3TPCA 2YMMA 3SJCA 4TN1A 3VRHA 3CNEA 1CRPA 3GI1A 2VF8A 1LK5A 2I2FA 3FPGA 3JATA 1RPTA 3T0IA 3ZI7A 4E5NA 1A27A 2E2HI 3B1VA 3CC2Z 1X8LA 2IZ0A 1PGPA 2JF0A 3NASA 5BUZA 3GT0A 5J3JA 2VPXA 2DBYA 1VCOA 1H9BA 1RPJA 5AKHA 3H9CA 4UEKA 1XMQB 5FR1A 2R25B 2QRGA 1X8XA 2X8WA 4UFOA 5AW1A 4ZN6A 3WDMA 1TJYA 1TC1A 1WBDA 1FDTA 4EY4A 1BHJA 2ZT7A 1ORTA 2XB4A 2WA2A 3D8HA 4MCAA 5AJUA 1TQ2A 3V97A 5I7FA 1T9HA 3L8YA 1Q22A 3WJ1A 3IS3A 1TI7A 3LG2A 4ZOCA 1A2QA 1NR1A 5GJCA 3ZGNA 4WUVA 1G4HA 2N3ZA 3DBLB 2OBFA 3EIOA 4MUEA 2XXJA 3TDMA 2GF0A 3UT5A 4F2PA 1RI3A 5LUBA 1EX7A 1T0JB 4TKUA 2VZEA 1M6VA 4PYRA 5EJ9A 1O96B 4R2JA 5E8RA 4F9FA 5KTOA 1QJ4A 3QMPA 3ZU5A 1CDZA 1U1GA 3F8TA 1PFQA 2JA5I 3MIZA 4KI7A 5CM8B 3A4MA 4AXXA 1ISSA 5A5FA 2E6KA 3R74A 4F6RA 4I19A 4OQEA 1TGVA 4Z86A 4G0NA 4CR6A 2PUAA 3ODPA 4OAOA 2J46A 4P3KA 2QUBA 3AERB 2OGZA 4U9UA 1FUYB 3T3HA 1A9ZA 1F5SA 5H02A 1EFKA 3PXGA 4D4JA 1R00A 5D51S 2X4GA 1G5QA 3OEYA 2HQOA 4LJYA 3VTAA 3QV2A 2CXUA 3T7EA 3FZYA 3R7WA 4J2OA 4RDHA 4Z8YA 3OX3A 2JIRA 4KQ9A 3AI2A 1O0CA 1QHHA 4JB3A 1UM8A 1JQDA 2Q0XA 2QI9C 2CUNA 3TMYA 3EVFA 3TRIA 1ZM4A 3OO1A 1BZYA 4XYGA 3F3FC 3NVDA 4YP1A 4QPNA 1QO7A 1X1AA 1V11B 1V9SA 1S89A 4PIMA 5FBZA 4QYSA 1Z5GA 2XRYA 5BVGB 2D1FA 5T6MA 1WPQA 2Q3JA 2ZCVA 4HI0E 2Y1LA 3MRSA 3VFDA 4AJEA 2IC5A 5TF0A 4AIIA 1WHSB 4CV1A 1TCBA 2L82A 3QWFA 2YFHA 1DHRA 3EEYA 4PX9A 2Z58A 4J4HA 1RD4A 2ORWA 3EZ9A 3N87A 4KBFA 3PRYA 4PG4A 5AHWA 1NF9A 2GRAA 1E2BA 6Q21A 1VBKA 2HU2A 1O87A 2QUHA 3GH1A 3AERA 3V8NA 2PR2A 3PGXA 2UYOA 4HRXA 2ZYTX 4N0DA 1JXOA 1SBYA 4DCSA 1JYEA 3CEAA 4RYLA 3JPWA 1K3TA 4IUDS 1PFWA 2F43A 1UBSB 4HZIA 5A1JA 1T6YA 1QG2A 1J42A 1Z2PX 2EVWX 4B48A 4DA6A 1JEOA 4XIIA 1KTIA 3TDKA 4YQFA 2XB9A 5J5CA 1NA5A 4LOIA 4Q00A 4NAVA 2R8EA 3R3ZA 5K99A 1ZIDA 2A1UA 2NYRA 2PNFA 3I6ZA 3GG9A 4LV6A 1ZJYA 5LKAA 2ZRKA 4ZTUB 3SZRA 1ZR4A 5DZSA 4IJQA 2IE0A 3DWGA 1FVOA 1IRIA 3AFHA 5BW6B 1UKZA 3T4PA 4EABA 1S3SA 2AN5A 2NTNA 3DBIA 3KSDO 4YO7A 3U49A 3K70B 1ZVQA 1ADCA 1VRVA 3B6MA 4TTVA 3CC7Z 2CEKA 3I45A 5EAIA 3VKUA 4NBFA 1YUMA 4W1RA 1C80A 4CMKA 4ZYUA 1UWLA 2DE7A 1FTSA 3VNUA 3E3OA 4PS0A 5K6RA 3FR7A 4DNXA 1LV8A 1Q7BA 1Z6AA 3AFNA 4KMMA 1XAGA 2FRDA 2Q2OA 1U1IA 1ZW1A 3CG0A 4UBIA 3ROZA 3ZWDA 3KQTA 2GO1A 1GY8A 2R6DA 3GEHA 2OTJ1 3E82A 5DMHA 4CFSA 1KZ7B 1AJEA 1WDLA 4HS9A 3IMKA 4MW7A 2CJFA 1EUDA 2HHAA 2HL6A 2WOOA 3MMPA 4IWNA 1JQJC 4XE5A 4F12A 5J63A 5GGYA 4U5XA 2HYDA 1OFTA 1X74A 2B30A 1AG9A 3PITA 4TMZA 1NVVQ 1X80B 3L79A 3MGCA 3O3NB 3QG1A 4MULA 4U9IS 1IOVA 1TUGA 4ARAA 4KR3A 1DBVO 1UBJS 3VI3B 2CUZA 1EVLA 2I4NA 3O5AA 4Y6GB 5CLFA 1Z08A 3F6SA 1KHHA 1Q15A 3JWEA 3KYCA 4UEQA 1AKVA 1EA7A 1SCUA 4MUFA 3MT0A 2TECE 1TVEA 4EBBA 3NNDA 3DQZA 3EHDA 4DDHA 2WG2A 4MVJI 5DT2A 4XWGA 3M82A 3G89A 4ND5A 5FP0A 4PHFA 2RKOA 3NBZC 5EL0A 1FSZA 2ZUCA 3VC2A 1JR3E 3HTXA 4DSZA 1XKXA 2DKOA 3OW2Y 3MERA 4ZCTA 5DDIP 3O8RA 2B20A 4HFRA 3U44A 1BYIA 2FSPA 1HDOA 2ZJ2A 3GJ5A 5E0OA 3RVOA 3AVXA 1PVDA 3PTAA 2F1OA 1RKXA 3ZUGA 1F0NA 1NJFA 5LMCA 3JAMf 2WQ7A 2WJJA 3HM9A 2JKVA 3QNWA 1PFVA 2HWXA 3BC1A 4XH9B 3HYLA 3ESAA 1NU8A 3DEAA 1D4ZA 4GEKA 3MBKA 5JZ9A 1C0LA 1J8QA 2JA2A 4WBNB 5CR9A 5TIIA 3IVXA 5FXMA 4LPKA 2FWPA 3MPUA 4UMDA 4ITVA 2KWIA 2M6RA 4LYGA 4P92A 3E3MA 4KXYA 4A6DA 1GPH1 3GELA 1KYQA 1IJFA 2F67A 2E2II 3G0CA 3H3XA 3OPMA 3VR6D 5CFRA 1QZZA 3KPWA 4UEJA 1SCBA 3HYCA 4KQMA 5E6RA 2PKWA 4RNDB 3OF3A 2HA7A 4PLTA 3BJEA 1TW2A 1B6SA 1VE7A 4EOGA 2EQ5A 1DC8A 1G17A 4TTTS 5F76A 2Q1YA 4MIEA 2A92A 3NH4A 4I66A 4Q93A 2NUAB 2WAMA 5B6PA 5KYUB 4TT3A 4Y3UA 1VJDA 1FUIA 3H19A 2AJTA 3IODA 3NRCA 4HH4A 1G41A 2EKZA 3LPDA 3U9TA 3LO8A 1G3QA 5C3MA 4V02A 2VNKA 1YIT1 3G82C 4G01B 1WB4A 4IIGA 4UBLA 3IIIA 3A9WA 1LEHA 3AY7A 4INJA 4QYWA 3HK2A 4LF9B 3VPBA 2I91A 1Q811 1QXFA 2G9QA 4CKBB 1HNZB 1TYDE 3PJGA 3PQ2A 4QQFA 3EVEA 4KDFA 2CBZA 1VE3A 2I66A 4IGIA 3COYA 3DLHA 3WWEA 2AEJA 2WF8A 4B71A 4C4XA 3RAGA 1ZVJA 3G4SZ 3I9OA 5KNCD 1E7WA 4PHCA 5H16A 1CUYA 1OBFO 1I1OA 1PJTA 5FBLB 1U04A 3C45A 3PUKA 3RPEA 2Q5EA 1ZGAA 4IHJA 1Z68A 3FGPA 1QM5A 3IHTA 1KRWA 5IJ9B 2A5GA 3D3WB 4M3NA 1EVZA 4AWBA 1LV7A 1VE9A 6REQB 3KQYA 3BTOA 3R0ZA 1O4VA 1IK4A 3JYLA 4XCQA 3QFTA 1TJPB 2LRHA 3EZGA 3QVUA 4ZIRA 3MTDA 1Q1AA 4C2TA 2WJWA 2ZEJA 1NSFA 4B6RA 5TGZA 2FN7A 2QJWA 1Y1TA 1IL0A 3QYFA 4BFVA 1YJNZ 3VSEA 3OZCA 1LDBA 1W52X 4B2IA 1RBZA 3TCNA 1S8NA 5AJHA 2RCNA 3THWB 7MHTA 1JFVA 1SXJA 3C1OA 4TKLA 5AJZA 1Y48E 2R4TA 2IOHA 3HWX1 1E2LA 2JW5A 1C1XB 2SKDA 1G8AA 2Q6TA 5IDYA 4ZCQA 4J16A 4B3HA 1ST2A 5CMLA 3FSEA 1N25A 2Q0SA 4RAQA 1GILA 1KEEA 4FB4A 1O0SA 2PIAA 5H3HA 3IEUA 1LWNA 3VDNB 4DR7B 5FYDA 4EG8A 3ETCA 1E18A 1FU7A 1VFPA 1G59A 4R9RA 4QUHA 3A3PA 3ZWNA 4BVKA 2EEZA 5CM9C 5LA6B 3GQBA 3D9XA 3W5BA 2XOKD 1B93A 3DDHA 1ID1A 1KTVA 2J9FB 1KOFA 1NI4B 3ILXA 2HHJA 4X7BA 1U7DA 1QC5B 3ONWA 1HDIA 4MLPA 3HLYA 4TYMA 4DMCA 4BQOA 1VSTA 2F48A 2HB6A 3DW1X 4UXIA 3EPRA 3HNPA 2B4YA 4Z9FA 2V0GA 3RRYA 5EHIA 3DUFA 1YV9A 3WLQA 1NATA 1FRZA 4A3II 2W2LD 5F78A 4HLUA 3O3MB 2F62A 3CUSA 4P08A 4R2MA 5DHSA 1HV8A 3GCGA 4EG5A 1L8OA 1HQYE 5BR4A 2N75A 3FLAA 4MAFA 1R2QA 4RW0A 2XDQB 1KBQA 2IVZA 2NPOA 3MGKA 3Q40A 2P9GA 4RF3A 2ANBA 4NBRA 3HRIA 3FCYA 4OB8A 5ED4A 4YMHA 3AC0A 2J41A 3VJKA 5COBA 4GOJA 4YX9A 5FV4A 4YP9A 5BOSB 1N5OX 1NSYA 2PANA 4B4WA 4G0WA 1Z06A 5DSXA 2ZAEB 4G1CA 4ZYYA 3AFMA 2QEX1 3P9KA 3UQZA 3OD5A 1SN7A 4D3FA 1I2MA 2HO4A 3AZOA 3JZAA 2AK2A 4RVFA 4GOND 4PZPA 5KDLA 2PSSA 5GOZA 4AY4A 3HQ4O 3N8HA 4BEVA 4D96A 2IY9A 3NHWA 1XVAA 4MI3A 1QGZA 2CHFA 3E15A 3BICA 2KPIA 4KQWA 2V9ZA 5DCWA 1Q1ZA 2VTDA 4BGIA 1IEWA 1CT9A 5IDXA 4TYYA 3PI7A 2BTOA 2Q3CA 3GJ7A 4P3OA 1D6JA 3M4XA 1FMJA 3PD1A 3MOIA 2QD4A 1BAPA 1E98A 2IP1A 8LDHA 5FNZA 1XNQB 4B32A 3UXHA 3B85A 2BJVA 1DJQA 4EARA 4HUTA 5BVGA 1SK8A 3IB3A 5EJGA 3T5DA 2WWFA 1SCKA 2IU0A 1ETHA 1QP0A 2J6HA 2Q3LA 1LSUA 3N0VA 4L7QA 5AW0A 2ORIA 1ULTA 2PZGA 4HTFA 4ZCSA 5CB6A 4JDPA 1X7WA 1CZOA 4NZ9A 3ZE0B 3P9PA 1ZMBA 2R6R1 2W42A 1SXHA 1Z12A 2F1HA 1EXNA 2X3UA 3C2QA 3P8ZA 3IPRA 3RV3A 3L1VA 3ZXIA 2E2JI 1YVPA 4MWZA 2O1SA 3CCUZ 3BTSA 3DBOB 4LJRA 3ODGA 5C1DA 1YASA 2PUDA 1SEVA 4K9RA 1GLNA 1WIWA 2R97A 2HIHA 1KC81 3MS7A 3TQRA 1IPFA 2PSEA 3FTCA 3SIXA 1J7KA 5ESWA 2GK6A 1SHZA 2X9GA 1VXOA 4BBAA 2GD1O 1ESCA 3RANA 3ZWQA 4OREX 3EVDA 1VL5A 1IRXA 1XHFA 4WLEA 1P19A 3FYUB 1WMSA 3F6EX 4KJXA 1THGA 3BH7A 3LQYA 2EFYA 3OLQA 3QBVA 3QUAA 1QYVA 2JLSA 1FDWA 1RO0A 1SC3A 5A9SB 5AW4A 1YK0A 2X40A 5DU2A 1I2DA 3SEFA 2RK4A 3V1KA 3H0EA 4Q9DA 1AKQA 3P0JA 3PFWO 5JS7A 1B6RA 1E7YA 4QLOA 1N1MA 3NDJA 3WC4A 2Z08A 2P62A 2F9MA 4TZ6A 1GOTA 3GFPA 4QU5A 2HQRA 2WSBA 1E58A 5H82A 2XYGA 1IN8A 3MC1A 3RRFA 5D3KA 3HCNA 4ZJPA 3NNNA 4OQXA 4B7XA 5EC8A 1YMQA 4CG1A 1G66A 3WFJA 4AJ1A 1I6WA 1TVKA 1VJ5A 3L4SO 5A5VA 5EKXA 2C83A 1STOA 3NXKA 4I5DA 4EPWA 1KJJA 2OXCA 2XNDD 1AKNA 4JQCA 1REQB 3MRVA 4QXMA 3GGGA 3CSDA 4BDSA 2HT6A 4EJ6A 1F2TA 1T8TA 1IK6A 1S2DA 1WCWA 1Z4QA 1EK5A 5AQ1A 1AN0A 4FEEA 1EYZA 2GXUA 3D8SA 3CJTA 3GTLI 3DAGA 3I9JA 3OU7A 4Q1FA 4QO7A 4GZ3A 5DTMA 3U3OA 3DULA 1M5TA 2G5CA 1FFGA 1YRBA 4UNSA 4GUAA 3JQ9A 4HNAB 3SCZA 3EXFB 3ZXUB 4DV6B 3EPPA 3K9HA 4P0TA 1AZWA 4MCIA 2X0DA 4F6LA 2RE8A 2I3AA 2YV1A 5T67A 3WBBA 3PPIA 2V65A 4BTEA 1PL6A 3FPSA 3PIIA 4LK2A 5LDGA 2FWMX 3H75A 1ECPA 4DIMA 5JAPA 1RKVA 3WMFA 1V4BA 1W4LA 2H3HA 1WZIA 3E7XA 1HF3A 4PZZA 3VO9A 1IBKB 1P7YA 1U2PA 4L4ZA 4A8HA 4FJ0A 3QXHA 3ZVKA 1GZ7A 2IYOA 1KPHA 2LGJA 3K8QA 5C9ZA 4MKZA 4ZZ2A 4RM2A 1JZTA 3ZHUA 4CEHB 1MIHA 1P0PA 1A7JA 2C5FA 2Q6KA 3VXKA 4QGBA 3FETA 5ICCA 3DDUA 3X1XA 1EDBA 4KK4A 1E2IA 1WKVA 4RH0A 1H42A 3ZH9B 3IAS1 4B35A 3TNYA 1E1QA 4MD9A 1NVKA 3CXUA 1DADA 1R8JA 4WCFA 4ZYXA 1DKPA 2C2GA 3EIHA 3FFAA 2C5AA 5IZCC 4I8XA 4OQFA 4YJ2F 1T9BA 2O8FA 1PGQA 4G86A 3DXXA 1C3EA 3R7WB 3K1JA 3O1HB 4WLVA 1E63A 3EZ2A 3EX7C 2HFJA 3BL5A 2OOXB 2Y71A 1Q20A 2BKXA 2NXEA 3VB9A 4AKSA 4HAOA 4BNYA 3FFTA 1ESEA 2G5TA 4OM7A 3U09A 4NAHA 1YDMA 2DR3A 5DW3A 4QDZA 2QP3A 3G9XA 2OAQ1 1LK7A 2POQX 3CR7A 3AM5A 2NYVA 4IDEA 4GOMD 4MQFB 4ZPJA 1A1SA 3WYBA 3M6XA 4HGPA 3WWOA 4ZAWA 1F0KA 1TCCA 3O2QB 1YS4A 1XELA 4QBKA 3JAWB 3WNZA 4ENSA 3GVIA 2CBGA 5SZJA 2ID7A 5CJPA 4B3FX 3VX4A 3NMUF 2YVUA 4K81B 4QOEA 5MGNA 2DE0X 1KXZA 1JJIA 4QZVA 4GZ5A 4J6FA 4XEHA 1VDZA 2MWMA 4KHZA 1H5NA 5H80A 2I65A 1Z22A 5ALKA 4C87A 1E1KA 3VDMA 1DSSG 2J3DA 5FUVA 1T36A 3KS9A 4ZCRA 1L8AA 1NC1A 2QD3A 2Y8EA 3RFXA 1N6KA 1C7IA 3IP8A 3NGLA 2F8SA 3TZQA 2C8VA 4PSCA 4NENB 3RC2A 5BQXA 1KQGA 3KL4A 4BNLA 3VA7A 3I04M 2PO5A 1JVSA 2HMWA 4EHHA 4C7OB 1XZCA 2CB0A 5ADWA 4OLBA 1QRDA 3PDJA 1AK2A 4RTQA 1CV2A 2YVKA 3U7QB 4HDNB 4WY8A 5BW4A 5JJLA 1VJ0A 4Y7CA 1VRCA 4H6PA 4QT4A 2I54A 1DKLA 3HU1A 3KR2A 3NWPA 5ALIA 1IBLB 3ELWA 5IT9A 2DM6A 1JIQA 1Y5NA 2Q3BA 1E3QA 2WM8A 1ZVMA 4UUOA 2QVBA 1ZRSA 2Y99A 3DVAA 4Q9LA 3FTEA 1QTQA 2AVDA 3ILYA 1BD4A 3VGPA 3TLGA 3BRCA 2D8AA 4JR2A 3O84A 3FZEA 2YHUA 4YP7A 3OM8A 4EJMA 1NDQA 2GN2A 1OXBB 2W6MA 5C32A 3IUSA 4BNVA 1UMCA 3WK9A 1TMOA 4PZDA 1Z4KA 1UBNA 4JUFA 1PI3A 2I5PO 3C1AA 3L6DA 4MLZA 5K6TA 3UG7A 3OQJA 3TR5A 4LNUA 1GQ2A 5JAIA 3GZNA 3H4TA 5CHYA 1X38A 4L2IB 1H5UA 1G8PA 3MCVA 5DV9A 4FU0A 4JI5B 2GK4A 4TL6A 2IEAA 3RASA 5IULC 2AFVA 2AX3A 3B9RA 4D3YA 3TECE 3B6JA 1EFPB 2C2YA 2PJRA 4YC7A 5CIWA 2H1VA 5ITZB 3LT5A 5DTIA 2R8ZA 2KMLA 2WSIA 4U00A 3STTA 2DLCX 1BQ3A 3R8FA 5EXSA 3ZD8A 3OPQA 4YASA 5IFLA 1JDTA 3PC3A 5H8WA 3S99A 2ZB3A 1M6YA 1QVZA 3PU6A 2YRFA 5CB0A 4IP0A 3TFWA 2XKBA 1SR8A 3EAGA 4PLYA 3H9QA 3CEHA 3KKPA 4QTUB 2FJUA 3A37A 3F8SA 4ZEOA 2I62A 1JA1A 4I3FA 2BCJQ 2C94A 1JJ2Y 2VK1A 2XCIA 2CXPA 3S1RI 1PEYA 2WKPA 1GUBA 3CF6R 1QF9A 1SKYB 1EVJA 1QDLB 3BD9A 1LVHA 2J0VA 3D6VA 3HO8A 3KKKA 1ONSA 1YZGA 2DSTA 2JFPA 4PG5A 1ZOSA 1IHPA 1KS2A 5BYKA 1Q11A 3OIFA 4XX0B 2ZSJA 5I4CA 3CF0A 4DGLA 2FZ5A 1L5HB 1EG7A 3BA6A 3L0YA 1Z47A 2G6BA 2IXGA 4GKBA 3SIWA 5C1PA 1FUUA 2PCJA 1AMNA 4C01A 3L6EA 4PX2A 4XB1A 3FKQA 4BLVA 1UAGA 3MJRA 4H3VA 2AI2A 5GQSA 3CCR1 2ONJA 3D7MA 4OH1A 3QLVC 2JATA 4UNQA 4Q12A 3S2YA 2QD1A 1ZS9A 5KI6A 2JRCA 1ZEMA 3OD1A 1PTKA 3FI9A 1Z2DA 3OJOA 4KXWA 2XUJA 1MENA 1KR5A 4PQRA 5EIBC 3IAEA 3RUDA 2RGCA 4TL8A 4ZCLA 2O2YA 1HEIA 3QUTA 5E6UA 1LQTA 2QLFA 1KEVA 5CD1A 1GU7A 2J3IA 2ABWA 3R4CA 3UJ7A 3S81A 4N3AA 2GUGA 1QPGA 4TWAA 2VPYA 4L5CA 1IQ0A 1A8IA 3N2KB 1F8XA 3GGSA 5EIFA 4NLLA 1DEHA 2WYOA 1TIPA 1OX5A 1IULA 1CQJB 4HWPA 4N6NA 5MN5A 1QFZA 1K6EA 1RYHA 3IT2A 1FFDA 3A70A 4X6LA 1Y6ZA 2HCRA 1R5NA 5CA0F 1TM4E 4WV3A 1CUSA 4YXWA 1YHQ1 2W70A 4UTNA 2I1LA 1XZMA 3IPCA 3KT0A 4RJJA 4AJKA 3R0XA 4YYEA 4C7BA 1UZAA 5JWOA 5AHRA 5LMZA 4NJOA 4E1VA 5BR7A 4KACA 1YUNA 1ILEA 2XOXA 2TS1A 2GJAA 1SCQA 4JCCA 2PYIA 1VHTA 2V4ZA 3DR3A 4M0LA 4P82A 3DJYA 5T4FA 3NBXX 2QBYB 1ZKDA 4F5WA 1KY4A 1OF1A 4Y98A 4YJ2B 5KOIA 3J80f 1DV2A 1R0XA 1U28A 4IDGA 1DO0A 1EA5A 3VSAA 4CQMB 3GP8A 1RBMA 3AHFA 3NWEA 2J4DA 1N8SA 1Y6GA 4R54A 2JI9A 4MQFA 4ZPXA 3IR5A 4PRYA 4BNIA 5CNMA 5FPHA 2Q62A 2V54A 1GT91 1K1EA 1Q1EA 2GCGA 2ZP1A 4C5BA 3I6IA 4D1YA 3LBIA 4WY5A 3WRVA 1DC7A 3KBBA 4FFPA 2OHOA 3AUKA 3HYTA 4RK6A 3EDCA 3AB8A 3BHNA 3ETJA 3JXEA 1ZRNA 3CURA 3CF2A 4ZVPA 3CNQS 3K0CA 3OJFA 4NE9A 4YS6A 4Y2JA 5IM5A 3M2TA 3CZAA 4IFIA 1B6TA 3EWIA 5KYVA 3USES 1GL7A 1SUEA 5AHKA 3W4JA 4BZWA 4CZ2A 4RA9A 2VDRB 3PUZA 2FMIA 4MYRA 1F20A 4IGAA 1ZD3A 4H60A 1JB9A 3EUFA 5DTJA 3L01A 5GZ1A 4U7TB 5L6LB 3J81A 4DR4B 4MXDA 3O91A 3P4YA 4Q7QA 1NBMA 4JL8A 3PFIA 3CKMA 3OOWA 1XB2A 2P2SA 3GZNB 3NBQA 5DGXA 3NHAA 5ESDA 2RAUA 3OOYA 3SYKA 4MGYR 3UK6A 4JYBA 1SXQA 3P9XA 4PBTA 3N1UA 3N8NA 1JR4A 1Q7EA 5KUTA 3OQ6A 4FBLA 4OJQA 3DE3X 5FFMA 3IF8A 3EERA 4W5HA 4FMBB 2QN8A 4DC9A 1SZDA 1GPDG 1TIKA 3O9MA 4O3FA 5B3AA 2UUAB 2H4YA 4RHCA 2EJUA 4EEXA 5K8TA 1PLLA 1IBSA 1X7GA 5AYVA 1F17A 2EP5A 4XWYA 4XUEA 1H9AA 2VWPA 4R9NA 2BR3A 1PJ8A 3RIGA 2B6NA 2I7DA 5IKMA 2HA4A 2G17A 1AO3A 1P60A 3CW2A 3V4VB 1WETA 3UK7A 1NX9A 4E2YA 4NOMA 3HKBA 3N76A 2COEA 2LR0A 4IZIA 2GAFA 1SBQA 4MO2A 1KSGA 2IPMA 2HU9A 2YN2A 2VCEA 4Z2AA 3L5OA 4Q66C 1V3UA 2IELA 4NARA 4FCTA 3KVYA 1IPHA 3LA8A 4YT5A 4AC9A 3V48A 4FS3A 2YWHA 1HLDA 2VATA 3KUDA 3VPFA 2FK8A 5KNBD 4PEVA 3T0GA 3GXBA 1L5OA 4L50A 4N1AA 4D9NA 1LX7A 4DRYA 1GU1A 3L4BC 1GZVA 2PRJA 1FMTA 1FBTA 4IVNA 4B7ZA 4GBMA 1UJ4A 1THMA 5IH7A 3L1KA 3EODA 3PWTA 1XJ0A 2V0NA 3F5DA 3I0NA 3QF4B 2O5VA 4TUYB 5FULA 5IAKA 3OE1A 2V1XA 4UUNA 1TWCI 3H2BA 4UPVA 2WSMA 4TZTA 3QWIA 1YIDA 3ETLA 4M37A 2QTTA 4RDCA 5TQJA 4BLQA 3DD5A 2HMAA 3IXMA 3UT6A 1IZ8A 1NHWA 4IMIB 4XFJA 4DLTA 1M1YE 3PZRA 4RPGA 3WWPA 1H6CA 2AXPA 1LGYA 6LDHA 3W4IA 1HT1E 4AN4A 4JEHA 4IUYA 1Z45A 2E7ZA 1UC8A 3B6ZA 4H7JA 1HT2E 1M7BA 4NYJR 3P71T 2PSJA 3VU8A 5C8DA 3MRTA 3L92A 4M8IA 2O54A 4YRTA 2BGUA 1FK8A 4X7RA 3UMMA 4CV0A 2C57A 2R87A 3LK6A 2YXLA 4YLYA 3AHJA 2EXXA 3A3YA 2NU7B 1DCMA 2LKDA 3OLWA 4HO1X 4NCNA 1A9SA 5KYYA 5GP1A 3PO3I 1P0FA 2PVCA 3IP6A 2VHCA 3K7EA 4J9UE 1T4BA 3DL2A 1JSRA 4MRVA 5KVQA 1ZNXA 3BWYA 3R5KA 4BV8A 5K01A 2QLBA 2Z8YM 5L4LA 2BFEA 4OP3A 3SJZA 5C5DA 3NC1C 3FAKA 1YK1A 2YXNA 5J1TB 4ZVTA 2XMZA 2W11A 5K2MA 1A8HA 1JFRA 2Y0EA 4H31A 4D6YA 3OT1A 4HGOA 4AZ0A 3R6DA 2NUTB 5FLXA 1M6HA 1OHHD 3H86A 5CDUA 4AK9A 2QGNA 3GEPA 1XWIA 4QBTA 4Y2TA 1IPEA 1U2EA 1LPBB 4LOAA 1TYBE 1DXOA 1MT0A 5A7FA 1EFDN 1Y1SA 2AI1A 4DLRA 1QBGA 3RTEA 1Z9BA 2AZMA 3RFFA 1ZLYA 1OXSC 4TNUA 3E8SA 1R9GA 2Z3VA 2A1TS 2YUIA 3TRHA 2ZITA 1B0AA 1TF7A 3LGXA 4DCPA 3EPLA 1FIUA 3GVCA 3V8RA 5LYYA 5SYAA 1CC1S 3B3GA 4LRTB 1V8DA 3EGVA 1EFVB 5C8ZA 5KC8A 5LQDA 1GU0A 2C7GA 1KI6B 4MS1B 4RVGA 3GJQA 3VPGA 1N8TA 1XE3A 4BNMA 4E0BA 4WUTA 5BV7A 2IIVA 3PX3A 4DCJA 1IEVA 2O20A 4LNAA 1JDUA 3R7NA 2VDWA 2P6MA 4KUGA 2I4OA 1QIGA 3G2MA 3KDSE 2NN3C 1ABFA 2YWCA 3HMKA 4NZYA 4DPKA 2FHSA 2R7AA 3LBAA 2RGXA 3NXSA 5DM1A 1DZ3A 3DPUA 3NHSA 4H27A 2JNYA 4YLGA 3V4LA 1ISIA 4B6OA 2Q8QA 1EX9A 1M9NA 1KNQA 1O95C 3HUDA 4I8DA 3ZD7A 3MLAA 5AJVB 2D1SA 4LDAA 4DQKA 2ZIFA 3WLSA 1GPWB 1GXSA 2XMQA 1IIRA 1BTOA 1N5IA 2DCMA 4TLAA 3TIGA 4ZA2A 4HVTA 5K4HA 5IKOA 2BD0A 1ZUHA 3KD3A 1L1EA 2RFLA 3G6KA 3LUJA 3TW0A 5JXHA 2C7RA 1YS9A 2FDXA 4II7A 5E2IA 3PFFA 3GB9A 5T4BA 2FSIA 3GA0A 1PWXA 4I6JA 5IKPA 3GMSA 4EQ6B 5IRCD 3BXPA 1FQKA 4X9XA 4N0MA 1ZA1A 4R3WA 1AX9A 1DKUA 3IEPA 4QOGA 5FUQA 5L3SA 3RC3A 2X9VA 4K6CA 1IHDA 3S8EA 1X7DA 3TNJA 5B4TA 1U0BB 5ICEA 3IX0A 3QPVA 5KVSA 4DQ0A 4WNCA 4JI4B 3AEZA 1ZXXA 5F4ZA 1PTJA 2NXWA 1F1BA 3MWYW 1BOOA 3SE7A 4GXNA 3K4PA 3KCNA 2B5OA 4BMXA 5IYZB 1Q822 5REQA 4ZYLA 1QHNA 4ZD6A 3H84A 2XF8A 3HB5X 4BNGA 4P83A 5KSPA 2I2CA 1OV4A 3MLEA 4TTIA 1VP3A 1M66A 4E5KA 4RVHA 1T1JA 2Q2WA 3UB2A 1VDMA 1CZLA 2MINA 2ZYIA 2RI6A 4X44A 3CJQA 4LTDA 2PVPA 1JQ5A 4R9UC 1MN6A 1NKTA 3W2EA 3KR9A 3AHHA 4X65B 1S8OA 4ACBA 2JFYA 4ON9A 1DEAA 1E9RA 2ZJ0A 4IFEA 3TLYA 2GLXA 3H4IA 2BGLA 5EHXA 1US8B 1AA9A 2I8LA 3NBUA 4KQ2A 4MQEB 5C8YA 1UM9B 3UIEA 1YR2A 2HLDD 4DMLA 2IXDA 3AETA 1MABB 3NHRA 4P2GA 3RC7A 3ZV3A 4F2GA 3ERCA 1XV5A 2OTCA 2V5VA 3BTVA 5EP2A 2EJVA 3Q8XB 1KO7A 2P2DA 3ZUPA 4EFMA 3TIXB 2GF2A 1VIAA 1IVYA 1N6PA 2A88A 2QPLA 3GCZA 3Q5GA 4HY3A 4RF5A 4B84A 1GV1A 1J4AA 3N58A 4GR5A 2R5FA 4X84A 3W8EA 1IM2A 1QDUA 3THYB 1Z4MA 2FK7A 3PIDA 4AKGA 2J31A 1SKMA 2CHEA 2DH6A 3QXGA 4ZAGA 4GI5A 3OLYA 3U16A 2JLRA 1WMFA 2INGX 3IH5A 4ALIA 1QH8A 4KO3S 4RV5A 4FFMA 3FHLA 2HSGA 1YB2A 3I1JA 2LNDA 3QVLA 5HEKA 1U0SY 3PVCA 1MMFB 3P9ZA 4G5RA 4GPTA 1GZ4A 4INAA 3RIHA 3E9NA 3K0FA 3NTXA 5JRJA 3ESXA 1U5BA 3MJ4A 2R7LA 1LPMA 2EFHB 3WLTA 1UBLS 2AEMA 1C1DB 3W90A 2Y6UA 2YASA 3DCIA 2A57A 3ZE7A 4HAYA 4EY7A 5CG2A 4IIJA 5E7QA 4WCDA 2GPWA 4Y2HA 4WFJA 3UV6A 3FOFC 3FSRA 2W83A 5ER9A 4KXXA 3NTLA 4C0AC 3HFRA 1H5QA 3SS8A 4FVTA 1Z6ZA 2X0NA 3MWLA 2A5FA 3PTLA 4DDWA 4FZJA 2W03A 4IXTA 4WLUA 3VISA 5G3YA 3SFZA 1XD8A 4QTUA 1PDOA 4G0QA 3GNLA 1N6OA 4BTVA 3C3EA 4XSHA 1A98A 2MYUA 1VQPZ 4FNGA 2AHOA 3CME1 4RK7A 4WZAA 4DSAA 3JQCA 1NW3A 3S1MI 4EPRA 1NI4A 3JRXA 5LDHA 5DX1A 2I2AA 2IE8A 4P9NA 3CLTD 1B0PA 4NFHA 3TFOA 3FYDA 3LT4A 1P8AA 1XK6A 2NZYA 3GQBB 4S1WA 5HKAA 2CVHA 1NLFA 3EDYA 1MIOB 3NM4A 1XIVA 5JHHB 3UBTA 1TKBA 1TF5A 2LW7A 1R4MB 2WK1A 4YUYA 3ZV6A 5KX5A 5AOVA 2GD6A 1K9M1 1Q92A 2BFFB 3H9GA 2EGGA 2FP4B 2FR8A 3VVBA 1ZX1A 1X87A 1C9NA 1E6EA 1VQMZ 4G0PA 2HJVA 4P6VF 5TC4A 4X1IB 2V7QD 1CR4A 2P9EA 4CEJB 4BGVA 5IT5A 2JIMA 2ET6A 1U65A 2X9QA 5DBIA 1V8ZA 3RHTA 3NIBA 1ZRHA 3EIFA 3R24A 4RADA 1O6CA 3M0EA 3ZU4A 1HUQA 1Q7GA 1V8OA 2GD0A 1CHDA 1T8YA 2X7XA 3F47A 3DMHA 3GPDG 3I5UA 4Y9TA 3THWA 4FTWA 2FSVC 4FB5A 3LP6A 2RMKA 3QBJA 4PG6A 4KGDA 3TRFA 5IPFA 2H2FA 4LDZA 1YQGA 2ZB8A 5FFFA 3WKCA 5JZVA 4LCEA 1K7SN 3M6AA 5I7WA 4TV9A 3LYAA 5EUQB 2BFDA 5D7NA 3ZDQA 1WV1A 4RMGA 3IOMA 4OAPA 1L1OC 1A2KC 2ZQYA 4B76A 4HQLA 5BV1A 1CS0B 3IBYA 2XX3A 1OR8A 1V1MB 2CFTA 2ZYRA 4KIFA 1U8AA 4UUPA 5A2GA 4UTOA 3KQVA 1G9TA 1NPDA 2W6JA 1WUKS 3BFKA 5FOVA 1NJ8A 1SIWA 1SHKA 3DHNA 2PG3A 3K9QO 5FPYA 3I6QA 1K63A 1N2CB 3PSHA 3WLRA 1B00A 1MD9A 1S1MA 2VUHB 1Q7RA 4YUWA 2EP7A 1SQFA 2FHPA 4KLAA 4XQ9A 4RA6B 5G40A 1EWYA 4EGQA 4CV2A 2O0JA 4P54A 2NV2B 4LGVA 4EFKA 3G6EZ 2HT1A 4M53A 4YFVA 4YTEA 1PJ3A 2A0YA 2OUKA 2ZZMA 4Y67A 1U0HC 3BF7A 2NVYI 3HUTA 1KYTA 3JTMA 3DAOA 1UKEA 3I05A 1VBFA 1YQXA 3CGGA 2EW2A 3QYAA 2MDTA 4PSAA 5LL6f 4QL3A 1ZM3A 1N7GA 1VBMA 2F43B 4A15A 2R65A 1B41A 1PT5A 4TX1A 1I33A 1ORVA 3EVAA 1UJ2A 3PP8A 3SK0A 4YAKA 4JP5A 3LXXA 5I7RA 6GPBA 1MHTA 2BZ0A 1ORWA 2ZS7A 4YRCA 5EY5B 2MSDB 3GLIE 2CSUA 2PPLA 3F4BA 1Q3KA 1T2AA 3MTJA 4ZGBA 1MJGM 5FBHA 4B44A 2VHVA 2WB2A 3HJCA 3DO6A 4K9DA 4URZR 5K5EA 4QJ3A 3IV7A 2PXCA 4NRDA 4JXJA 1O57A 4YJFA 4MW4A 3W6ZA 4B82A 1ECLA 4MICA 3NG1A 4HMOA 4R69A 5C46F 4MW6A 3IE2A 1DC5A 2BGTA 4G0YA 4H1UA 1EM8A 1F2UA 1O5IA 4QOHA 3RC1A 3GLKA 4B7UA 3D54D 1QR6A 3JRWA 1W5EA 3MTEA 3REOA 5C80A 3CVVA 5E4TA 2OM6A 1ZQ1A 1T1GA 2YVLA 2BKUA 1H1DA 2ANCA 2D74A 2O8NA 4DARA 5C7IO 3TL2A 2B35A 1Q862 2Z0MA 1U4NA 2GN1A 3D5EA 1H4QA 2GFQA 3K1AA 3SYTA 2WKSA 1O6ZA 4JLAA 5I5EA 2C04A 1OI2A 2QV7A 1EJBA 2QRJA 2VK4A 5HUHA 3RYCA 3VO8A 4EW3A 3VTNA 4JDUA 4JI2B 4F9GA 3WJ2A 1UDCA 1YJBA 4Y6PA 3WLJA 4Y1EA 1OIXA 1EWQA 1DT3A 2BM8A 3UB3A 4QYMA 2W43A 2C00A 5CVCA 1YAJA 3OJ0A 4FFBB 3TM4A 4C22A 2ZDQA 4FIDA 4B40A 1H1TA 4JA2A 4L3WA 2O8CA 3F96A 2OXRA 3ZVMA 2VT3A 2H1OA 2W6NA 3W5HA 2LCIA 3BIWA 1M6VB 4G63A 3GWGA 3CLSD 2OLKA 2QZSA 2RGNA 3GBSA 4I9UA 1UBUS 1OAKA 3QENA 2EW1A 3UY4A 5JS8A 5CT6A 4YJGB 1REQA 2VDMB 2OV8A 3DZJA 4OKIA 2O3UA 3KKEA 4MWBA 7MDHA 1O97D 2IZZA 3R3JA 4FIZA 1BVRA 4HR7A 1OZAA 2WTNA 4B74A 2OP1A 3SI7A 5DBFA 2C96A 3W7VA 3UK1A 3NHZA 5I7OA 2QA5A 3E2IA 4CL8A 2XGGA 1WE2A 1A76A 1NE7A 2HJWA 4OSOA 4AF6A 2YW2A 1WHTA 3FWNA 3UENA 4HX5A 1Z5OA 2G06A 2ODEA 5DLQC 4B8YA 2BE9A 3R0QA 1BH6A 1P62B 1ZJZA 3DVLA 2CMFA 4KRYA 1G19A 1V9LA 4KXMA 4M83A 4OQMA 3M70A 4PY2A 5EZYB 3ZC3A 3AVTA 721PA 3C43A 3ESCA 3IAS6 4EYQA 2FQWA 1QHFA 1WQ1R 2JMOA 3VHLB 4EJSA 1N8R2 5HFAA 1DC4A 1XZHA 3CS3A 1FA9A 3NJ8A 4C5CA 3IDSA 5J9FA 2JLVA 4X6UA 2FVXA 2ZOSA 4YAOA 1LH0A 4BE4A 2GCPA 2DFVA 3H1TA 1ZUNB 2ZI9A 3BAFA 1DE0A 1Y6RA 5FEUA 1EP2B 1I2ZA 1OWLA 3PUVA 2GTIA 1YFJA 3DTNA 5EE1A 3H5RA 3CM0A 3DT9A 4NJMB 1USVA 5COAA 1BWPA 5JSHA 2YQ4A 5GINE 1J07A 1QHEA 1WTCA 1C8KA 2Q4BA 4LHVA 4LSMA 3R77A 4RF4A 1K6JA 4NV3A 4S1PA 2P2ZA 4X00A 2IBSA 1VLJA 1XNGA 5LP6B 3URMA 2GUWA 3OZDA 5KWSA 1V41E 1DAFA 2P4QA 5EWMB 4K2HA 5AJYA 3MTAA 5HFJA 2GMWA 3KVNA 1LS6A 2QZJA 2WM2A 2GYVA 3RFTA 3RUEA 3S2SA 4DMFA 1QZUA 2B8WA 4DQXA 1NMXA 3QBDA 4BGEA 2GU2A 1XMJA 3EEFA 4CTOA 1APBA 3R5SA 1FNSA 2NUBA 2MYPA 3CX4A 1P9LA 4G97A 1XVTA 4Q05A 3G23A 5ARCA 2NNWB 5KDOA 3DJFA 4K86A 1CWUA 1U7ZA 4XYBA 5IUNC 3FPAA 3NT2A 1FYXA 1QWSA 4UE3S 3IPAA 4V39A 2WDPA 2IPLA 4NNOA 4P2BA 4D43A 4EVRA 4UATA 4AMVA 4M1QA 5CRIA 4M6WB 4X66B 3DMPA 1ECCA 4MRAA 3SQDA 1A9XB 4HB4A 4PQYA 4A8TA 5DLPA 1LA2A 2PKEA 4R0MA 5F52A 1NUUA 3QYPA 4M22A 4NMMA 4AP6A 4MRIA 1PEDA 4MR7B 3MYRA 4BCDA 4DWOA 2WG0A 4MAMA 3TXYA 1XAHA 4F3CA 2PSHA 2VDUE 1OAOA 1Z07A 1T5TA 3FOZA 2X8BA 1DGQA 2QTZA 1MQ8B 1P7WA 1PYOA 2FEKA 3DH0A 3WIUA 2EATA 2WQZA 3TOSA 2HDOA 4DLWA 4AU1A 2OFFA 4DB2A 1GAJA 3K0AA 4FYVA 3R7BA 4YEDA 2QN9A 4FBGA 4L9WA 3A14A 3MAAC 1UT6A 2NVQI 2FFHA 1BGVA 3RUHA 3WIEA 2OBYA 4XCXA 3D6JA 1Z4NA 1ZGJA 3FFBA 2ZQ5A 4J7AA 2OZLB 2ZIXB 5ISMA 5DN6A 2FSHA 4MP3A 3SKYA 1NXQA 2OCLA 1O4WA 4RUKA 4DZRA 1Z01A 5CUQA 2VWQA 2CE7A 2AG5A 4TL9A 5BYAA 2WWTA 3IMGA 3F8WA 1TUBA 2LV8A 1JKIA 3TGLA 2XTJA 1CETA 3QY0A 2C2WA 1IZ0A 3I58A 3FI0A 3T9CA 1YUBA 1CEQA 3TBFA 3QUCA 4CQLA 1FVHA 4G41A 5D00A 4ZC1A 2V98A 5TARA 2JCBA 2B5WA 1H85A 1LTKA 1WTAA 2DY1A 2UZ0A 2Y4OA 5D7BA 3OMXA 4D5EA 5I9NA 4ZCPA 1NONA 4UHFA 2ZI3A 4J0JA 2B34A 3PVSA 4ALLA 4Q9IA 4RSMA 1UP7A 4DPLA 4G9GA 4RIFA 4ER5A 4DV5B 5IJZA 2XBLA 1U3VA 3Q1LA 3LFHA 2D0PB 4GPD1 5DE3A 4ZJZA 4XQCA 3ELBA 4BQNA 1PG5A 2WWHA 2ISQA 2HSZA 3D4NA 5JXWA 4M87A 2HBQA 3LY9A 1W87A 1W5BA 3I2YX 3IQGX 1KK1A 4RETA 3Q5EA 5LSAA 2FUG6 2WJGA 3UUGA 4PYNA 4W1QA 3I62A 3D7SA 1U3DA 2RT9A 3LGSA 2GM4A 3FIJA 3AXSA 3DOEA 3WTCA 3CKYA 2DFTA 2NVWA 3GJ0A 2G71A 1FYDA 3JYQA 3LPLA 1OSNA 2W2KB 1WAMA 1IY0A 1UBTS 1YH3A 4HAZA 2UZ3A 1O8CA 1PGOA 3FWZA 4IILA 4ZVQA 1SXJB 3MVEA 3ZDCA 2G1JA 4F1WA 2XB2A 1GITA 1PL0A 3HEAA 4YGYA 3ROEA 1VQM1 1H0RA 2FZKA 3BMQA 3CZCA 1A1VA 5A6SB 1SUAA 4YB8A 4DLLA 2X1HA 4O63O 5M34A 4CM4B 3S7ZA 3CFYA 2DKFA 3LY8A 2WIAA 1WUIS 5AUQA 4YONB 1W75A 5TMBA 2FW7A 2CV0A 1MX1A 2ENUA 3YASA 4YA6A 2H2AA 3H9UA 1ANKA 3L7AA 4O4LA 2WDZA 2Z9BA 2P2NA 1RC0A 1W25A 2OHVA 1LDMA 1QMGA 3MMXA 2ZJ3A 4PZUA 4QECA 4CM4A 2JNWA 1VJRA 3PXXA 3G0OA 1NX6A 3I0MA 2DHQA 4DQLA 3I01M 4AKHA 2A59A 2VJMA 3G9UA 4GMKA 4PCLA 2DHEA 4OJNA 5KKAA 4R1UA 4DG5A 2IOFA 2IIPA 4M38A 5HM8A 5BMVA 3Q9UA 2JFZA 3GFRA 3CUUA 1VL6A 2GCIA 2CFIA 3L6OO 4Z0NA 4IIJB 1YE3A 3UCEA 5FIUA 3ADKA