4S1TA

Crystal structure of the mutant i26a/n52a of the endoribonuclease from human coronavirus 229e
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
347
structure length
342
Chain Sequence
SGLENIAFNVVNKGSFVGADGELPVAASGDKVFVRDGNTDNLVFVNKTSLPTAIAFELFAKRKVGLTPPLSILKNLGVVATYKFVLWDYEAERPLTSFTKSVCGYTDFAEDVCTCYDNSIQGSYERFTLSTNAVLFSATAVKTGGKSLPAIKLNFGMLNGNAIATVNIKNINWFVYVRKDGKPVDHYDGFYTQGRNLQDFLPRSTMEEDFLNMDIGVFIQKYGLEDFNFEHVVYGDVSKTTLGGLHLLISQVRLSKMGILKAEEFVAASDITLKCCTVTYLNDPSSKTVCTYMDLLLDDFVSVLKSLDLTVVSKVHEVIIDNKPWRWMLWCKDNAVATFYPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridylate-specific endoribonuclease
publication title Crystal structure and mutational analysis of the endoribonuclease from human coronavirus 229E
rcsb
source organism Human coronavirus 229e
molecule tags Hydrolase
total genus 86
structure length 342
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.360 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 4s1tA01
3.40.50.11580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4s1tA02
2OZKA 2GTHA 4S1TA 2GTIA 4RS4A 2H85A 2RHBA
chains in the Genus database with same CATH superfamily
1NE2A 4DQLA 5GJVC 5CFRA 1N2SA 1T5BA 2WU3A 1AN0A 1WPGA 3C43A 4EUHA 1KZ7B 4F2GA 2PUGA 3IGFA 1PW7A 2ZSHA 4P4LA 4TX1A 3ULKA 4BLWA 4EG1A 5K8CA 2HRRA 1RAAA 1LNZA 3CH7A 3BE4A 1QAMA 5E95A 5TXGA 5ICGA 1E3QA 5CD9A 1X1CA 3QWFA 1FNCA 1WZUA 3J81k 2P2DA 1GCIA 4FE7A 2WM3A 3VV3A 1PVOA 5T6BA 3G5MA 1NLMA 1YO6A 4EGFA 4DGSA 2BIFA 4KOAA 4Y2HA 4QTTA 3M4NA 2CF5A 1K3TA 1U7OA 1ECFA 1X1EA 4XRGA 4ZDKA 3MC1A 2I7VA 3K6KA 3LA6A 3O3MB 2G71A 2DM6A 2PMFA 3DL4A 2P7HA 4BFUA 1Y8ZA 3KUKA 1VYTA 1J0AA 2GCPA 5LBTA 1X7WB 4G0YA 2B21A 2R8RA 4HLQB 3VPBA 1MA0A 3K32A 1W2HA 4D0RA 2FOLA 4Q7EA 2OV3A 2POQX 4HXEB 5ALJA 5LL6P 1ODTC 2XXJA 2PDAA 3LGSA 3HA3A 5CAEB 4G9GA 1E20A 4CTJA 4RZSA 1YUKA 2IY9A 3SR3A 2PSFA 1SB9A 3D1VA 1U6JA 3NP7A 4QL3A 5FYQA 3M0EA 5DIFA 1XZEA 1NRXA 4V1CA 5CK5A 1Q0RA 3P0FA 2BAGA 1N5DA 2FEAA 2QD1A 1GYRA 2WW8A 4UNQA 2AC2A 3OEHA 4CKEB 4CQNA 1GLGA 1D09A 1RQ7A 2QN6A 1MO2A 3GP5A 4DRYA 4KBGA 1IBLB 4E5PA 3ZHOA 5EWJA 2WV9A 5J5CA 1ZJ6A 4TL6A 2CK3D 4UUMA 4BO4A 3RROA 1RC0A 4M99A 4XYMA 4AYTA 1U0LA 1U99A 3AVOA 4FDLA 4NNPA 1ZJYA 4ZQHA 1KBOA 2ZJ0A 5F2KA 3B7PA 1HXHA 2SCUA 4OB6A 3SFZA 1JU9A 1P5HA 2RFLA 2XHEA 1T0PA 4R2IA 5DLYA 1KH2A 4EI8A 4NCKA 1EM8B 3AH8A 2FWNA 2LWIA 3P71T 3T06B 3W90A 1W0JD 3LLMA 4JI8B 4OXIA 3BC1A 4MPDA 2A67A 4W7HA 1JHMA 3OM9A 1FRNA 2LRHA 2QM8A 3G0IA 3S55A 1FTSA 3AXTA 1ODKA 3OTQA 4KPUA 4TTRA 4Z1MD 4YPFA 5K0EA 5JYEA 1OTYA 2R7KA 3C7AA 2BTQA 1VKHA 2PU5A 1HG0A 3KYJB 3PGA1 2COKA 4UDNA 5IXSA 3MEQA 4FEYA 4CMEC 4G8JA 2G0AA 2NV0A 4MEBA 4Y2TA 1VLHA 3TMYA 4CJXA 1OI3A 3CMAZ 2BC9A 2Z9CA 3MBKA 2XX3A 1W6UA 4BLUA 4GMDA 5A9SB 5IVIA 3G6WA 3MZ0A 5DM0A 3ZV7A 4BRUA 1MVNA 3QVGA 4GWKA 4WBXC 3HCAA 3IBFA 3CUEF 4AQ7A 1PE0A 4PZPA 2PQMA 3BREA 3S2IA 4EFDA 4JLJA 3CQZI 5J5AA 2QM7A 4R3NA 1UFRA 1I4EB 4M8LA 3RS5A 3WP0A 2VBFA 3IDAA 4MW4A 2UZ3A 2B6NA 2C3PA 2X86A 2Y4OA 3ACDA 3BAZA 4WJZA 4BEVA 3L0ZA 1L8LA 5BVHA 4FEEA 1U8TA 2BMVA 3KNZA 4LW8A 1W36B 1M2NA 2AF4C 1UMBA 5IG2A 3F3PC 1YA8A 4XUDA 4NBWA 4KPEC 3M6AA 3F0TA 2ETVA 4L6CA 5FBKA 4Y0AA 1CY6A 1EDDA 2D5IA 2WICA 3FPGA 2JFBA 2RIPA 4MVJA 4W1RA 3WGYA 4OGFA 4BJ3A 5J4HA 4I9GA 3TVYA 2X0RA 2XA2A 1RRKA 3I2YX 2JGAA 1E5LA 4QPZA 3RFVA 1LLCA 2Y9MB 1GQOA 2HSGA 4BCBA 3I42A 4EGJA 3IUMA 1K732 2H2DA 2OBLA 2GI4A 2FDXA 2OAGA 3EZ7A 1JGTA 2Q6TA 1M8PA 4WNYA 1A5TA 1O8BA 1YRWA 4IJVA 4RE5A 1HDIA 1JP7A 3AQ4A 3ONFA 4Y2SA 3RU7A 1G64A 2DSNA 1H9AA 2P35A 3GJQA 3UUFA 4DHWA 3O95A 2YWHA 1NM5C 2H9AA 3W8NA 1QHIA 2NG1A 1W5SA 2ZW9A 3I1YA 3KYDB 4MZDA 5ESXA 1ZUIA 2R6AA 4BKQA 1KEVA 3V5NA 4UNRA 1AQJA 1JHXA 1IZ7A 3LDAA 3VV2A 2HHHB 4I0WB 3BL6A 4YCNA 3JAWB 4RV9A 1XHFA 1EXMA 3DLPX 1ODCA 4TZKA 3TXXA 5AVYA 1SUFA 2H92A 2ATVA 2Q5IA 3DJYA 3HBNA 3R44A 2OZKA 1QIDA 4AWBA 3MONA 1M67A 4URHA 3FYDA 3OPQA 1HV8A 4IVPA 1DPGA 4D0LB 5JQGA 1RR6A 2BUAA 2I3GA 1W0KA 1WG8A 3Q3CA 2J1LA 1A8SA 4EYKA 1ABFA 2J3LA 3BAFA 4DSTA 3R7LA 4RX1A 4LYHA 4NJMB 4XFJA 4LJ5A 5IJ9B 1Z8NA 2COEA 2MSKA 4LC9A 3HLTA 2JEZA 5TF0A 1ZJZA 3SBXA 4DRXB 5CBKA 3KWLA 4OA5A 2C94A 3U56A 2C07A 5IM4A 1F7VA 2IU0A 4RTQA 3I6QA 1QVZA 2WM9B 1EUQA 2D3WA 4Z86A 1L4FA 4LJ8A 4ZT5A 1GNSA 3NORA 1N7JA 2YXNA 3HJHA 3NT5A 4YMWA 3B6KA 1X9GA 1TM3E 1OT5A 4XGQA 4GI1A 4JENA 1GGFA 4XVCA 3PHHA 3F6SA 5JSZA 1DV1A 1T8WA 4MMYB 1TVMA 1BEZA 2W9XA 1RRVA 1P2FA 4L0MA 1W49A 4ZHQB 1AURA 1NLYA 3UGKA 5KINB 4NBEA 3OHMA 5G3ZA 1ZIDA 5HQTA 4FKMA 4INAA 3IKJA 3KPYA 4QSMA 2E4WA 4WEQA 3NWOA 4KYUA 4IFIA 4YA6A 1C29B 2J9YB 1NPDA 3BULA 4H3VA 4HDNB 4Y1RA 1S2MA 4L5IA 5C1PA 2QI9C 2AG1A 1Y0BA 1RAIA 2DBRA 2GWRA 4V03A 4WOPA 2NYVA 4H2DA 4KNYA 3GAMA 3SF0A 5L95A 1OB5A 3RC8A 2A5YB 3ZBQA 3G2NA 2QROA 1AZSC 5BOVA 4JEUA 1CD5A 4PLPA 4U2FA 3UKOA 1ONNA 1NN1A 2FG6C 3B82A 4AJNA 1H22A 2WJPA 1BE6A 1JL3A 2Z5GA 1AN9A 1SKAA 3OM0A 4YT4A 3KE8A 1A5ZA 1DTWA 2A9JA 3C1UA 3AU9A 4J0QA 5AWFC 1QCZA 1X2EA 2QAGA 3ADBA 3KPJA 3UMRA 3Q7IA 4P0TA 4O4IB 1RYBA 4IV8A 2Z2ZA 4ND2A 1FLVA 3O2JA 4B6SA 3KBOA 1Q77A 4P4UA 5KNCD 3ETHA 1R6BX 3UF0A 3K20A 4I46A 2J9ZB 3T9FA 4OLJA 1MJGM 2DT8A 2C4VA 1D2AA 1W8DA 2A9KA 3LX6A 3Q2OA 1QQAA 1GRVA 1ZH1A 1CUXA 3SR0A 5LWHA 1JYEA 2HD4A 1C7ZA 4JI3B 3K70C 2GHIA 2ZUSA 3LSTA 4UAUA 5AOAA 1XWFA 5HP4A 3THWA 1KO7A 3EIXA 1JWBB 2XCQA 4KUGA 4TMKA 3ZW7A 3R5FA 1G0OA 1FJ2A 1MNAA 1VPDA 1NMQA 2WEKA 2O7SA 1E3EA 3ZIDA 4HPXB 4IEFB 4NG5A 3ZGZA 2ECQA 4PYMA 4BAGA 1Z6ZA 5A1TA 3INRA 4XE5A 2PANA 4OHBA 2NAFA 2BM9A 4QLBA 5CG2A 4JBGA 2DSTA 4IJ6A 4X1OA 5AJVB 1OHHD 4OHWA 5I51A 1X87A 1EVLA 4BFVA 2HPZA 2IFTA 2YWEA 2AS0A 4RU1A 1JEDA 3W2IA 3WL3A 4MD9A 5AM1A 2C97A 5JAUA 5C81A 3GD7A 4J8PA 2EP5A 3V4LA 1A5AB 1MOZA 3CZQA 4ZI2A 1DL5A 1ESCA 4BVEA 4XTCS 4RXUA 4TPKA 3LOUA 1QVWA 2C3YA 4B87A 4CLXA 5CFQA 2A0XA 3HKEA 2FGKA 1ZVJA 2BT4A 1GADO 2BTOA 1C3LA 2NO6A 3WVNA 3K5HA 3KT0A 5C1BA 3GGJA 2OPHA 4OLAA 3QI7A 3RUPA 2BJOA 4JVNA 1XMSA 1Y7LA 4RGQA 3S4YA 3MJSA 2XDQA 1C7JA 2J46A 3S8YA 4B46A 2VKTA 5L7WA 5IYZF 3H8JA 3DE1X 3GGSA 4H6XA 4OUDB 3PGLA 3P7MA 4WCFB 3SS8A 5LQAA 3KYBA 4Z9AA 1IAQA 1ZNQO 2R8PA 2IH2A 3G7UA 3GJXC 4DUZB 2F9FA 2NZ8A 4TKMA 5DFAA 3RUCA 3T5GA 3LLCA 1LDNA 5CU7A 3OT5A 3AFIA 3TZHA 1K2VN 4O1MA 4EA9A 5IH7A 2CB9A 1J5XA 3Q88A 3PC2A 3S8MA 1LLUA 1NJI2 1U8FO 4MONA 3EODA 3PUKA 3QFFA 1N7HA 4FQ8A 4US1R 2Q1WA 2WJ4A 4JOBA 4LFCB 4XIIA 4ZKDA 5G0UA 2QTRA 4NKRA 1XVVA 3CH4B 3GRAA 5AW9A 1IJFA 4OIMA 2C9MA 3O73A 5DEOA 2C4TA 4JL8A 3MLEA 1B93A 1LQUA 3AIMA 1P9OA 3MFQA 1SEVA 1VRVA 4MKRA 2PS0A 1CYDA 3FETA 2WZBA 4TLDA 4F86A 4C2BA 4NQZA 2VAPA 2XMRA 5E4TA 3FSGA 1ZH8A 2QT1A 1X1QA 2K5RA 1V43A 4OQXA 1RC8A 2IUYA 1NI4A 2CVQA 5JSUA 4KIUA 1CUIA 1URPA 3W5SA 2QX8A 1Z62A 1Y34E 5BPFA 5DM1A 2KE5A 3A37A 1II8B 3DE5X 4Z6KA 2V96A 5JG7A 4D3ZA 4IMRA 4X1YB 4BZXA 3SIXA 1EAYA 2HTFA 4I55B 3H9QA 1IZ9A 3DG9A 3ANSA 3HGTA 5KQRA 4PX3A 1M2KA 2X9GA 3CNQS 2H17A 4FMDF 3OSUA 2R8BA 4OJTA 1FU8A 2OGUA 1RC1A 3NJRA 3C7CB 3PXCX 3NHRA 2CHGA 4MDYA 2I9KA 1US8A 5FA5A 3A3YA 2AD5A 4JBLA 3H3VJ 1UP4A 2B8NA 3IBYA 4K9MA 4WEOA 1CJSA 4QJ3A 2GN8A 3QVWA 2HXGA 3F5DA 5KYKA 2G3YA 2O5VA 3IUNA 5LP6C 1UZMA 2JJ2A 3SEZA 2QRLA 3NDPA 5JHGB 3AFMA 1YKGA 3EGEA 3R5JA 4MQEB 5K3EA 3OEEA 4XSGA 1PJTA 2B5VA 3CNLA 3G82C 3M6UA 4N12A 4YJHA 4ARZB 4EKGA 5L3SB 4D6XA 5ALDA 1T15A 1ZGGA 1Z0SA 1HMYA 2ZS7A 4WY5A 3UJDA 2IXTA 4L02A 4NVRA 5EE9A 2FZLA 1P9WA 2RH4A 3WBJA 1DO0A 4YRLA 3H5NA 3HFJA 1YDGA 3EA0A 1TK9A 2ZT8A 1MAVA 3GMDA 2C4UA 3A1SA 8OHMA 3DDNA 1RXEA 3IVMA 1IN5A 2W7TA 3G88A 3W6ZA 3VPFA 4WFIA 3OF2A 2CXRA 2GZ1A 4TTPA 3FPSA 3OI7A 2EVWX 5KKNB 3QXJA 5D5QA 3RNOA 3FNRA 1KI3A 2NSJA 3FI9A 3BFKA 1VQL1 1JIQA 3D7MA 2XUHA 3HKCA 1AT1A 2V0CA 1RMTA 2B5WA 3I6IA 3K0FA 1E1KA 4OATA 2X2OA 3D3JA 3HOWI 5HWSA 3IFUA 4LJRA 4XGNA 4A0GA 4KRXA 3D7NA 4JVSB 2QLVB 2ZWVA 3CLRC 1G2QA 3NBZC 4LTNA 2VPYA 3JSAA 3R5KA 5LN1A 4XWWA 4NWIA 4P5EA 2X9NA 2IC5A 3KXLA 4Y18A 1MRZA 3ZJYA 5A5FA 1W5BA 3HP4A 2DTDA 4YCJA 5JCXA 2W42A 1CR6A 1X3ZA 2ZREA 4MR7A 3D9XA 4XVHA 5EEHA 5FUBA 3HI4A 3SE0A 2LE0A 3SIRA 1O97D 3A3OA 5JNWA 3FNBA 3JWEA 1UXKA 3KG2A 4OF4A 3LRTA 2GOYA 3QYJA 3HOXI 1Y89A 3NDRA 2D1SA 4KXLA 4P3YA 2A0UA 1JSRA 2GJ4A 4M1MA 4RETA 4QAQA 3RFCA 4EA7A 2XXAA 2O59A 2G70A 1D2MA 3E03A 4EWLA 3JRWA 1G98A 4WIAA 4A2WA 4H1VA 3FBWA 4QHTA 3MXTA 4RPCA 3L0DA 2VJCA 4LZOA 3FFXA 2QLMA 5L51A 1UWCA 1BKSB 2BCGY 3ZHXA 3CCS1 2FUCA 2H1VA 3O3OB 5DSTA 1GSAA 4ND6A 3OO0A 1BS2A 5BNIA 5KVCA 3NW9A 4U5QA 1C2TA 2EJCA 1NVKA 3KDSE 1KVSA 3HKDA 5FEMA 2VC2B 2GVDC 3FOWA 4AMBA 3TNLA 4CV0A 5FPSA 2PQ0A 1E9AA 2QD3A 4MUNA 3MELA 3EY4A 5FB3A 3OE4A 1NUAA 4EP1A 4AJ4A 5FA8A 1NASA 3O82A 3P0EA 4DNPA 3KUXA 1U28A 4TYPA 1OAOC 4CQMD 3R8XA 2MYTA 1LNSA 2DE0X 1H2ZA 1F12A 2Z30A 1PNRA 1RSZA 2DLNA 3EWIA 4EKNB 1O58A 4DBVO 4HGOA 1OA0A 3ZCRA 4BBPA 4BNUA 3Q9LA 2VT7A 4C76A 3D43A 4Y2VA 1I7DA 4BMPB 1T29A 3M1AA 2Y1FA 1KP3A 2O20A 4JFRA 3X44A 2FUKA 4JA2A 3HGMA 1D6MA 1JSZA 1YCHA 5IBCA 3OEHD 3GR6A 2OZEA 4BWGA 5IABA 3IEVA 1WSWA 3UMSA 1TYEB 3PZRA 2XJ9A 5FIUA 1N8TA 2VJDA 4BDSA 4LSWA 5IUNC 2H3HA 4L8GA 3TVTA 1AKWA 3OZCA 4GSYA 3KKKA 4Q19A 3AQIA 1KEEB 3W9YA 4DQXA 2A9VA 2QRHA 1PJCA 2ZB2A 4I1IA 3PFIA 1P4RA 1GPBA 4NZPA 4JLAA 4M1TA 1RXYA 3F71A 4JR2A 4DW8A 3H1TA 4DY4A 2PGAA 2PGOA 3BGWA 3TOVA 2ZRNA 4MXUA 1K5DA 1TKCA 1EFDN 1DXQA 2VUUA 3IX7A 3MJCA 1J23A 5I7SA 4LYEA 1DDOA 3B51X 4AMUA 2IZZA 8AT1A 2JBHA 5SY6A 1U7DA 1VI6A 3HXKA 4YX9A 1YONA 2P28A 2M6NA 2FR1A 4FPXA 1E6MA 4MB2A 5B3JA 3G2PA 1DWUA 1I3NA 1P6UA 3G89A 1Y4SA 1LVUA 3QPAA 4FW8A 4FYIA 3VTFA 2AMJA 4C3OB 3AEKA 4YB8A 1IUKA 5J2TA 1CUZA 3DXYA 4H6WA 4UD2A 1R2QA 2VDQB 4HZIA 5T8KA 3DT8A 3G2IA 2G76A 4RLHA 3CMMA 3JZDA 1T3GA 3L7KA 5AH0A 3G6EZ 5DGHA 4CF3A 2YADA 1C80A 3R5HA 1IB6A 5DOZA 3K4HA 1MO6A 2F8LA 4CMHA 1KA9H 4OL9A 4PSKA 1G21A 1GA1A 1L7XA 1Y9JA 5AW4A 2WIJA 3AESB 5BSRA 4UU7A 5IWAB 1ST3A 1QOQB 3AY0A 3PNPA 4QOGA 3I6ZA 1IHYA 5G40A 4F9GA 1QU2A 2HHCA 2X9VA 2YCLA 1MX3A 4K26A 1BKDR 1K3UB 1L7QA 2RDMA 3IUEA 2QRMA 2VXOA 1Q91A 3WL4A 3RR2A 4CF7A 4BMOB 1PT7A 4MW7A 3K0HA 4GMGA 4I4LA 5CCBA 4D45A 3S2GA 2G1AA 3QVXA 1Z45A 3HVHA 4L08A 3HGQA 3TLYA 1UK6A 4MMXB 1U1EA 2X8BA 3LWNA 2PBLA 2GA8A 3IX0A 1RAEA 3EQ6A 3WE7A 3GT3A 1ZK0A 1BHSA 2DHDA 3PJGA 2X58A 1TM4E 4MV4A 4WVFA 5FD8A 3U3JA 1H4TA 2YICA 1GPWB 3WB9A 3WDSA 1IBKB 1EEXB 1X7XB 2N47A 4MVJD 4NU6A 3O8RA 2EQ5A 1CSEE 3HU3A 3PT5A 5T4BA 5EMJA 3G59A 2YVQA 1LSJA 1UEJA 2OLKA 3BWBA 3KQOA 4L8LA 1SK8A 4PHCA 1XLUA 5H80A 5ILGA 4QWWA 1G8JA 1H93A 1XC7A 4QTTB 3H5VA 2ONZA 1AK1A 3RYIB 2H2IA 5ES4B 4E5SA 1JTEA 1Y5RA 4FCCA 3LUSA 2CLOB 5D7NA 1G8GA 3NRCA 4LJ9A 3AHHA 5TLSA 2CNNA 4N7JA 5ISMA 4GUDA 4HQ6A 2YXPX 5BSFA 4WK4B 2D59A 1P3Y1 4Q7MB 3ICWA 4WNAB 1T0UA 4KN9S 4ZO7A 2AMYA 4CQMB 2XCRB 4CEIA 1M5RA 1NC3A 1N7IA 4HC4A 5IH3A 1MAHA 2FKAA 3ZE8A 4MUYA 3OW2Y 4HWKA 5LU8A 2CYBA 5JXHA 1XP5A 4GKKB 3A04A 2FR8A 3WK6A 5LQRA 3T7KA 2P5YA 3DUWA 2J3IA 1TAGA 4UHEA 2UXBB 2AI2A 1TDJA 5F64A 3NGMA 3ROGA 3UJCA 3EF3A 4NU0A 1PAUA 4DV2B 1BQEA 4C3ZA 2FUG6 3UCFA 2ZM6B 3HDJA 3HHEA 1P1JA 3TW4A 2O6LA 5EWJB 5KWSA 1FNMA 1WLYA 2WVGA 4A6PA 4RGVA 4AJOA 1M2JA 4F12A 2BOVA 3CF6R 1KK1A 4HLNA 4OPMA 3E2MA 4DSUA 4F4UA 4ZCMA 1V96A 1WTAA 2XY4A 1CEQA 2WSSA 1D6SA 1UAYA 3QIVA 4G5YA 2JLUA 1AU9A 4WERA 2O2CA 2ZTHA 2IV7A 4EFNA 2SCUB 4LI3X 4BY9E 1DKLA 1M5TA 2G1JA 2PSEA 3A6LA 3AF1A 4KWHA 3SLKA 2AN1A 2VTVA 3SSMA 1THMA 5HEKA 3I61A 1PV4A 1UJCA 3D1LA 4RF3A 1XA3A 2XYGA 5J47A 2HF9A 2LD4A 1QVVA 1E7RA 2OQVA 2QPTA 4Q1EA 1NQUA 1SUCA 1UKAA 1K06A 2Q4ZA 2DWQA 3MWYW 4HQRA 4BJ5A 4KPUB 4MQ4A 1E5QA 2X1HA 2W6OA 1ISFA 1R3DA 1SVIA 1VZ2A 6YASA 2BTQB 4O2LA 5AICA 3MTGA 1D03A 3WNVA 1TZMA 4BVFA 3EJ6A 3I12A 4B3MB 3TDKA 1THGA 3HVKA 1KI2A 1MQAA 1QKJA 2KYRA 4KQ9A 4TT8A 3RK4A 4BNNA 5HG0A 5B4TA 1XNQB 3JAKA 5D6NA 4B80A 3CPHA 4FFOA 5JY6A 3O4IA 1NNEA 3MMNA 3PUIA 1KY4A 3S2FA 3PLAE 5LQDA 1DRUA 1NVDA 3PEFA 3MG9A 1TI7A 5L7TA 3ABZA 4U02A 2BCEA 3WB1A 1OBOA 2X9LA 4GU5A 2R87A 2RGUA 3BFPA 3OLCX 2PH3A 4LQLA 4M0LA 1XU4A 1XCPA 3IT0A 3UUWA 4C3UA 1R4NA 4KYIB 2X3FA 3A6DA 1WW3A 3WADA 1Q0LA 1TO1E 3RC2A 3M3PA 4RO0A 3TTXA 4ENPA 5BVHB 1I6MA 3ZXSA 4OHMA 4DDWA 3MJTA 4ER7A 2IPMA 3AY3A 2G9QA 1IONA 4FOTA 3C4QA 5FUMA 4JQCA 1I24A 2FMHA 5G2OA 3IP3A 4BVBA 2ANBA 3EZNA 3IOCA 4JJZA 3S27A 4AJKA 2ZJ3A 3O2NA 2O50A 3CG0A 5AJTA 2NUAB 3RJZA 4FMCF 4ND5A 4FHGA 4GVLA 4UUQA 2JHGA 2B1JA 2QNIA 5DTRA 3U3OA 1MO5A 1L4BA 1Z5UA 2HT6A 5ELMA 3IIKA 3HY4A 1ST2A 5FLEX 3ABRB 4G1BA 2Q28A 2HSJA 1ESMA 3R41A 2JKVA 4R41A 1RXIA 1V3VA 4A8HA 4HDQB 2WYWA 3DAOA 1Y3FE 3TSCA 4BTVA 4CU2A 1PT6A 4OHKA 2QRQA 1YR7A 1WBBA 2NO1A 1AUOA 3X3HA 3S2HI 1WXFA 4FZJA 4W8GA 3VXKA 1FUKA 2D0IA 2WF5A 1CERA 2ZE6A 1QO9A 1QH0A 2QMZA 2Y3IA 3A36A 4YDRA 4DJFC 4PG6A 2BSQA 4NXMB 5GVRA 5IBQA 5D84A 3U1VA 2IPXA 2SECE 3R20A 4RGYA 1NXPA 2R7ZI 2GJSA 2R7LA 3TYXA 2B94A 3C98A 2IX9A 3OJCA 3KQWA 1NY5A 1U2ZA 1G6KA 2FE1A 4AKGA 3THRA 5DRTA 2WMOB 1FVXA 1CQIA 5EXDA 4B3BA 3ML1A 2ZIUB 5ALHA 5D85A 5BSKA 2WD8A 5AI5A 3KB8A 5FNVA 1YB5A 3GFSA 1KRLA 5DGXA 5EWMA 2CMKA 3W2FA 4GYWA 3T1TA 2CLLB 4YCCA 4BFZA 1YZYA 2E3JA 3O4JA 5JQGB 3FM9A 5F4ZA 3DCYA 5C3EI 3IJRA 4GHWA 4PYQA 3CC2Z 1GPH1 3EQ2A 1EESA 2C7QA 5J3JA 2OVFA 4RSGA 1JE1A 2C29D 3OIFA 3WX0A 4DDMA 2VDWA 4O4HF 3E22A 2LDXA 3EWNA 4WNIA 3D4IA 2C2GA 2PYIA 4S2UA 2I87A 4TTJA 3GLFA 1SOVA 3RYTC 1NJ8A 2A4KA 2GO7A 2HREA 3KSDO 4MGEA 4WOKA 2QREB 4B3XA 1ZGCA 5MHTA 5ALRA 4U00A 4RPKA 2ZWPA 3FDIA 1AQLA 1L4EA 4P1ZA 3BIWA 3T54A 3FSGD 4PHTA 2I34A 1TU3A 1UR5A 4PGGA 4QEKA 3LK7A 4MLPA 3SQNA 4KDRA 1TWCI 2VDNB 3C6YA 3G0GA 2C54A 4C01A 2WE7A 3KQQA 3UANA 1BXRB 2IT1A 5AO9A 4R7GA 4BZZA 1NVFA 2ZYTX 3IMFA 3UT6A 1JNYA 1R6TA 1RWWA 4V0LA 1JMKC 2V7BA 1FBNA 4C29A 5FWNA 3A2KA 3R77A 1X15A 1QK4A 2PEZA 1D1QA 3NUGA 4KP7A 3MJEA 4W9NC 2DPMA 5KSZA 4AWXA 2P0YA 2OESA 3K92A 1S2LA 1RQFA 2GCEA 1ULTA 2VPWA 2DFDA 3RBZA 3DLCA 3T34A 4BKMA 1QP8A 4DABA 5DTJA 1U9IC 4ZOBA 5AHRA 2H2GA 1SCAA 1ISSA 2CLHB 4OHZA 4ETNA 1GP2A 1DTWB 2ZDGA 2HIGA 3GEHA 1U4SA 4WLOA 3STVA 2QAGB 3WNQA 1MT0A 4LDRA 4ZYVA 4XQ0A 4QJ5A 4RMGA 4DA4A 2JJ2D 1KFCB 1LPMA 4UXJA 1DKRA 2I3AA 1RWBA 2D1FA 3DR3A 3L0PA 3PQCA 3MMSA 3OEED 3S2UA 2LCFA 2FP4A 3SZRA 5LKAA 2AHOA 3K9CA 1RKVA 3LG2A 3KFVA 3PR2B 4L5AA 1PQWA 2QMYA 1YK1A 2ZITA 4AICA 2JCBA 3N2KA 2JAWA 1KU0A 2FETA 4G2TA 1G63A 3UH0A 4ESOA 1SCDA 4FZ5A 4AX8A 3HOYI 1MJGA 5C8XA 3THWB 4BB0A 2BCJQ 3LP6A 2KLBA 4JBYA 2IS4A 5FBRB 2XUOA 1K7CA 3AM5A 2E6KA 5ITSA 3B12A 5K3AA 2OAEA 4K9SA 1KAOA 3OOYA 1YT5A 2FPOA 5F9HA 2QRPA 2R44A 2QPLA 2D0OB 1ZISA 1F3OA 1R18A 3WL6A 1UBJS 3AUKA 1SZDA 2R0QC 2GBCA 2DQZA 3T7IA 4QQFA 2Y0SA 1X9HA 3LP8A 4WBNB 1LBEA 2BJWA 3IPLA 1N2XA 1Y6RA 2HK7A 1GXSA 4V0ME 5TV2A 2PK7A 4KPGA 1DADA 5B30A 5LZ4A 5KSWB 2P79A 5FA6A 2VXBA 2Q0XA 3TCNA 1XRLA 4FZRA 4YO8A 1KBZA 1ZVVA 1J1ZA 4X1IB 3RBXA 1V9SA 2PIAA 1W2BY 1KNQA 5JY1A 3IQZA 3H18A 2X6RA 4WN9A 1YFJA 3RG8A 4M9CA 4FGJA 1GQ2A 1YRAA 3O21A 9ATCA 2WSYB 2PH7A 4JGBA 1K68A 1KI6A 3W9SA 4LJ4A 2OAQ1 1AY0A 3B3FA 4O0LA 4L95C 3CRNA 1NR5A 1GARA 1QG6A 4BVLA 1DOAA 2YNMA 4PIMA 2HJVA 2YHIB 4A0RA 4X62B 5JE8A 3JAMA 4LFBB 2C31A 3ZV3A 3WJAA 5AOBA 1U1CA 3LVRE 4BX2A 4R1MA 1KO5A 4JXJA 3ZZMA 4L7QA 1JIVA 1V6SA 1QIGA 1K63A 1DKUA 1Z74A 1AE1A 2PLRA 3ZHUA 3OLZA 1UJ5A 4G6ZA 1VLMA 1W30A 2FXIA 2W2VA 1E2JA 3K2IA 3AF4A 4Q1FA 4ATNA 2ISSD 3MUOA 1A7JA 2CUNA 2REXB 5I4KA 1E7WA 1V9LA 4REOA 1NI4B 3NHZA 2QS9A 3VOBA 2Q99A 2DOKA 4GXQA 3WZ2A 2B4YA 5CLHA 1ENPA 1NXSA 2X19A 4Z8XA 1WA5A 1DIHA 1MH1A 1YR2A 5CCXA 4G3XA 5E7QA 3LW8A 1PHPA 3C6MA 4BO1A 1NAHA 2XMGA 2FPMA 4LYDA 4BTEA 1NVVQ 1XVLA 2WZCA 4MUJA 2H0RA 4TKLA 4U6SA 3BXXA 4LV6A 1LZKA 1DT5A 2ZP1A 1TTTA 1EZ4A 3WSVA 4XQGA 2H6EA 1ZHOA 2IK8A 4DLBA 4E22A 2GPNA 1DBSA 4MGIR 4TXLA 3RAJA 5JEDA 4NIMA 2C7VA 2PMBA 2PKQP 3NANA 3ICOA 1P0FA 1US8B 1BDHA 4M98A 5JD4A 4IGFA 2GN2A 2G5GX 3GARA 1EKXA 1H0SA 3HBFA 2WWVD 2EARA 3SM9A 1W4ZA 2CHEA 3D6AA 1KD11 1SXJC 2P4QA 2NVWA 3CNBA 4P82A 4HMPA 5KNBA 1ZKMA 3Q7PA 5BR4A 1H4VB 5BN5A 3JYLA 3DMTC 5CK4A 1XVAA 4P81A 1ZD1A 2DP4E 2WWHA 4YMVA 2IH5A 2Z2XA 5F3WB 5F2EA 2B1RA 3PP8A 4W1PA 2G28A 1A8HA 4TVSA 4BQRA 1H4QA 5BSUA 1SCIA 3S5UA 4W5JA 3I9FA 1BXGA 2ZR7A 3GWZA 5ALQA 5E8JA 2X5XA 1SHLA 1GPJA 2NSHA 4LC1A 3TUZC 3SOZA 2ZIXA 3MWEA 1ULUA 2XD9A 3TW6A 4QATA 2W2LA 1BMQA 3CX7A 1YXMA 4YTEA 2ZIAA 3DCIA 3R5XA 5K8IA 4RAQA 5CXUA 2FF5A 3B1FA 4HSEA 4RKFA 3U7GA 3U4HA 3PUJA 4M3NA 1NJFA 3O84A 4V24A 3WKBA 2NQ2C 2CFTA 2H1HA 1AGYA 1BU5A 2CSUA 1F51E 5FQNA 5HK8A 2PNJA 4BNLA 5INTA 2EW2A 2AR0A 3H65A 5KYWA 2ZYVX 3QWUA 1Y5IA 4G9EA 4ZOCA 2EOAA 2DE6A 3TLBA 2DWPA 3N39C 2FSFA 2PZJA 1YITZ 3O8OA 4EMBA 2BH2A 1FYDA 4LKOA 2I3BA 2JIRA 1VGVA 2IHVA 2YWCA 4J0GA 1V3TA 3I2FA 1ZR2A 1W4RA 2QTFA 3CT4A 3TAUA 3C6BA 1GG9A 2WJAA 1HEYA 3NMUF 4F8EA 2ZJ2A 1GRNA 2Z56A 2BP7B 1S7GA 3JWPA 3OTIA 4HAYA 4JN6B 1HTTA 1AKNA 1XAIA 3EFBA 3DMGA 4P33A 2XGOA 4RFSA 2KJQA 2BFCA 3R9IA 5K8TA 3JAMf 2PKYX 1WDLA 2X0DA 4R8MA 1FMJA 3LP5A 4BLVA 4ED9A 1SQ0A 3CEHA 4XR9A 4R54A 2RG1A 3D0RA 1LQLA 2HEIA 4NE7A 5IKOA 1QHNA 1EAMA 3JVUA 1CPYA 1UBKS 2H4XA 4Q9IA 3U9TA 1MVLA 2NWQA 2AKYA 3LHSA 2JANA 4V0RA 1QKKA 1P1FA 4JB2A 4QTZA 3FYCA 3EE6A 3DVSX 1V7CA 4MQ5A 3A2LA 1MEJA 5KQSA 3HKDB 4KC0A 1V4BA 4P6VF 2XVXA 1RQ2A 3PO3S 1RJDA 4J0DA 1H66A 1JG2A 2CMFA 3CF0A 1FUUA 1DG1G 5EE5B 2H1OA 1FW8A 3CV3A 4BNGA 4BRSA 1VE6A 2PVSA 3A6HA 1KR5A 5EIBC 3Q5EA 4KL8S 5F5NA 4BNXA 4E5YA 3JYOA 4DMRA 1JF8A 1MMFB 4ZMRA 3HRIA 3AJ8A 4WMLA 3CCL1 1RRFA 1VQKZ 3LRPA 5CX1B 3Q12A 1G38A 1BA2A 2FHSA 2AI1A 3HXLA 1SQFA 1EGHA 4FFVA 4YWHA 2B35A 2XWBF 1N9KA 5I4IA 4RGBA 3CCE1 1JSLA 3PBKA 3BWVA 5EJ7A 1YKFA 2NZVG 5SZIA 4MP6A 3VMIA 2Y1WA 3RTDA 4QXMA 4LDAA 3CLTD 2P11A 1JIJA 5AKGA 4ME6A 1G8AA 2LBPA 4V02A 2BW0A 3TQOA 1U8EA 4TZ6A 1R66A 2OCIA 2FQ1A 5FEUA 2DETA 5K3FA 1X0TA 5K3CA 1X7HA 1CUGA 3VZCA 2RBKA 4FYYA 1RFLA 1U0SY 2JA6I 1KHTA 2H7YA 1FUYB 1QQ6A 1J8YF 2I33A 2NXNA 2V9ZA 4IHJF 5K3OA 1VXRA 1GTZA 1WETA 3QBJA 2HA5A 3VVBA 4CKWB 1Z0AA 2WSSD 2HDWA 2LIPA 2XB4A 4FN5A 2JA5I 1ANKA 1CE8A 1QFZA 4HN9A 3TLKA 3AP2A 2JFVA 4K5QA 1XDDA 3Q2KA 4NHEA 1RWOA 5IANA 2HA2A 4RIEA 1VG9B 1E2GA 4NFLA 2JFOA 3EFOA 3IOBA 5DIZA 3I04M 4P22A 2RGWA 2AC7A 3UHAA 2ST1A 3B1JA 1FQWA 1TYDE 4OSOA 1C8LA 4TLEA 1N2CA 2KI7B 4NBAA 5IVPA 2WUDA 3IQGX 3PVZA 1P4SA 1V4VA 3UWKA 1QOZA 4X61A 2GK6A 1XDSA 1Y1PA 2BDTA 4NC9A 3ROTA 4OL0A 5KQMA 4OQ4A 3ILSA 4DEVA 2ZSUA 3ADCA 2QHXA 2GQ0A 7YASA 2ID4A 2VPZA 2ODPA 4D9IA 2WM2A 4ESHA 3IS3A 3COPA 4P86A 3KQLA 4BKOA 1FSGA 2H54A 2J3DA 3FKSA 3PVSA 1MO4A 1B1CA 1G21B 1Q1GA 4XJSA 2ONCA 2V8KA 1FK8A 1VL0A 4LJ7A 3EPRA 2P8SA 3VDXA 4UQLA 1U3WA 3FWYA 5L3ZA 3ZZ1A 3UAZA 5FPKA 2AN3A 5FLKA 4YJGA 1CZOA 2GD6A 2PRKA 4FI3C 1BAPA 5DP2A 1Z0IA 5HTOA 1OI7A 2J0QA 3AUFA 5GJCA 3V4PB 1XLTA 3FDFA 2NXCA 3LWBA 3KR9A 1Y82A 3B36A 3K9QO 3R3YA 1JQDA 2DFKB 5KVSA 4QPJC 4J7AA 3L92A 2E0IA 1T2VA 1NF8A 1U7UA 3ESQA 3UJAA 1NKVA 3P26A 1WB4A 7MDHA 2WWYA 3KB6A 3QFCA 2IUEA 3HDTA 3QU2A 5I8ZA 1P0CA 1K8RA 4HLDA 5EKUA 7REQB 2NU9B 3AGQA 5JBQA 3UAXA 5AN9F 4OYHA 2D06A 4GL4A 3HB7A 3FTQA 3I9V6 4XXHA 3HUDA 3IHWA 3OHSX 3UATA 3OH8A 1VQ9Z 2I2WA 1W1WA 2FG7C 2V97A 5DI3B 3H1PA 1MRNA 2JDIA 3J7TA 4DLUA 5I9BA 3VDMA 1EFKA 4EGAA 4JSYA 2Z0MA 3ZWNA 4YALA 3QEMA 2FFBA 4PLVA 2IZ0A 3PF9A 2G83A 5L45A 1T2AA 1AKRA 2J5KA 2VYQA 3ORFA 4I1RA 5CMLA 3OKAA 2DUUA 2DXIA 2JFNA 4MUXA 2HF2A 4MVJE 4UM9D 3DL7A 4JA0A 5D01A 3NAMA 2QTCA 4A0SA 3HN7A 2F3QA 4HX2A 3ZCSA 1UMKA 4QHSA 3ELDA 4RK7A 2IVFA 2FY8A 5BUCA 1TF5A 1JKXA 3QKWA 4TOIA 4BO8A 4BZQA 5EVJA 1MPXA 4UHJA 1YS9A 2ZETA 2JFZA 4HGYA 1ORHA 4HRYA 3GEIA 3AW9A 3NFRA 4ZO4A 4EYQA 2WUGA 1QLJA 1WM1A 2QU7A 2FCAA 1RO4A 1QS0A 4IVNA 3TECE 2H0AA 4HADA 4TKZA 3Q3VA 4BXOB 2EZUA 2CL5A 4EFKA 4EQZA 1A7KA 1BWQA 1OTXA 1EUDA 3BQMB 2PT5A 1HKUA 3E5NA 1YL5A 2G67A 4RELA 2NU7A 4C7MA 1Q1AA 1RHKA 3V1UA 4EHHA 3GP8A 3EXAA 4C03A 4GOLD 5EE1A 3L9WA 3OZUA 1QHEA 1RKQA 5FOWA 3STWA 3V00A 3ROFA 4MA4A 4PTLA 3NM6B 2FPIA 4XX2A 1KMHA 2Q51A 5CURA 1NG1A 4KFUA 1XTSA 2LPMA 4X3CA 1RHRA 5D1HA 1EM6A 5LU9A 1EHIA 4DG5A 4RD0A 1AV7A 1UKVY 3FUTA 3JQ7B 2BPOA 3AEXA 4REQB 5DX0A 4IEIA 1PEDA 1XTRA 2Z3WA 4DTCA 2NVYI 2PRZA 3BRWA 3RZDI 1KVQA 2J3QA 1L4UA 4MQFB 3V48A 4AI6A 2PS9A 4I4TA 1Q16A 4O4LF 4RAOA 1N32B 4HD8A 1B6GA 2DPLA 3CMA1 2EF0A 3H2BA 1IOLA 4QG3A 4D6PA 5BYKA 1P2TA 3U3ZA 4G63A 3NUZA 4NB9A 3DV0B 2FZ5A 3N70A 3AUJB 5BN4A 1DZIA 3BGIA 1ZRNA 5JSFA 1EMDA 2XWSA 1SC4A 1M2VA 2C83A 2MMCA 3GV0A 1RBQA 4NBNA 4HB2A 5J2UB 4DREA 4KREA 3UH1A 4Y6GB 2VF4X 3U49A 1PJRA 3T3NA 1E0KA 2ZJYA 3ABIA 3UJ9A 2BJHA 4M1EA 5TDHA 4DGQA 1YZHA 3SF8A 1GT91 2R7AA 1I3QI 2IYFA 5IT9b 1CHNA 3NVMB 1M0EA 1I3CA 3SIPA 1R4NB 2K6GA 4HAUA 2G0NA 2PJDA 4URXR 1NULA 4RY9A 3ZW9A 2XZTA 3R3HA 3P0JA 5AKXA 3AT1A 2B3TA 4WUTA 4Q34A 4B79A 1JEAA 2C7BA 5IHPA 1F2UA 2DKNA 1O77A 1Q84A 3WLTA 4UBJA 2IUFA 3U7HB 5AUQA 3DEKA 2PXHA 2VDUE 1HDOA 2QUHA 3OLQA 3D0QA 1DLJA 2R00A 3E84A 4LKRA 5F2OA 3F4BA 4Q4CA 4NBHA 3A1NA 1C5KA 3IAHA 3PI7A 4L0DA 5DHSA 4DV1B 2ZRKA 3DAYA 1E9EA 4BLPA 3IKVA 1CFZA 1CKEA 2CXTA 3SX0A 3LF2A 1KTVA 2GPWA 2J3JA 2DMRA 3VOTA 1TCVA 2EZ9A 3C8ZA 1XMIA 2AIRA 4HNUA 3U62A 1QE5A 5DP1A 1EWRA 2BWJA 3K0CA 4X6YA 1TIPA 4TSKA 3B2EA 2RIQA 2FCRA 2XMDA 4OKIA 3IE1A 4YDSA 1QC5A 2HT1A 1HFJA 1YU9A 3JR7A 1EEHA 2GF2A 4IZOA 2RH5A 2ZBPA 4CMAA 1P31A 5EJ6A 2XE8A 4PFQA 1SXJE 3L1HA 3WXBA 5I8WA 1KGDA 1P33A 3TW8A 3I4MI 4QSHA 3KAPA 4E31A 2HNKA 1Y1WI 1MENA 2ODEA 2OBYA 2VI5A 1XTVA 1DG3A 3GZJA 1XDUA 5GADl 1UC4B 1OZ0A 3ADKA 3LCRA 3QG1A 1FMFA 2FF7A 2YFHA 1SG6A 1R0BA 1G41A 2KBEA 3IP5A 4TWIA 2XUQA 1CQIB 4ZAYA 3TDMA 3UMCA 5KEIA 3V4RA 3VKFA 4UM9B 1Z6AA 1P81A 3BXFA 3I30X 1DP4A 2AI3A 2C57A 2WJVA 5FNVB 5HCUA 4KQGA 5EWMB 1V11A 4GVXA 2J0SA 3EVNA 4U9IS 4OQLA 1RQXA 3T52A 3TZQA 3OJFA 2GH1A 1A2OA 2GJKA 3Q5GA 221PA 1DFIA 3L7YA 1C9NA 4KRFA 1YJAA 2C61A 1LPAB 2I0FA 4FTWA 3WGIA 2ARKA 3GTLI 1P5ZB 2P77A 2VYNA 3ZX4A 2VHZA 3LVFO 2YNMD 1OBHA 2QZJA 4B2LA 4FYMA 4YGXB 4D80A 1LV7A 2LXNA 3E22B 3PCXA 3D7RA 4L9SA 3DGEC 4BLQA 2J7PA 1D1SA 1OX4A 5FFFA 3BD9A 3UWSA 3EPJA 4MHTA 5C7LO 1EJ0A 3U13A 4AP5A 4KITB 5EJGA 3GROA 1PGJA 4YAGA 3PFWO 4GOMD 4JJGA 3KFLA 1L6IA 4M0CA 1T1GA 2Z6VA 3EHDA 3ZH2A 4DIMA 3ZCVA 3IPXA 4Y0VA 2FFRA 4KAFA 2YZKA 1SUSA 1LBTA 1RPJA 2XKAA 4KQCA 4MOWA 1OFHA 4LHYA 4LRQA 3WNDA 2RONA 2Z5VA 3TSOA 3BIJA 4LSGA 2GM9A 2RIRA 4QBGB 2EHJA 4OI1A 3NZEA 1VJDA 3P2JA 1FP6A 3GTGI 2QYOA 3CIOA 3ZE2B 6LDHA 3G2HA 4ZU1X 3QELB 1BHQ1 2QPOA 1GYPA 2XI4A 1HNNA 2ADMA 5BORA 2WKQA 1M7GA 4CR7A 1L4NA 1U3DA 1V5IA 3UCEA 1P80A 1N5IA 5AW5A 4RQTA 4B44A 3STYA 1KXZA 1RCTE 4QJ4A 3A9CA 4MCIA 3RBAA 3ZWVA 4AYXA 5AT1A 5H3CA 4EI2A 3VKHA 1AZTA 5BXQC 1VM6A 5GAJA 1RI3A 5GGYA 3IR7A 1M9NA 5HZKA 5E38A 2R2GA 1PWHA 1U2TA 2O2HA 3JQ8A 4LHWA 5KAPA 1PUJA 1LBHA 4AZ0A 3DYIA 4BXXI 3IUYA 2C9BA 3HDHA 5IXYA 5JUWA 3IHLA 1I2BA 3TZBA 1G66A 4HEA6 3WYDA 4B7ZA 3EOAI 4RCVA 3VYUB 4NPCA 5FXMA 3K0KA 2JA8I 5D1OB 4FBGA 4UCWA 5JNUA 4RBNA 1ZCBA 2UZIR 4JX8A 4QU0A 1D0SA 4YN3A 3IV6A 4NJEA 1POWA 3T9CA 1LK5A 4BNFA 4LWZA 1E2MA 3ILXA 4LXGA 3I73A 4JLWA 5E1DA 4MVJP 4L22A 4JK3A 3II6X 4ZPXA 1MUUA 1EDZA 4QX6A 4B9EA 5JAHA 5BYAA 4DSOA 2PA3A 2A9PA 5E2AA 3TJMA 3L4KA 1CR1A 4UJ3A 4JHLA 1QK5A 1KORA 1L7BA 3IERA 1Q1QA 1DBQA 1K7FB 1VPLA 2W2LD 5H70A 1GAWA 1PG2A 4XUCA 4D5EA 1AKEA 4HLUC 4PRLA 5DXFA 5HBRA 4EDHA 1BCRB 3HNPA 3P2EA 4GZLA 5BN3B 3H9BA 4F2DA 1GCUA 1G8YA 1FA9A 2O7VA 5K5EA 3ER8A 1EU1A 1G8HA 3CEMA 1QSGA 2GETA 1DQSA 1A72A 1XVIA 3CLUC 3MERA 2WVJA 3ED5A 1BRMA 1N2JA 2DBZA 2O1XA 3DTNA 1QZZA 5C1IA 4BLRA 1GKUB 2JA1A 3PEEA 4AD8A 1ZJ4A 4IIHA 2WWXA 2JVKA 1R16A 1EBFA 3K09C 2IHJA 4FVTA 5ESRA 1WOMA 4RF4A 1RLOA 4EKEA 2D74A 4LTDA 5L8VA 4LOHA 1XPUA 1U0RA 2ZBFA 3KB1A 2D0PB 4NONA 2YASA 1VB5A 4IDPA 5DM4A 2PPLA 5EGSA 2ZVQX 4WN9B 5FDFA 2P4SA 2BEVB 2YUTA 4DAOA 6PFKA 5EZ5A 1Y3AA 3VDRA 1YDEA 3GXOA 1JG1A 1T9GS 4PHHA 3SN6A 4BNYA 4ENWA 5LMCA 1GTVA 2JCGA 4BQOA 1LPPA 4HWOA 521PA 2VWHA 2P68A 3OM1A 4TL7A 4MV1A 1VQ1A 3N8KA 3VDNB 3AEQA 2IEAA 3THOA 1PS0A 2QYSA 1SG9A 2DY1A 1RZUA 1CUJA 2GBFA 4DC9A 3AILA 4XM1A 4AY3A 5ALTA 2QA4Z 3I62A 4OMUA 4L28A 2VQ6A 1ISPA 4BO3A 1IM2A 3D3WA 2DT5A 3V2GA 2HYDA 1II0A 4BEBA 3MS2A 3ZYZA 1F2DA 2PBRA 3EA4A 1KVUA 3BF7A 3OPXA 4N01A 1N5RA 3FHTA 2WYUA 4KSBA 1H65A 1T4CA 2WRZA 4YXWA 4B32A 3BE6A 3EIUA 1Q0UA 1QF8A 1EVZA 1I5EA 1N2GA 2MWMA 1AIPA 4BJ1A 2BF7A 4Q3NA 1J2RA 2TMDA 1U4NA 3KLPX 4RORA 5LUAA 6ADHA 2FW9A 5ES3A 2WG1A 1E7QA 3ZU3A 1B14A 1EWTA 3ZJTA 1I3LA 1YTUA 4UMVA 4MYSA 5C46F 3SR4A 4KQEA 1QGAA 4HTFA 3WQQA 2R6MA 4HATA 4BBRI 4MWEA 1GPLA 2JR6A 1UBFA 3DE3X 4PXAA 1NUIA 1SCJA 1SVOA 1BOFA 1J0BA 4KXYA 3U17A 4IGEA 2MSEB 2I62A 4D2IA 1GUDA 5DYTA 4DLLA 3KX2A 3QPUA 5KJCA 3WA6A 4YYZA 3NU1A 2IU4A 5K0GA 2PGNA 2B9VA 5IAEA 3SYRA 3RANA 3B20A 4N82A 3BJMA 4IVRA 2C99A 2QG6A 1PFQA 3V1TC 2R4UA 4BNDA 5F76A 4BECA 4HEHA 3I6BA 5J43A 2QBYA 1SFOI 1P2BA 2ZXFA 1O87A 4PQGA 3GLRA 1GPUA 1XEWX 2AEFA 5HM6A 4NBRA 5BN5B 2J59A 4CDNA 1LVHA 2SKCA 3L49A 4W82A 2X41A 5JDIC 4MV5A 1WVGA 1DUSA 1W9MA 3WK9A 5AW0A 3QOFA 1SUWA 1S1MA 3KD2A 4NMLA 1T9BA 2J09A 1BXGB 1H8ED 1DL6A 1QIMA 1SUDA 2JS7A 2VUTA 2A5JA 1WOYA 1RWVA 2O3RA 2PV0A 2XGMA 4LI0A 2ZYHA 1Z5PA 2V45A 2V3VA 2NT3A 2CE7A 3KPVA 3MRSA 4R8RA 1MB3A 2ZIXB 4ZI7B 3PUWA 2RHBA 1CDEA 1DAFA 1QGDA 1SIUA 4K81B 3REGA 3TRHA 3HO8A 3NH9A 5A5VA 3OPYA 4HDOB 4F3TA 3OESA 2GEUA 1U1FA 2GHTA 2ZBDA 4JLDA 4YRCA 2HIMA 2GARA 5MN4A 3AOEC 3FKSD 2VEDA 4GBMA 4OHCA 2VLIA 3ENKA 3FIUA 1VG1A 2GM3A 1R5NA 3IP8A 3N2ZB 4H3KB 2CUKA 1YCFA 2JGIA 2XT9A 3JD4A 3GGGA 4BYMA 1SKMA 3FNQA 5JMPA 5KYWB 4QU5A 4N41A 4HUTA 1OH8A 1E0DA 4HDMA 2F4MA 1HFEL 2QY6A 2XCIA 3JWGA 2NO4A 1TUEA 3LNTA 3IVXA 3QJYA 4DPKA 4AKHA 3DE7X 4JT9A 1M72A 2VHEA 1CY4A 2WIDA 3B38A 3BH0A 1HQYE 4A3KI 3E82A 3OUTA 4LDNA 4OQFA 1KI7A 3OJLA 1L5KA 1R6UA 3ITKA 2EKQA 5KWEA 3OFNA 2HMUA 4XX1A 3U09A 3KTAB 3VNSA 4EWCA 5DHRA 4FB5A 3WC4A 4FSDA 4HWTA 3JARA 5KSYA 3OQOA 1NIPA 2BFCB 3Q1LA 4BFYA 2FP3A 2IUSA 3CUSA 1TCCA 2X0JA 3NH6A 4IKPA 3CEPB 4PG4A 2I6GA 4CL2A 5LMNB 1P1BA 1U2QA 3Q4GA 1K6JA 4BVJA 4ERXA 3K7AI 3ZD9A 1Z4KA 1KOJA 3EGXB 4D8UA 2VT6A 1W8IA 3ZDBA 5C0OE 3KZCA 3SNKA 2XMBA 1JDBB 1K7YA 1ORDA 4CWAA 2Y1XA 3CNNA 1D3AA 1C8BA 2Q6OA 2IP2A 4LDZA 5KTTA 3GEBA 4KFTA 1JNXX 1JG4A 5DI9A 3QMMA 4TTTS 5EIOA 1R0YA 1MGOA 1E0SA 4AJLA 2I3ZA 4MUKA 2W03A 4G5XA 2OFOA 1W44A 4YACA 1VPEA 4EI9A 3JQRA 2XCLA 3FPKA 4IHJA 2YJZA 5E2IA 5IF3A 2VZLA 3BXZA 4D3SA 2DUJA 5AVOA 4EZBA 3C16C 3EGWA 3ZLJA 3LY5A 4B4DA 3CKYA 3PKIA 1JLKA 1JU4A 3TPFA 3CW8X 2O4HA 2DQKA 3A3NA 1Z2DA 4ARCA 3GJSA 2FSGA 2A0KA 2AN9A 3KKMA 3T0GA 3M1IA 3D6TB 3O83A 4K1LA 4R2HA 3STTA 2AB0A 3MTIA 3OU6A 4BGIA 4FFPA 3ROXA 4C0AC 3HCRA 3Q98A 4PSUA 3P5JB 4IJWA 2XKJE 1CC1S 5B36A 4B7CA 3DB1A 1JLMA 1T10A 1NV8A 2GBLA 2Q3JA 2CXSA 2ZS9A 5K3FB 3VX4A 4CL8A 5A5GA 3U0BA 1NGSA 2HU9A 4KR0A 3S2YA 4E33A 2NVOA 4F5ZA 1GCAA 4HWGA 4F60A 1NPYA 2BSXA 2C78A 4QKQA 4YONB 4PGFA 1PF7E 3MUNA 3VPCA 1XI2A 1M76A 3S68A 5K01A 4Z49A 4I4IA 1YJQA 1XTZA 2YS7A 3P2OA 5K09A 3F6CA 4TMFA 4CM9A 4C06A 5TQ0B 2Z3ZA 3JX9A 4IXDA 2Q5EA 2CE2X 4L8FA 3EFOB 2AFHA 4EO7A 4EVRA 2O4CA 4F5YA 1AXRA 3NYWA 3ZV5A 1G9SA 4F5EA 3R3XA 1N2CB 3T35A 3MRTA 1A5BB 1T3TA 1QGUA 4MI6A 4C0HA 5H9WA 4XDGA 3BRWD 5ER9A 1PJQA 1CCWA 1NQOA 1SBIA 1UDCA 3I04A 4M0DA 4BBZA 4OBWA 3NM5A 3HOUI 3BSSA 3WOVA 3OQMA 4HR7A 1QXFA 2IWRA 5FBWB 4BX9A 3G6E1 3AONB 3TAXA 1Z7YA 1I0LA 3OCVA 5L6MB 2B8TA 5GM2A 4C78A 1P18A 4DS3A 1E9RA 1H2XA 3BB4A 3CWCA 1PEAA 1C9EA 3HSYA 1VIVA 2B4KA 2W22A 3JPWA 4GPBA 2W2KA 1YQXA 2QU8A 3GCWA 2PT6A 3LS2A 4IQGA 3K5PA 5FTJA 4F45A 4CT5A 1WDTA 5SY9A 1G18A 1T5DX 1XYGA 1KERA 4X20B 3SS7X 3ZDRA 3O31A 3U37A 4IDQA 4Q3EA 4M2LA 2OC9A 5B1SA 2C2MA 2QYTA 3DM5A 1MV8A 1SR8A 4YJGB 5GP1A 1WW9A 1QHFA 3N74A 4PAOA 1IFXA 4X92A 4F2WA 4LZNA 2E5LB 4BC0A 4ECAA 2GVNA 5CFZA 2A59A 2PRSA 4QWMA 3W2TA 4UC0A 1D4OA 2IEIA 1AQNA 1I4WA 3SEFA 2GEFA 1EJ2A 1ZI6A 2PT9A 1G5IA 2R5FA 3OX2A 3U2QA 5JLAA 1FNSA 4N9QA 4JUIA 2OCKA 4WT7A 3VH1A 4YUZA 1EJBA 1OREA 3DBRB 3TOZA 2PIDA 1WUTA 5D86A 4QQKA 3ASYA 4YC7A 4AL4A 1KPGA 4LXTA 4NZNA 5KOJA 3H11A 1TEZA 4C2UA 2VXCA 3DS8A 1FMCA 5LBIA 2WKPA 4E2ZA 2V7XA 3ZTTA 2ZI9A 5FBHA 4N6GA 1ODFA 3M4JA 1KEWA 4A1OA 2G9RA 4R4JA 1GUAA 2QUIA 3ESYA 3P9NA 2WT4A 4DR7B 4J94A 4QXOA 5JAIA 4KTVE 1G3MA 2J5BA 1DBWA 2PEYA 3IIEA 3U7EB 4JQSA 2IXDA 2LNDA 2E1RA 4YAUA 2WYOA 3OIGA 2PT7A 3COZA 4F9EA 1IVNA 4FFBA 1DJNA 2QJWA 1S89A 3GEDA 3GRKA 2FEPA 2X23A 3DQZA 3H17A 2XVYA 3WIOA 1XL1A 3HZRA 2O1EA 2NOAA 1H05A 1KMMA 5DK6A 4CNBA 4DSNA 1Y9AA 2P9EA 1TGYA 3EXEA 3ZX5A 3QXHA 5B3AA 4QD3A 2IF2A 1KJZA 4NBUA 3MWKA 1GY8A 9LDTA 1LU9A 2GPSA 3OQJA 4ZVNA 3UQYS 4LZWA 3Q40A 4PPGA 3FDZA 4M55A 3JVVA 1WMEA 4G5GA 4MD7A 3E58A 1TO6A 4HB4A 4MA5A 2RK4A 4GUAA 2R60A 2XMQA 3R0JA 1C9JA 4R01A 2HDHA 4DMMA 3CKKA 1O08A 3MF4A 3TM5A 2UZ4A 3WK5A 2OG2A 4QGHA 2QRUA 3ETGA 1YMQA 4DRZA 3RS4A 3HRKA 1QS0B 2IXGA 4MWGA 4LBVA 1EP2B 1RWKA 2OFXA 4UREA 4ZO8A 3RU3A 3SC6A 2A3NA 5J58A 2Q3HA 4QTXA 2J7PD 2H7XA 5CM8B 5HDBB 1RZVA 1EUDB 2EKBA 3RKRA 3KJFA 4PLGA 2WTUA 4HX5A 5C3MA 1CF2O 1MDBA 3IXMA 3VO9A 4G8BA 4EHFA 4H6VA 1CVIA 2J8ZA 2BRUA 3AVVA 3HJTA 1ABEA 2JLCA 3IXLA 3KUDA 4BP9A 2MSLA 3ZD7A 1WJ2A 1SHKA 3PHJA 1H4SA 1X7YB 1KMHB 2FPIB 1Z4IA 4IO0A 3R8FA 4IR7A 1FS4A 3DKIA 1S4MA 4EJ6A 3JWHA 4NQRA 4UASA 1ZMXA 3Q10A 2V58A 3LA8A 4PAMA 2C96A 1UXGA 5AW2A 2NADA 3S2ZA 2OPBA 5FTNA 2B1GA 4G0ZA 4KQMA 2Q6VA 1A95A 3AETB 4I4TB 2BTEA 2QEQA 2QJFA 1AK2A 3VI3B 3WLFA 3W3AH 3E9RA 3LE8A 1OXTA 3GLFE 1JIKA 3BK1A 1USPA 3GZTB 1H8HA 3V9PA 1F8UA 2ZI7A 3HMKA 1CJKC 1XBTA 3IQFA 3OZBA 4IWNA 3QLVC 2FWBA 4MNTA 2W2QA 2KX7A 3T7CA 1M2VB 1R12A 1L1QA 4DSAA 4TV9A 1T5OA 3CRMA 4TMWA 4X45A 2WINI 2PZKA 4GDFA 1D4ZA 1I36A 4X3OA 4NE2A 3SF8B 4Z0NA 4D81A 4XOIA 5E7IA 7AT1A 3FOCA 3H0KA 4EPVA 5BNTA 2KBFA 2YZGA 5TPZA 2DERA 2CL7X 4QNRA 4R2KA 1W94A 4UEKA 2E4VA 2DBVO 4RHEA 5KOIA 2ID8A 1EXVA 3RFTA 1N78A 5IKEA 3A10A 2CNKA 3HVUA 2O19A 1T0HB 5CT9A 5GONB 3NAGA 3MJHA 2OO5A 2GLTA 1QRAA 3M81A 1U2GA 1F2UB 3EMDA 3IA2A 1EX7A 5DNDA 5EMNA 4QUJA 3WYBA 4CKXA 1EVJA 1JPUA 1RABA 3KVVA 2G9ZA 3VYRB 4ZVQA 1Z17A 1U0TA 1WPRA 1LZLA 4O4JF 5J59A 1TIBA 2IIPA 3V46A 1DBIA 4YUXA 5C80A 2C42A 4I1VA 1M7HA 4DMHA 1FTWA 2I4NA 4G5RA 4WRRA 7ABPA 5LM3A 3INNA 1OWOA 4HNRA 1ZD2P 2WTAA 3L9XA 1XTTA 4NL4H 3O26A 3PU6A 4ZU3A 4CIAA 2EDAA 4KNWA 2ZPTX 1VL1A 3OMXA 4M9QA 4DA7A 1CZHA 2O4UX 1K2WA 3GELA 3IMEA 4PF1A 1GVHA 1FDOA 1GZ3A 3V7WA 4F46A 1F48A 3PDWA 3ROEA 2FMFA 2XE6A 2H8GA 4TROA 3VTKA 3LO8A 2B99A 5HIMA 1A9ZA 3CW9A 3FVVA 3W5CA 1GM5A 4PVDA 4BNZA 3C41J 4YAOA 4KHPB 2GA9A 3WGGA 3L06A 1GNRA 5LA6B 2P9BA 4O1HA 1GUBA 4TQUS 3VTNA 1B3BA 3BJZA 4IFBA 3UIEA 2H63A 1OLSB 2ZRIA 3OLXA 1S7MA 4MYCA 3KJXA 3PX2A 3IHKA 5DJ5A 1RM3A 4TLAA 5KNLA 4HNQA 4RCZA 1OD6A 3AJEA 3OBIA 3OEYA 4LOLA 4OP1A 1U7XA 4ZV4A 4KV9A 3T4PA 4EY3A 5JMOA 3DFKA 5LLTA 1QU3A 4R0VA 3SX4A 4E3ZA 1UM8A 5JZVA 1QONA 1H6AA 1V11B 1W47A 1XNJA 1O1YA 3CC21 3EEFA 4P58A 4TWRA 3UICA 1A82A 2VP3A 2RE8A 3VGPA 4BP3A 1JT2A 2CKDA 4EJ2A 2QTZA 4LWOA 3LY8A 3TKYA 3TL3A 3THXA 3I6MA 3QKTA 3STXA 5KB3A 1ZINA 2VQEB 2O2EA 1NMYA 4KXNA 4RWEA 2AJLI 2R4QA 2P41A 4J91A 3ND6A 5AVUA 2WWFA 2XYHA 4LA4A 4Q4HB 2C8LA 4U5XA 4TUYA 4ZCIA 1DIOB 4DM7A 1XYVA 1UCFA 4CHGA 4C21A 3HFRA 3K94A 1E3LA 1HTWA 1UOEA 5DBIA 1I3KA 1AO3A 4EGQA 1ISJA 1LJLA 2C59A 2R62A 4UZFA 3FMGA 3JY6A 2GEKA 5M7EA 4PANA 1VECA 3UV7A 1Q3KA 3ZWMA 3IO3A 3C8MA 5K0BA 4K8OA 3ETLA 2WY2D 4YXWD 4AB1A 3WKDA 4P80A 5FT9A 2AWOA 5A2QA 4BUZA 3DZKA 1TZCA 1WVMA 2WZDA 3JASA 1FBTA 2R48A 5GZ3A 2C8VA 1CDDA 3D7SA 3AHFA 1PYGA 3VR6H 4UHKA 2FNAA 3GJTA 4YDQA 2W6CX 5G3YA 4YHHB 2B61A 3ZI4A 3A4IA 1F6WA 1VDMA 4ZREA 2EX1A 5BURA 1LF0A 2FPGA 5JXIA 4TXNA 4C08A 1JEYA 3VC1A 2TMGA 1VRWA 1JXOA 2CXPA 3PC8A 3JTEA 1TZJA 5JQWA 3IDZA 1NNSA 1CNFA 4UQOA 6REQA 2EV9A 1I0ZA 4RTJA 2RBLA 4E70A 2EWMA 2VSYA 1DBPA 1RHJA 1MJHA 2E49A 2F90A 2GVZC 2Q3BA 3KKQA 2PGJA 2YUIA 4PAGA 5EZQA 5FI1B 2I6QA 1OJ7A 4FSHA 4AZ0B 5T41A 2FWIA 1B73A 4O59O 2ETXA 2X4DA 4AKEA 1C4XA 3PQEA 4NYMQ 4BN5A 3QYFA 5H7XA 1TYCA 3PJRA 5DCYA 3NQ41 2GJAA 4B3GA 1NR7A 1ODIA 3KEQA 2QOEA 3CVYA 1T3LA 4WUVA 3ANLA 2P90A 1TYZA 4WVLA 5HRCA 4JGGA 4IS3A 1RWNA 2KMLA 4ARVA 3HZOA 1AHIA 4NJEB 1Y9EA 1WUYA 4XW2A 4YAEA 5FWYA 1U0EA 1XKXA 4C7OA 2CFRA 2HPAA 1YFZA 1NATA 4CVNA 4N03A 3FCEA 3KIFA 2JI6A 1PGNA 2RGNA 3E3NA 3I1IA 1LRLA 3JWJA 2HSWA 3NBXX 4MI1A 1W73A 5EHIA 1Y81A 2E1PA 3RYHA 4G4GA 1F8XA 2HIHA 4Z51A 3KKNA 2REBA 1QP7A 3Q8KA 1QG4A 4LE1A 1ODSA 2UU9B 3T5DA 4C4XA 2GF9A 1JA9A 1UJBA 2PUTA 4KYTA 2Q3DA 2XOXA 3WWEA 3UHJA 5SY4A 4ZGGA 3UC9A 5F1KA 2FLWA 2RKOA 2P75A 1TRKA 1X1SA 3BJIC 4ZXPA 1C4WA 1FRQA 1XXLA 2BZGA 2EERA 3AJ9A 4OJMX 4EFLA 2VPPA 1XTIA 3UJ6A 5JYCA 5K6AA 3UV3A 4BMYA 5CD1A 3STUA 2WV7A 2XYRA 2OP1A 2FFAA 1QMGA 3CSDA 4H0NA 3DBOB 4OFBA 3H99A 1VQ5Z 3KPUA 4FJ1A 2ZOSA 1Y6FA 4TWBA 3CUYA 1KSFX 3O2QB 4LGMA 3FYUC 5DLQC 3IB6A 1TT7A 1MP0A 2GCOA 4YCMA 2HPVA 1T6BY 4KQ2A 4PPFA 2R6CA 2QQEA 2O2IA 3ABQB 3W5IA 3OFND 3H2IA 3N8IA 1TUGA 4ZVLA 4R71A 1YIDA 1QYWA 3DZCA 2PX4A 2P5SA 3ZY4A 1IG3A 4EPWA 1Z3IX 1G20A 1G5RA 3V1KA 4F3CA 2MYNA 2P6OA 3OZRA 1DQYA 1HDYA 1W4LA 3PDHA 1L7MA 4Z3DA 3L18A 4X8HA 2RC5A 3K6JA 2Y2UA 1NY6A 2AHRA 2QRKA 2VNHA 1VJ5A 5C5IA 7ADHA 2XUPA 4MWBA 4A92A 4QO7A 1Y48E 1GAQA 2FSSA 2WD9A 3KK0A 4XOUA 3AEQB 2ZJ7A 4Z9YA 5I4BA 3WWOA 1HZZC 3MRXA 1N36B 5IZ4A 4HQFA 4II3A 4TLBA 4H59A 2W11A 1YZLA 4YRMA 5TQ2A 4LYAA 3A06A 2QRVA 4GZ3A 3RTGA 1CG6A 2Z1DA 1N0WA 1OC4A 4UE2A 3RS3A 2FQWA 5U4XA 5A2Qf 3D3WB 5K2OA 4ER3A 2JGKA 1GL9B 2FPPA 1BFDA 3GFFA 3GNSA 3OU2A 3NX4A 3RGWS 1J8MF 3V8VA 5IK2A 4F1JA 1GTSA 3T94A 1KFKB 1GRQA 4O08A 3CSSA 4MS4A 5D8DA 2AFVA 1FX1A 1P39A 4NV1A 3P45A 3S1NI 1EDBA 4X0EA 4MRPA 2OXEA 1QXSA 4TWJA 3VPDA 5K0SA 5A04A 3HCDA 2PD4A 4RIFA 5A3VA 5BOSA 2DYKA 2ISQA 4KX3A 4IG9A 1CNEA 1VLJA 3LKZA 4WLFA 2Y1EA 3MILA 4Z2YA 3EBOA 3EZ6A 5A3SA 5EHQA 3RZOI 2R8ZA 4UVHA 2F9LA 4NX2A 4F4CA 1JPVA 3BHJA 4DN6A 5EJ8A 2O8CA 2AA3A 2L69A 2ZYRA 5F23A 1P62B 4WZBE 2WT8A 1F9EA 1YV9A 2BMJA 4POOA 1SVUA 1VLVA 2I54A 4HGQA 1NVXQ 2OQ2A 3IQXA 3HG7A 1Z36A 4E4TA 4B6EA 2PK3A 4PSCA 5EKSA 2HRBA 4I6EA 3NOXA 4UDOA 3VNRA 3TRFA 2YXBA 3W0LB 3AI1A 4BNDB 3V4OA 3QKIA 4CM9D 4EJSC 2WAYA 2QBYB 1N33B 4NOKA 4PBRA 1TL7C 1IH8A 2H9IA 4CRWB 4A4DA 1Z6QA 3WNBA 4B1FA 1B2RA 5HE9A 2LIYA 1OAKA 1PZHA 1NDQA 1YUBA 2BY4A 1NWCA 3IB3A 1UADA 3ZV4A 2X5OA 3WLNA 1MW8X 2P0AA 1ZO8A 4H7KA 3FHJA 4UNIA 4P4SA 3PQDA 4D43A 1FY2A 1YRQA 4PFKA 1LJ8A 1VSUA 4RDHA 1XZHA 3NHKA 1QMPA 1IZ8A 2DX7A 2ORIA 4D8XA 4DBZA 1X3WA 1IPEA 4A93I 3NCTA 3AU8A 2IRWA 4XWAA 2QQ0A 3L05A 2PUCA 3GJRA 3OQVA 3USES 2J85A 2FEMA 3KR1A 1G9XA 3B1VA 1YIT1 1DINA 2RSLA 4X7RA 4MTLA 3N2IA 3NYIA 4JKIA 1E8NA 1DXYA 1OROA 2R8XA 3KALA 4U7HA 4MMZB 1UDAA 4HDMB 2AOTB 3JQAA 3BKWA 1MX9A 1L5YA 2P65A 3WHPA 4RZ2A 4CR6A 1D5WA 1KVRA 1Z07A 3DHEA 1XRNA 4UM8B 2DE7A 3LM8A 2OT3B 1EH5A 4V38A 4MQMA 2L17A 1FFAA 1N0HA 1XZMA 2IGBA 2VUIB 1FYVA 2VYVA 3CRZA 3M4XA 1IE3A 4OMFG 4ZRMA 1OWMA 1PT9A 2JLRA 2ZBQA 2IV2X 2JJMA 4HYQA 3PGKA 3KOZA 2GK7A 3JARB 3M1LA 5K8UA 4KLCA 2JBWA 2HF1A 1SU8A 3DTTA 5G41A 5C1DA 4Z4FA 1KQNA 5CM2M 3HCFA 2NP6A 3IUSA 4MINA 2O8VA 3NPAA 3G1WA 1W88A 1G6OA 2CWWA 2VP0A 1DGQA 3DR5A 5A1JA 4V3CA 4ZAFA 4NYJQ 5TQJA 3DH0A 3TTTA 1XZGA 2I2DA 2V7TA 1Z5WA 5LLDA 4LF8B 1E77A 3HVJA 3T5CA 3PR3A 8ADHA 3GBPA 3J80A 2GPYA 1U3UA 2WYIA 1NW9B 3RHSA 3CNHA 3RRJA 3F46A 1VQK1 3P19A 4M8SA 4QDXA 5EIEA 5IDWA 4IIBA 4K03A 2R8YA 2Y6VA 4IOJA 3G2LA 2FU5C 4FFDA 2CLSA 4NEGA 1L3BA 1X70A 1RI2A 1ONBA 5COBA 4YMSA 4QE3A 1KRHA 5AW6A 4V0OA 1KMQA 1LV8A 5EJIA 5JRJA 3NHYA 3F7TA 4B74A 1M7BA 1F4LA 1VL2A 4MUAA 4D8YA 4ZDIA 2HAEA 4XYBA 1B0ZA 2R5WA 3A1WA 3EISA 1U8UA 1ZMBA 3TL2A 1M1ZA 4XVQA 4QXRA 4CKCA 3PNBA 2ODAA 4DJ5X 1YBVA 4MHSA 3A27A 5IP5A 1YULA 4FWIB 2PMCA 1QJ4A 4DB2A 2ZI3A 2BE9A 3DDHA 1V3QE 2FMXA 3HCOA 5AVWA 1G5QA 4E3WA 1XNHA 4AS3A 2AQ8A 3JQFC 3C0KA 5C53B 3KXIA 3B5JA 4HEQA 1G5TA 3PRYA 2P2ZA 1QZ3A 2W8BA 1WXWA 1YRBA 3IQEA 5CB4F 1A9SA 2E82A 3BHNA 3OP4A 1E96A 4KFSA 4NABA 3SQWA 3NGXA 5ED4A 2Z4TA 3QOWA 4PO3X 2DG2A 4WXHA 4ON9A 5L6LB 1YC2A 3Q7TA 3QVKA 1MBZA 4KFRA 3S1AA 2IYTA 1UFOA 4MIYA 2RGAA 4EY6A 5JNVA 3IRVA 4PC1A 5ADWA 1QFYA 2AFHB 2JAHA 3W77A 1GKKA 4PC3A 3GAZA 3GDOA 1XD9A 3IEUA 4MKZA 1DRJA 2YVUA 1P1IA 1TU0A 4FT2A 5JXWA 2IF0A 3QEJA 1RLUA 4LMRA 4RMIA 3RVKA 3PGXA 1QGUB 1YRHA 2CXUA 4YPOA 4B2PA 1YHZA 4OHUA 2P2GA 1T3HA 3HA7A 5CGZA 4K1XA 2AW5A 1E79A 1J9ZA 1H8HD 2JH8A 5F5LA 3HBLA 3A05A 3KLBA 5CFMA 2V7VA 2YC2C 4UCFA 4H27A 4JJ8A 3AOGA 2QX7A 3L8EA 4HH3C 2Q0HA 3W8DA 2W2KB 1PDOA 3TDHB 5B7PA 2YKGA 5ENZA 2CT8A 2VDVE 4ISCA 5EI5A 1KYWA 4IJQA 3IMGA 1ZN9A 3CPSA 4BUCA 4Q21A 4BC1A 4EG5A 3PPVA 2L42A 3ITDA 5TPZD 1NOJA 5CLLA 5CW1A 2AYDA 2O8FB 2IZ7A 2VQFB 4H1HA 1J2EA 4M4SA 5F7JA 3M3DA 3OZXA 1SXGA 4LBWA 4JI6B 2JVIA 4E1VA 1EA7A 5I3ZA 5CXQA 1EK0A 3E8MA 2DUNA 4EG4A 4ZEVA 1E60A 4RDCA 3SVZA 4EJMA 2XAAA 4H7HA 3AF3A 4AMGA 1PFVA 2A92A 4YP7A 3CEJA 1CRZA 1NTOA 5T4FA 3FKII 1JHQA 3ZW8A 1ZK4A 3AM4A 3KDAA 1M1YB 1ZZGA 4HAZA 1NUSA 1P4GA 2G0TA 3SVLA 3LL7A 5KOJB 2A7QA 3H11B 3TE7A 1ZBQA 4DCUA 5HJEA 1PJ3A 5SYNA 3G71Z 3J80f 16PKA 3CN9A 3KO8A 5AM5A 2JJYA 5F7OA 1NVGA 3IURA 1UBNA 5C4XI 1VQ91 1M6YA 1LRKA 1U2RA 5DT2A 4AWAA 2B5OA 2XTZA 4YMLA 1V8FA 3GFRA 3VSAA 2CL6X 4J1TC 3V4ZA 4NCHA 4MRMB 3TN7A 2OE2A 2NSDA 3UBTA 1RZRA 3MSCA 5T3UA 4FFBB 3VRHA 3CLSC 1R37A 1AKQA 1VFPA 1TE2A 2BN4A 2G9VA 4RV5A 4XGKA 4A0QA 5I9IA 4DEXA 4DANA 4GL2A 2AG8A 5HCIA 1CVRA 1FCJA 4EO4A 3GA5A 5E6UA 2Y0CA 3EVGA 3U19A 4XVUA 4QXPA 5HJ2A 3VYVA 3R9WA 4PWZA 3D3QA 4EI7A 1KOGA 2W6JD 4D9JA 2AR7A 4K05A 3FDZB 4ROSA 5UKDA 1GITA 2M2IA 4H60A 5P21A 1QGOA 2TMYA 4MKFA 4CIBA 3SQOA 4HDSA 1KK3A 2A9RA 3V80A 1E5DA 3OJXA 1FUIA 1E5VA 4K6KA 1TA4A 2AJTA 3S1MI 2GK3A 5CCEA 5E2BA 1TLFA 1VLQA 2Q1XA 3AVWA 3KQVA 5JS7A 5KDLA 1YHQZ 4IJMA 5AIBA 1K92A 4KCGA 4CTOA 4DF3A 2ZB7A 4WGGA 3HR7A 4KO8A 1RPZA 4C0SA 1HDRA 1M34A 2QJOA 3PXBA 2FN9A 1OU0A 3T61A 1QB7A 4CMKA 4EA6A 1NQVA 3N53A 1CS0A 3OQIB 4HB3A 4RMHA 1YFLA 2I8AA 1NBOA 3LQFA 1K4KA 3NEYA 4NEHB 2A7XA 5IC4A 3WFZA 1VOTA 4LRUA 3KKOA 2SICE 5JJBA 2BGGA 2ANCA 1Q12A 1Y1QA 5HF9A 4KQXA 1ADGA 4U3JB 2WHQA 2WSBA 2X3UA 4L3WA 1PR5A 1R3UA 3VYTB 3ELUA 5D3ZA 5CA1B 3N8HA 1KC1A 1PUXA 1RXWA 2H1LA 2LTAA 2QUZA 2SHKA 3AX6A 5H82A 3A70A 5H59A 3RARA 2KI5A 3HKBB 3RV3A 3SYNA 1JA1A 3HZHA 1L5FA 4GH5A 5EAIA 5BSHA 1SIBE 1PVVA 3X2EA 4JUCA 3DBVO 3RAGA 1UXJA 2IHNA 1VG8A 2AQIA 2VBIA 4TT3A 5B1HA 2F8MA 1PK7A 1OUMA 3I3OA 5CVCA 3SXUA 1USPB 3U44A 1VCHA 1HLPA 5CIWA 4E2XA 1A4RA 2QZZA 4IMIB 2AKAB 3DMRA 5SZHB 2OO3A 1E99A 4TV9B 4IDHA 3PWZA 3NOQA 1L4LA 5HQ3A 2I4MA 4YRNA 1NI3A 2AJBA 1AQUA 2G40A 1KAMA 3W5VA 3ZDCA 1USWA 2NACA 4Q16A 1OVGA 4QDUA 1I6LA 2OY0A 4C6TA 3AI2A 4AUKA 1F0NA 1SVNA 3ISJA 1X94A 4OOEA 3HVIA 3H0EA 5J1TB 4EW2A 4YRQA 2IYWA 4IQ0A 4K9LA 2QQ5A 3ACBA 1AKVA 2AUMA 4L0QA 4OMDA 3F6EX 4OHPA 5CB0A 2FMUA 5CM2Z 5A7FA 3GU3A 3HY3A 4OU5A 2PMEA 3TIFA 1DRVA 2O23A 4N76A 2HWWA 1CXZA 3OQBA 2GN6A 3HHPA 1OR8A 2FW7A 1XEXA 3O9VA 4GPD1 4C2AA 4XQCA 4HH0A 3G49A 4O0MA 1MAWA 4RS3A 1XJQA 3IE2A 4F9FA 1KVTA 1MVOA 2CLEB 5FWDA 1RW4A 1R15A 2OBBA 1NMEA 1QQ5A 5DBHX 3A6JA 2OFPA 4RVNA 1EVEA 1UMCB 1J24A 2D54A 1IN7A 2O9JA 2J0EA 4B43A 3O1JC 1XG5A 1IWBB 3L4SO 2AN4A 3Q7SA 1TA9A 2Z2YA 3TPZA 3UHOA 1VA5A 3DE2X 1N77A 5FWXB 4KX5A 1X1BA 5DDIP 3V32A 5LQJA 4MD8A 4D9NA 3VAZA 4K9RA 1ATZA 4PZ9A 2RJNA 1JTVA 4LEIA 4X94A 1TTHA 5BWLA 1U8XX 2H2FA 1KEZA 1DEKA 5LKRA 4L5BA 1U7HA 2XUZA 3NR2A 2ZCJA 4ZCRA 3JYQA 3ZCPA 2Q1TA 4HDKB 4R1OA 5FL3A 5KX5A 2HB6A 1MORA 3BMOA 4G36A 4AXBA 5D1PA 3UWDA 1FP7A 1BEEA 1W0CA 1ONPA 3OX1A 4IF4A 2B4AA 3D3KA 4MUBA 1YNOA 5AK3A 3ZG6A 3LPLA 4K9QA 5I7WA 1JAXA 1NFFA 1KK0A 2EEZA 1WZ2A 1XTBA 2Q9UA 4EHJA 2ZJOA 3SVTA 3GLIA 1DZ3A 1LJUA 2QQGA 3I9MA 3HNRA 2HWKA 2I4TA 3RREA 2Q1SA 4KYVA 4NBCA 2I1LA 5IDYA 3UXMA 3EQ7A 2XCSB 3ZXUB 4E2YA 3WL8A 5IHXA 2OLEA 3THXB 1JEJA 3L04A 4GKVA 3CBQA 3Q3HA 1UPAA 3NP9A 3EGIA 5FLYA 5K0NA 1E4OA 3JQDA 4PSDA 4KAAA 4TMXA 4P53A 5ALMA 4DDVA 3ASZA 5KYXA 1IBSA 1ZM2A 1BA3A 2PJZA 2ZRJA 1Y8QA 3RGGA 1R6DA 4TUYB 2HWUA 3PE4A 1S01A 4NICA 2G4VA 3FVQA 5G1PA 1FFBA 4YT2A 4P9NA 1XVUA 4A8PA 4FZVA 2VWGA 2QXYA 1H2HA 3IMCA 3OCXA 1TJ4A 2EFYA 2D5LA 3P8ZA 5E9QA 3P1JA 1CY1A 4ZHQF 3C7TA 4YAIA 2GYVA 4ZVKA 2FOXA 3RPEA 2O3JA 4ADSG 4ZJUA 3R75A 5IK2D 1VBMA 5DEIA 3INYA 4AP6A 2D5AA 4CLDA 1CQPA 4IDFA 1Z01A 1PHRA 1T9HA 2AX3A 2GEJA 1QTIA 2VXYA 3EDMA 3MUEA 3QH4A 4Z0TA 4WADA 3QITA 1EK2A 1S8NA 1PP4A 1PBNA 3JASB 2JCXA 2NT4A 3O8QA 4RJ2A 3FVTA 4F3RA 1D6JA 1NP7A 3B89A 2WMNB 3E7PA 1XXHA 4R2JA 1O54A 2DH5A 4S0ZA 3QVSA 1N5LA 4Z9FA 2YRFA 5K8VA 3FGOA 4ALJA 5COAA 5A4IS 1IY9A 2PSHA 3KWMA 2NV6A 4Q7JB 4TQ9A 2GCGA 4LMAA 1YMVA 3HBMA 2KSQA 5J4LA 5ANRB 5ADHA 4H08A 1AC5A 1AS3A 2BKEA 3ND5A 1UWVA 2V4UA 3KEGA 3L4BA 1GOTA 4O4IF 1AKYA 3DPSA 4RV4A 4DADA 1IBMB 4XLLA 3ZCQA 2A88A 3HFGA 4ZQBA 2GCNA 1XQ6A 2OO5C 3R3ZA 1FFWA 4X60A 5KHAA 2QE6A 2FX3A 1JFVA 2P91A 3DC2A 4PC2A 1NW3A 1Y6QA 4JC4A 4X7MA 3AKCA 1Y1KE 3HP7A 1Y42X 4YLGA 1F2TA 4PYRA 5EE3A 3TOSA 1KFJB 1VQ8Z 1V45E 4EGSA 2RT9A 3PWKA 1C9YA 3F73A 4HG2A 3WGMA 1GU7A 1O9HA 4C7OB 3Q8XB 5T4HA 2LKDA 3PDIA 3GJ6A 4OY3A 2V54A 4TTAA 1W581 2ZE8A 3DAHA 1EHCA 2QKDA 1RYDA 1PQYA 3K0BA 3PHBE 4U1RA 4Q9KA 3RYHB 3WMEA 4B6RA 4C1BA 1DEAA 1Z28A 3KB2A 3MOGA 2GZRA 3K6SA 3HU1A 5BW6B 5FO1A 4XIJA 1KQGA 5EKTA 3UMBA 1Z38A 5CIQA 1ADJA 2J3HA 4PR3A 4ITRC 1ZEMA 4A8JC 1KH1A 3S81A 2MMGA 2J6BA 4BVHA 4IJ5A 4NU5A 1L1RA 1K5PA 4WTOA 1JWHC 2VJPA 1CJVC 3FQQA 1XPOA 4LWQA 4GEGA 2QP3A 1ZVMA 5IP9I 1JAIA 1GQRA 1KE2A 1KH3A 4EBFA 2KW5A 1Z5ZA 1CEXA 2D8MA 4KQJA 4KVZA 3CTPA 2XVMA 3LDHA 4FOLA 1OH5A 4A3LI 3FGPA 3OCCA 1A2QA 4DV6B 1QNLA 1W52X 1ADYA 1K5HA 4B75A 3BX1A 2IDKA 5HRUA 4A9AA 2VYVD 3TOCA 2P27A 5JDCA 1L5RA 3QZUA 4ZCQA 2O3TA 4M1OA 3AINA 2PUVA 5JASA 2F1KA 2HL6A 1FSSA 2QMEA 3T6KA 2ZRLA 1TZBA 5EQFA 4H0FA 4F84A 4PLZA 2ZTSA 3WRXC 5BQFA 5IDXA 4YGYA 3B3AA 2XGSA 5K2MA 2VHYA 1KYZA 3FRIA 3JR3A 5JNTA 1AGXA 1HQDA 3HJRA 3IOEA 4AG6A 3PNQA 2JAPA 2B8WA 3GH1A 2O2JA 5LNK1 2X13A 4W1QA 4O8ZA 3VOAA